DEMOKRATISCH – LINKS

                      KRITISCHE INTERNET-ZEITUNG

RENTENANGST

Archiv für die 'Umwelt' Kategorie

Missbrauchte Lebewesen

Erstellt von DL-Redaktion am 13. Dezember 2019

Datei:Schlachtung5.jpg

Von Hilal Sezgin

Dass Tierversuchsanstalten Untersuchungsergebnisse fälschen, dürfte kein Einzelfall sein. Bundesweit gibt es immerhin mehr als 700 solcher Labore.

Genau zwei Monate ist es her, dass die Tierrechtsorganisation Soko Tierschutz heimliche Aufnahmen aus dem Innern der Tierversuchslabore der Firma LPT veröffentlicht hat; und wie viel mehr ist seither ans Tageslicht gekommen! LPT steht für Laboratory of Pharmacology and Toxicology GmbH & Co. KG; diese Firma unterhält in Hamburg und Umgebung mehrere Labore, in denen Pharmazeutika und weitere chemische Substanzen an Tieren auf Giftigkeit getestet werden.

Noch vor wenigen Jahren hat die Firma auf ihrer Website offen ihr Leistungsspektrum dargestellt; angeboten wurden Tests an Mäusen, Ratten, Hamstern, Meerschweinchen, Kaninchen, Hunden, Affen, Katzen, Schweinen, Fischen und Vögeln, und zwar mit folgenden Methoden: oral, intraperitoneal (in die Bauchhöhle), intravenös, per Infusion, dermal, per Inhalation, intravaginal, intrathekal (ins Rückenmark), rektal und per Eingabe in den Augenlidsack.

Solche Giftigkeitstests sind zwar bislang vorgeschrieben, aber zumeist nicht genehmigungspflichtig. Ihre Durchführung verläuft im völligen Graubereich, wird fast nie durch Veterinärämter kontrolliert. Der gemeinnützige Verein Soko Tierschutz hatte einen Automechaniker als Tierpflegehelfer eingeschleust, der berichtete, dass sich unter seinen Kollegen nur ein einziger ausgebildeter Tierpfleger befand; die anderen waren Schlachter, Mechaniker und ein Militärmusikant.

Sogar wenn solche Versuche ordnungsgemäß durchgeführt werden, ist ihre Aussagekraft mehr als zweifelhaft. Wenn Sie Hund oder Katze besitzen, wissen Sie, dass denen Schokolade giftig werden kann; Eichhörnchen knabbern unbeschadet am Fliegenpilz. Dass Contergan Fehlentwicklungen am menschlichen Fötus hervorrufen würde, konnte man aufgrund der vorherigen Tierversuche nicht ahnen; jedes Jahr müssen Medikamente vom Markt genommen werden, weil sie sich im Tierversuch als „unbedenklich“ erwiesen hatten, bei der Anwendung am Menschen aber nicht. Zur eigenen Sicherheit, also um teure Ausfälle und Schadensersatzforderungen zu vermeiden, testen viele Firmen längst nicht mehr nur im Tierversuch, sondern zum Beispiel auch mithilfe von Zellkulturen. Dass das Gesetz immer noch auf dem Tierversuch beharrt, ist daher ohnehin antiquiert.

Ausgeschnittene Tattoonummer

Im Falle von LPT meinte der Soko-Mitarbeiter zudem zu beobachten, dass mindestens einmal Daten gefälscht wurden, damit sie zu den erwünschten Ergebnissen „passten“. Diese Anschuldigungen wurden seither durch ehemalige Mitarbeiter des Unternehmens bestätigt. Der frühere Leiter der Hämatologie sagte gegenüber dem TV-Magazin Fakt aus, dass in einer Krebsstudie die Organe eines verstorbenen Affen ausgetauscht worden waren: „Man hat die Tattoonummer, die sich im Brustbereich des Tieres befindet, ausgeschnitten. Diese hat man nach dem Ende der Studie den Organen des ersetzten Tieres hinzugefügt.“ Ein weiterer Mitarbeiter erinnert sich an Manipulationen von Fakten, die bereits 2005 der zuständigen Hamburger Behörde gemeldet worden seien.

Damals ist anscheinend nicht viel geschehen, doch vor zwei Wochen wurden mehrere Labore und Geschäftsräume der LPT von Staatsanwaltschaft und Veterinäramt durchsucht und anscheinend wurde umfangreiches Material mitgenommen. Mehrere Firmen haben Aufträge ans LPT zurückgezogen; das Unternehmen selbst verkündete, ein Labor zu schließen. Mehrere Großdemonstrationen gegen Tierversuche, an denen jeweils bis zu 15.000 Menschen teilnahmen, gingen voraus. Dem steht bisher ein großes Schweigen deutscher Forschungseinrichtungen und des zuständigen Berliner Ministeriums gegenüber.

Quelle       :         TAZ           >>>>>        weiterlesen

———————————————————————-

Grafikquellen      :

Oben            —     Schlachtung auf Burg Loket

Urheber Straktur

Ich, der Urheberrechtsinhaber dieses Werkes, veröffentliche es als gemeinfrei. Dies gilt weltweit.

—————————–

Unten       —          Peta  —     dinamicline [CC BY-SA 3.0 (https://creativecommons.org/licenses/by-sa/3.0)], via Wikimedia Commons

Abgelegt unter Deutschland, Ernährungspolitik, Positionen, Umwelt | Keine Kommentare »

Der gewagte Green Deal

Erstellt von DL-Redaktion am 12. Dezember 2019

Von der Leyens gewagte Mondreise

MoonClouds.JPG

Seht nur die kalten weißen Haare des Mondes von Wanne-Eickel

Von     Eric Bonse

Die Kommissionspräsidentin setzt beim Kampf gegen den Klimawandel auf Förderung der Wirtschaft. Die EU soll Vorreiter in der Klimapolitik werden.

Die Europäische Union will eine globale Führungsrolle im Kampf gegen die Klimakrise übernehmen – mit einer „Wachstumsstrategie“, die auch die Wirtschaft ankurbeln soll. Das kündigte Kommissionspräsidentin Ursula von der Leyen in Brüssel an. Es war die erste große Entscheidung seit ihrem Amtsantritt am 1. Dezember.

„Der Europäische Grüne Deal ist unsere neue Wachstumsstrategie“, sagte die CDU-Politikerin, die von den Staats- und Regierungschefs eingesetzt worden war. Investitionen in Milliardenhöhe sollten dazu führen, dass die EU bis 2050 klimaneutral wird und zugleich zum Spitzenreiter bei grüner Technologie und Industrie aufsteigt.

Dies sei Europas „Mann-auf-dem-Mond-Moment“, rief von der Leyen aus – womit sie ein Stichwort der konservativen EVP-Fraktion im Europaparlament aufgriff. Mit „Mann auf dem Mond“ ist allerdings nicht das Mondmännchen, sondern der Mondflug gemeint, der einst die Fantasie anregte – und der US-Industrie zu einer Führungsrolle verhalf.

Bisher ist allerdings nicht einmal klar, ob sich alle 28 EU-Staaten an der Reise beteiligen. Polen und andere osteuropäische Staaten haben das Ziel der Klimaneutralität beim EU-Gipfel im Juni in eine unverbindliche Fußnote verbannt. Ob der Widerstand beim nächsten Gipfeltreffen am Donnerstag gebrochen werden kann, ist offen.

„Wir haben nicht alle dieselben Ausgangsbedingungen“, räumte der neue EU-Gipfelchef, Charles Michel – ein liberaler Belgier –, unter Anspielung auf das Kohleland Polen ein. Michel versprach, auch „die sozialen Konsequenzen in Rechnung zu stellen“ und die Verlierer der klimapolitischen Wende großzügig zu entschädigen.

Eine zentrale Rolle soll dabei der „Just Transition Fund“ spielen. „Wir haben das Ziel, 100 Milliarden Euro an Investitionen für die am stärksten gefährdeten Sektoren und Regionen zu mobilisieren“, sagte von der Leyen. In den ersten Plänen war nur von 35 Milliarden Euro die Rede.

Finanzierung ist noch offen

Quelle        :        TAZ             >>>>>           weiterlesen

——————————————————-

Green New Deal der EU

Ein großer Plan mit Lebenslüge

Hans Baluschek, Illustration - Little Peter's trip to the Moon, Night.JPG

Von der Leyens Mondfahrt

Kommentar von Ingo Arzt

Der Green Deal der EU-Kommission ist ein Klimapapier mit vielen vernünftigen Vorhaben. Doch die Lebenslüge vom ewigen Wachstum thematisiert es nicht.

Die EU ist das Beste, was es im Klimaschutz derzeit gibt. Und das ist keine gute Nachricht.

Die neue Kommissionschefin Ursula von der Leyen hat am Mittwoch ihren „European Green Deal“ präsentiert, der retromodern nach Ärmel aufkrempeln und Probleme anpacken klingt. Es geht, nur zur Erinnerung, eigentlich darum, einen Kollaps der Ökosphäre zu verhindern. In dessen Folge Millionen, vielleicht Hunderte Millionen Menschen sterben könnten, weil wir Jetztmenschen ihnen die Lebensgrundlagen weggeflogen, weggefahren und weggefressen haben.

Und was macht die neue EU-Kommission? Sie schreibt ein erstaunliches, deprimierendes Papier von 24 Seiten. Erstaunlich, denn darin steht geschrieben, der Klimawandel sei die definierende Herausforderung unserer Generation, Arten stürben aus, Wälder und Meere würden zerstört. Die Klimaziele werden deutlich erhöht. Ökosysteme sollen geheilt werden. Der Green Deal fasst eine Menge vernünftiger Vorhaben zusammen, von einer CO2-Grenzzsteuer bis zur Steuer auf Flugbenzin oder einem möglichen „Recht auf Reparatur“ für neue IT-Geräte. Das ist ein passabler Wurf, verglichen mit dem, was aus Australien, Russland, Japan, Saudi-Arabien China oder Berlin kommt.

Quelle         :          TAZ          >>>>>         weiterlesen

——————————————————–

Grafikquellen     :

Oben         —       Full moon surrounded by clouds over Carmel-by-the-Sea, California, September, 2009

Abgelegt unter Energiepolitik, Ernährungspolitik, Europa, Umwelt | Keine Kommentare »

Vorschläge eines Sozialisten

Erstellt von DL-Redaktion am 12. Dezember 2019

Für eine Klassenpolitik in der Umweltbewegung!

IAA Verkehrswende Demo 07.JPG

Quelle       :            AKL

Von Hans Neumann, Hildesheim

Die Massenproteste gegen den Klimawandel bringen Schüler*innen, Studierende, abhängig Beschäftigte, Erwerbslose, Rentner*innen, aber auch Selbständige und Unternehmer*innen auf die Straße. Außer der AfD spricht sich niemand dagegen aus, dass der Kampf gegen den Klimawandel ganz oben auf der Prioritätenliste stehen muss. So viel Einigkeit über politische und soziale Grenzen hinweg, freut viele, die in der Bewegung aktiv sind. Sozialist*innen sollten verstehen, dass diese scheinbare Stärke der Bewegung zum Verhängnis werden kann. Eine genauere Analyse über die Rolle von Klassen in Gesellschaft und sozialen Bewegungen ist angebracht.

Wenn Sozialist*innen die Gesellschaft erklären wollen, kommen sie nicht daran vorbei, sie mit Blick auf ihre materielle Grundlage zu verstehen. Im Gegensatz zum Idealismus ist es für den Marxismus zweitrangig, welchen Gruppen sich Menschen gedanklich zuordnen und welche Vorstellungen voneinander unterscheidbar sind. Wenn vegane Katholik*innen nichts mit anarchistischen Tierbefreiungsaktivist*innen zu tun haben wollen, mag das im Einzelfall wichtig sein. Für das Verständnis unseres Zusammenlebens in einer Klassengesellschaft ist es aber weniger interessant. Hier ist es vor allem von Relevanz, welche Rolle Menschen im Produktionsprozess spielen und ob sie sich dessen bewusst sind. Mit Marx gesehen ist hierbei entscheidend, wer die Mittel zur Produktion besitzt und wer nicht – also ob einem die Maschinen, Rohstoffe, Gebäude oder Ähnliches gehören, die zur Herstellung von verkaufbaren Produkten benötigt werden oder ob man in dieser Wirtschaft im Grunde nichts anderes als seine Arbeitskraft verkaufen kann. Alle, die in letztere Kategorie fallen, bilden für Marx die Arbeiter*innenklasse, die rein zahlenmäßig den überwiegenden Teil der Gesellschaft ausmacht und von der Konjunktur der Wirtschaft und der Willkür der Eigentümer an den Produktionsmitteln, den Kapitalisten, abhängig ist. Werden Jobs schlecht bezahlt, bleibt weniger zum Leben. Gibt es nicht genug Jobs, bleibt in der Regel nur das bisschen Brotkrumen an Arbeitslosengeld oder anderen staatlichen Leistungen, um zu überleben. Ganz anders ergeht es ihrem Gegenpart, der Kapitalist*innenklasse (oder „Bürgertum“). Deren Mitglieder können sich ein schönes Leben machen, weil sie weder von ihrer Arbeitskraft abhängig sind, noch genau genommen selbst arbeiten: im Produktionsprozess schaffen nämlich nur die beschäftigten Arbeiter*innen neuen Wert – den Mehrwert –, der zum Teil wieder in das Unternehmen investiert wird, zum Teil ausgezahlt, zum anderen Teil von den Kapitalist*innen in die eigene Tasche gesteckt wird.
Deshalb ist z.B. Aloys Wobben nicht wegen seines großartigen Umweltbewusstseins oder Fleißes unter den 20 reichsten Deutschen. Sein Vermögen von mehr als sieben Milliarden Euro ergibt sich einzig und allein aufgrund seines Eigentums an der Firma Enercon GmbH (Windanlangenproduktion), d.h. seiner Stellung im Produktionsprozess und damit vor allem durch die Ausbeutung seiner Beschäftigten.
Wenn es um Arbeitskämpfe geht, forderten die Arbeiter*innen bei Enercon in der Vergangenheit einen höheren Lohn, kürzere Arbeitszeiten oder Verzicht auf Stellenstreichungen – was insgesamt hieß, einen größeren Teil des von ihnen produzierten Werts an die Beschäftigten abzugeben. Das Unternehmen setzte in diesen Fällen aber alles daran, ein möglichst kleines „Stück vom Kuchen“ abgeben zu müssen. Das Interesse der vielen Arbeiter*innen und der wenigen Kapitalist*innen steht einander direkt gegensätzlich, unversöhnlich diametral gegenüber.
Außerhalb solcher Lohn- oder Arbeitskämpfe ist das Klassenverhältnis vielen Beschäftigten oft nicht bewusst und dennoch – unabhängig wie die einzelnen Menschen dazu stehen, wie sie es wahrnehmen oder was sie empfinden – gibt es diese Klassen an sich und auch diese Klassengesellschaft. Dass sich Arbeiter*innen bewusst als Klasse für sich zusammenschließen und organisiert Gegenmacht aufbauen, ist allerdings ein Prozess, der durch Erfahrungen mit Ausbeutung und vor allem mit Klassenkämpfen voran getrieben wird. Es ist die Aufgabe von Sozialist*innen, diesen Prozess durch Propaganda und Organisierung voran zu treiben und Ihre Stellung im Produktionsprozess aufzuzeigen – gerade weil die Kapitalist*innenklasse als Klasse für sich schon organisiert ist: Mit ihren prokapitalistischen Parteien, ihren Gesetzen und vor allem mit ihrem Staat.

IAA Verkehrswende Demo 16.JPG

Klassen und ihre Schichten
Wenn Marxist*innen also zwischen dem grundlegenden Klassenunterschied (Eigentum an Produktionsmitteln: ja/nein) und der bewussten Zuordnung zu einer Klasse unterscheiden, vergessen sie dabei aber auch nicht die jeweiligen Spezifika unterschiedlicher Schichten in den Klassen: In der Arbeiter*innenklasse ist es z.B. beachtenswert, ob man sich in der Ausbildung befindet oder bereits lange Jahre arbeitete; ob man in einer Zeitarbeitsfirma knechtet, oder einen unbefristeten Vertrag hat; ob man aufgrund seines Geschlechts zusätzliche Unterdrückung erfährt oder nicht; ob man in einer Fabrik für Solaranlagen arbeitet oder in der Pflege usw. All diese Unterschiede sind wichtig. Sie prägen die Bedürfnisse der Menschen und beeinflussen ihr Denken von sich und der Welt. Innerhalb der gesamten Arbeiter*innenklasse haben diese Schichten aber auch gemeinsame Interessen – Klasseninteressen. Je bewusster sich die aktiven Teile der Arbeiter*innenklasse über ihre Klasseninteressen sind, desto mehr werden sie danach streben Kämpfe und Bewegungen zu einzelnen Fragen (Lohnhöhe, Umweltschutz etc.) zu politischen Bewegungen/Kämpfen zu machen, die die Klassenherrschaft des Bürgertums und die im Kapitalismus bestehenden Eigentumsverhältnisse in Frage stellen.

Die Rolle des Kleinbürgertums
Das alles mag als theoretisches Gefasel wahrgenommen werden. Mit Blick auf die gegenwärtigen Kämpfe zum Thema Umwelt sind diese Ausführungen aber nicht unwichtig: Denn oft vergessen linksdenkende Menschen, dass auch auf einer Demonstration zum Thema Umwelt eine Zusammensetzung von Akteur*innen unterschiedlicher Klassen und Klassenschichten gegeben ist und oft sogar eine bestimmte in Forderungen und Ideen dominieren kann. Im Falle der gegenwärtigen Umweltbewegung sind es vor allem kleinbürgerliche Schichten, die den politischen Charakter der Proteste bestimmen.
Als unterster Teil der besitzenden Klasse teilt sie mit dem Großbürgertum die wesentlichen Gesamtinteressen der Kapitalist*innenklasse, droht aber durch starke Konkurrenz des großen Kapitals immer wieder, in die Arbeiter*innenklasse abzusteigen. Die ihr Angehörigen besitzen Produktionsmittel und können im kleinen Rahmen ihre Existenz auch auf die Ausbeutung anderer Arbeitskräfte stützen, bleiben aber selbst darauf angewiesen, von ihrer eigenen Arbeit zu leben. Mit kleinem Kapital ist ihr Wettbewerb in der Regel auf lokaler Ebene begrenzt, während das Großkapital in viel breiteren Kontexten agieren kann. Das Großkapial benötigt Einfluss auf die Gesetzgebung des Staates und seiner Außenpolitik, während das Kleinbürgertum sich auf individuellen Einfluss begrenzt und oft in eher lokaler Politik mitmischt. Es ist insofern privilegiert, als dass es sich die Früchte seiner Arbeit direkt auszahlen kann, während Arbeiter*innen ausgebeutet werden und nur einen Teil des von ihnen produzierten Werts als Arbeitslohn erhalten. Durch den Konkurrenzdruck der großen Kapitale ist das Hinabsteigen in die Arbeiter*innenklasse jedoch immerzu eine reelle Gefahr. Insofern wird es ideologisch zwischen die Stühle gesetzt: Der Sozialismus wird als Bedrohung betrachtet, weil er das Privateigentum an Produktionsmitteln in Frage stellt, der Kapitalismus wird als Bedrohung betrachtet, weil er durch den Konzentrationsprozess des Kapitals das Kleineigentum an Produktionsmitteln tendenziell zerstört. Es ist kein Zufall, dass Teile des Kleinbürgertums in der Geschichte für reaktionäre Ideen, einschließlich dem Faschismus, besonders anfällig waren.
Zum Großbürgertum kann immerhin potentiell aufgestiegen werden, was durchaus mit einer positiven Bezugnahme auf das privilegierte Leben der Eliten einhergehen kann. Gleichzeitig kann dieses Verhältnis aber auch Neid und Missgunst hervorrufen, da die Klasse des Kleinbürgertums im Vergleich zum Großbürgertum in ihrer Masse eine benachteiligte Klasse bleibt. Wer zugleich aber immer der Gefahr ausgesetzt ist, ins „einfache Volk“ (Arbeiter*innenklasse) hinabzustürzen, kann Ihnen gegenüber ebenfalls ambivalent sein: Etwa mitempfindend, wenn das Leid unverblühmt wahrgeommen wird, aber distanziert und chauvinistisch, wenn man sich abgrenzt und als besser wahrnimmt. Nicht imstande, zur herrschenden Klasse aufzusteigen, ordnete sich das Kleinbürgertum außerhalb von Krisenzeiten historisch immer dem Großbürgertum unter. Teile des Kleinbürgertums schlossen sich jedoch auch der Arbeiter*innenklasse an, wenn diese selbstbewusst Kämpfe führte und als fähig angesehen wurde, eine bessere Gesellschaft zu erstreiten.

Was hat das mit dem Thema Umwelt zu tun?
Wer soziale Bewegungen in einer Klassengesellschaft verstehen will, darf sich nicht damit begnügen, wie sich Akteure selbst zuordnen. Ob man sich als Öko, Autonome*r, Vegane*r oder Kiffer*in definiert, ist für Marxist*innen zweitrangig. Wichtig ist in erster Linie die Stellung im Produktionsprozess und ob sich diese im Bewusstsein der Akteur*innen niederschlägt. Hieraus ergibt sich das revolutionäre Potential der arbeitenden Bevölkerung, wenn sie damit beginnt, sich als gemeinsame Klasse wahrzunehmen und den Kampf für eine sozialistische Veränderung der Gesellschaft aufnimmt. Dann kann sie auch Teile des Kleinbürgertums hinter sich sammeln, die erkennen, dass eine sozialistische Gesellschaft ihnen eine bessere Zukunftsperspektive bieten kann als der Kapitalismus. Vollkommen diametral dazu stehen auch in diesem Beispiel die Interessen des Großbürgertums, das auch hier die Aufrechterhaltung der Produktions- und Eigentumsverhältnisse vor Naturschutz, Menschenleben und Rationalität gestellt wird. Und auch die Sonderrolle des Kleinbürgertums wird relevant: Denn gerade an der Umweltfrage ist das Konfliktpotential zwischen Groß- und Kleinkapital hoch.

Fridays for Future Aschaffenburg 15.03.2019 01.jpg

Während das große Kapital für seinen Profit zum Beispiel ganze Landstriche niederreißt, wird damit die Existenzgrundlage lokaler Handwerker, Händler*innen, Bäuer*innen und des kleinen Gast- und Tourismusgewerbe zerstört. Ein Programm, das das verhindert, kann auch ein Anknüpfungspunkt für das Kleinbürgertum sein, um seine Unterstützung für ein sozialistisches Programm zu gewinnen. Geschieht das nicht, können sich eine politische Führung des Kleinbürgertums oder von ihren Ideen geprägte Akteur*innen zu einer mäßigenden, abwartenden, bremsenden Rolle entwickeln bzw. der Bewegung eine falsche Richtung geben und sich schließlich auch den prokapitalistischen Forderungen des Großbürgertums anschließen.
Für Fridays for Future heißt diese Klassenzusammensetzung z.B., dass sich auch Unternehmer*innen mit „Entrepreneurs for Future“ an den Klimaprotesten beteiligt haben und das Verkehrsunternehmen Flixmobility GmbH kostenlose Busfahrten zu den Demos anbietet. Es bedeutet auch, dass sich viele kleinbürgerliche Kräfte v.a. aus dem Dienstleistungssektor bei „Unternehmen für Fridays for Future“ sammeln. Obwohl das Klein- oder Großbürgertum rein quantitativ oft nur schwach in der Bewegung vertreten sein mag, kann sich ihre Ideologie in Führung und Ideen der Bewegung niederschlagen. Oft sind es z.B. Kinder dieser Klassenangehörigen, die stellvertretend für diese Klasse individualistische und idealistische Lösungsangebote vertreten. Auch wenn in der Bewegung die Arbeiter*innenklasse in der Überzahl ist, besteht in Führung und Ideen gegenwärtig eine Dominanz des Groß- und v.a. des Kleinbürgertums – nicht zuletzt weil die Arbeiter*innen als Individuen an den Protesten teilnehmen und nicht kollektiv, was die Gewerkschaften erreichen könnten, deren Führungen aber auch in dieser Frage versagen.
Dieser Einfluss sollte nicht unterschätzt werden: Viele Fridays for Future-Aktivist*innen übernehmen unkritisch die Forderung nach einer noch viel höheren CO2-Steuer, die v.a. die Arbeiter*innenklasse zur Kasse bittet. Arbeiter*innen würden nach Meinung vieler Aktivist*innen selbst eine wesentliche Schuld an der Misere tragen, weil sie als Konsument*innen die gleiche Rolle im zerstörerischen System spielen würden wie Kapitalist*innen. Appeliert wird so etwa ans Bewusstsein der Konsument*innen, z.B. durch die Propagierung von Fleischverzicht und dem Verbot von Flügen unter tausend Kilometer Länge. Sorgen vor Arbeitsplatzabbau in umweltschädlichem Gewerbe werden in der Regel ignoriert, statt Forderungen nach Lohn- und Beschäftigungsgarantie ggf. in alternativen Branchen aufzustellen. Statt dadurch Beschäftigte in umweltschädlichen Industrien für die Umweltproteste zu gewinnen, werden Arbeiter*innen direkt oder indirekt aufgefordert, ihre unmittelbaren ökonomischen Interessen doch bitte zurückzustellen. Das wird für die Umweltbewegung ein noch viel größeres Problem werden, wenn die wirtschaftlichen Probleme und Zukunftsängste größerer Teile der Arbeiter*innenklasse im Zuge der drohenden Wirtschaftskrise zunehmen. Dann wird die heute in Teilen bestehende Akzeptanz einer „Kostenbeteiligung“ am Kampf gegen den Klimawandel, zum Beispiel durch CO2-Steuer, wieder abnehmen.
Die Folge dieser Konstellation ist zwar eine positive Resonanz bei bürgerlichen Medien, aber eine Spaltung, statt breite Mobilisierung der (gesamten!) Arbeiter*innenklasse. Klar wird auch, dass viele kleinbürgerliche Kräfte mit „System Change“ nicht einen wirklichen Systemwechsel, hin zu einer demokratisch geplanten Wirtschaft, meinen.

Die klassenbewusste Alternative
Wer lieber davon redet, individuelles Verhalten zu sühnen, statt große Unternehmen, ihre Lobbygruppen und den Kapitalismus als ökonomisches System zu verurteilen, nimmt die Hauptschuldigen aus dem Visier. 71% der globalen Treibhausgasemission stammt von nur 100 Unternehmen. Seit dem Jahr 1751 lassen sich 63% der globalen Emission auf nur 90 Unternehmen herleiten und alleine 30% der gesamten Emission auf lediglich 20 Unternehmen!
Konkrete Maßnahmen gegen konkrete Unternehmen sind notwendig und nur eine demokratisch geplante Wirtschaft kann diese Aufgaben angehen. Das geht nicht ohne eine revolutionäre Veränderung der Gesellschaft und einer globalen Bewegung für Klima, Arbeit und Wohlfahrt auf Basis einer sozialistischen Programmatik.
Sozialist*innen sollten deshalb auch in der Umweltbewegung einen Klassenstandpunkt einnehmen. Das bedeutet unter anderem: die Verantwortlichen am Klimawandel klar benennen, keine Forderungen unterstützen, die die Arbeiter*innenklasse für den Kampf gegen den Klimawandel bezahlen lassen würden, sondern Übergangsforderungen aufstellen, die deutlich machen, dass die Kapitalist*innenklasse nicht nur für die notwendigen Maßnahmen zahlen soll, sondern auch, dass es nötig ist Privateigentum an Produktionsmitteln und kapitalistische Profitwirtschaft zu überwinden.
Eine Linke kann ein solches notwendiges Programm nur aufstellen, wenn sie selbst eine Klassenpolitik betreibt, also die Arbeiter*innenklasse als die entscheidende, potenziell revolutionäre Kraft wahrnimmt wird und nach einer möglichst breiten Vereinigung zur Klasse für sich strebt.

Fridays for Future Aschaffenburg 15.03.2019 25.jpg

Kämpfende Arbeiter*innen und Menschen, die ideologisch auf der Seite der Arbeiter*innenklasse stehen, finden sich zu Hauf bei den gegenwärtigen Umweltprotesten. Es wäre Aufgabe von Sozialist*innen, diese Menschen anzusprechen und die Klassendifferenzen in der Bewegung aufzuzeigen. Erst aus einer klassenbezogenen Selbstverortung entsteht die Möglichkeit, sich Klasseninteressen bewusst zu machen und daraus schließlich auch politische Schlussfolgerungen zu ziehen. Statt die Klassenunterschiede in der Umweltbewegung ignorierend Umweltharmonie zu predigen und „die“ Umweltbewegung als Ganze unkritisch abzufeiern, gilt es für Sozialist*innen aufzuzeigen, dass es im unmittelbaren Interesse der Arbeiter*innen liegt, mit der Profitgier dieses Systems, mit dem Raubbau an der Natur, mit diesem Staat als Institution der herrschenden Klassen und damit auch mit den prokapitalistischen Kräften in der Bewegung ein für alle mal zu brechen.
Sollte die Arbeiter*innenklasse als eigenständige Kraft auftreten, könnte ihre rein quantitative Überlegenheit in der Bewegung auch eine neue politische Führung entstehen lassen, die der Umweltbewegung einen proletarischen, statt kleinbürgerlichen Charakter verleiht und die kleinbürgerlichen Schichten in ihren Sog mitzieht.
Dafür reicht es aber nicht, sich allein am Thema Umwelt abzuarbeiten, sondern auch die anderen Hauptanliegen von Arbeiter*innen, z.B. das Thema Wohnen oder konkrete Lohnkämpfe in den Blick zu nehmen und vor allem verschiedene Kämpfe der Arbeiter*innenklasse zu vereinigen, um wirklich schlagkräftig zu werden.
Dazu gehört eine Orientierung darauf, die Gewerkschaften auch in soziale Bewegungen wie die Umweltproteste einzubeziehen und Agitation auch in den Betrieben zu leisten. Vor allem sollten solche kämpferischen und antikapitalistische Kräfte in den Gewerkschaften unterstützt werden, die sich dem systemtragenden Kurs der Gewerkschaftsspitzen in den Weg stellen.
Und es heißt für die Partei DIE LINKE, hier mutig voranzuschreiten, Vorschläge zu entwickeln und an die Umweltkämpfe mit einem klaren sozialistischen Programm heranzutreten!

akl - Antikapitalistische Linke

—————————————————————-

Grafikquellen        :

Oben       —        Protest against IAA in Frankfurt. #aussteigen

2.) von Oben    —     Protest against IAA in Frankfurt. #aussteigen

—————————

3.) von Oben       —       Fridays for Future, Demo in Aschaffenburg, 15.03.2019

——————————–

Unten       —       Fridays for Future, Demo in Aschaffenburg, 15.03.2019

Abgelegt unter International, Kultur, P. DIE LINKE, Umwelt | Keine Kommentare »

Bauern finden Frau

Erstellt von DL-Redaktion am 11. Dezember 2019

Monsanto finanzierte Glyphosat-Studien in Deutschland

Bundeshauptveranstaltung des Tag der Regionen 2018 mit Julia Klöckner.jpg

Und nun hält die Frau ihr Maul ?

Quelle          :      INFOsperber CH.

Von  Tobias Tscherrig

Dokumente zeigen, dass Monsanto auch in Deutschland im Geheimen Studien finanzierte, um Glyphosat ins richtige Licht zu rücken.

Wie Recherchen von «LobbyControl» zeigen, finanzierte der Chemiekonzern Monsanto zwei wissenschaftliche Studien über den Unkrautvernichter Glyphosat. Mit derartigen Studien, die bei Zulassungsverfahren eine wichtige Rolle spielen können, sollten vor allem die Vorteile des in der Öffentlichkeit stark kritisierten Produkts unterstrichen werden: Seit Jahren steht der Unkrautvernichter Glyphosat im Verdacht, krebserregend zu sein. Trotz der starken Verdachtsmomente, verlängerte die EU-Kommission die Zulassung des Pestizids 2017 für fünf Jahre.

Es ist nicht neu, dass Monsanto wissenschaftliche Studien über eigene Chemieprodukte mitverfasste oder finanzierte. Allerdings betrafen die Fälle, die bisher publik wurden, allesamt die USA. «LobbyControl» liegen nun Dokumente vor, die beweisen, dass Monsanto auch in Deutschland verdeckt Studien finanzierte. In der Schweiz haben grosse Zeitungen bisher nicht darüber berichtet.

Bezahlte Studie als Hauptargument

Monsanto und andere Glyphosat-Hersteller stellten sich in der Vergangenheit auf den Standpunkt, dass Glyphosat-Verbote in der EU Wohlstandsverluste in Milliardenhöhe zur Folge hätten. Eine Aussage, die mit einer vermeintlich unabhängigen Studie vom Institut für Agribusiness (IAB) aus Giessen untermauert wurde. Die Recherchen von «LobbyControl» zeigen nun, dass die entsprechende Studie von Monsanto, dem Hersteller von Glyphosat, mitfinanziert wurde.

Der Chemiekonzern Bayer, der Monsanto für 66 Milliarden Dollar übernommen hatte, hat die Recherchen von «LobbyControl» inzwischen bestätigt. Dies, nachdem Michael Schmitz, einer der Studienautoren und ehemaliger Institutsleiter, gegenüber «LobbyControl» das Gegenteil behauptet hatte. Der Agrarökonom ist inzwischen emeritiert und lehrte bis 2015 an der Universität Giessen, wie der «Spiegel» berichtet. Er sei zudem als Sachverständiger für das Bundeslandwirtschaftsministerium tätig gewesen und habe als Gutachter für die Deutsche Forschungsgemeinschaft gearbeitet.

Institut fällt nicht zum ersten Mal negativ auf

Die Absicht der Chemie-Industrie ist klar: Ein allfälliges Verbot von Glyphosat würde den betroffenen Unternehmen empfindliche Umsatzeinbussen bescheren. Deshalb erstaunte es auch nicht, dass Monsanto Millionen in Lobbyarbeit investierte, als in der EU die Wiederzulassung von Glyphosat kontrovers diskutiert wurde. Zu den umstrittenen Lobby-Methoden gehörten auch die Finanzierung von deutschen Wissenschaftlern. So setzte Monsanto zum Beispiel Kronzeugen mit Professorentitel ein, um den Interessen des Konzerns mehr Gewicht zu verleihen. «LobbyControl» bilanziert: «Der Fall belegt einmal mehr, mit welch unethischen Lobbymethoden Monsanto in den politischen und gesellschaftlichen Grosskonflikt um Glyphosat eingreift.»

Das Institut für Agribusiness, dass die Studien herausgegeben hatte, war «LobbyControl» bereits in der Vergangenheit negativ aufgefallen: So liess es sich unter anderem eine Studie zu den volkswirtschaftlichen Schäden von Fleischverzicht von der Geflügelwirtschaft bezahlen. Das ist kein Zufall: Das Institut wurde von Vertretern aus Politik und Agrarindustrie begründet.

Interne Dokumente belegen Finanzierung durch Monsanto

Im Zusammenhang mit einer Recherche zur Studie über die volkswirtschaftlichen Schäden von Fleischverzicht, befragte «LobbyControl» Schmitz auch nach zwei Studien zum Thema Glyphosat. Die zwei Studien erschienen in den Jahren 2011 und 2015, warnten vor Milliardenschäden bei einem allfälligen Glyphosat-Verbot und stellten den ökologischen Nutzen des Unkrautvernichters für die Landwirtschaft ins Zentrum.

Die Studien seien aus eigenem Forschungsinteresse und ohne Finanzierung durch Dritte entstanden, habe Schmitz damals auf die Anfrage von «LobbyControl» geantwortet. Nun liegen dem Team von «LobbyControl» aber interne Unterlagen vor, die das Gegenteil beweisen. In einem Auszug aus einem Protokoll des Vereins für Agribusiness-Forschung aus dem Jahr 2012 steht: «Das IAB hat unter finanzieller Förderung durch das Unternehmen Monsanto (Brüssel) die ökonomischen Aspekte in Deutschland für die landwirtschaftliche Produktion, für die Volkswirtschaft sowie für die Umwelt analysiert.»

Als «LobbyControl» Michael Schmitz mit den neuen Erkenntnissen konfrontierte, blieben die entsprechenden Fragen unbeantwortet. «LobbyControl» sei voreingenommen, soll Schmitz argumentiert haben. Er beantwortete nur inhaltliche Fragen zur Studie.

Anders der Chemie-Konzern Bayer, der die Finanzierung der Studien eingeräumt hat. Trotzdem sehe das Chemie-Unternehmen zum jetzigen Zeitpunkt keinen Anlass, an den Methoden, Inhalten oder Ergebnissen der Studien zu zweifeln. Gleichwohl entspreche der fehlende Hinweis auf die Unterstützung durch Monsanto nicht den Grundsätzen von Bayer. Der Chemie-Riese habe erklärt, den Hinweis auf die Finanzierung durch Monsanto auf der eigenen Internetseite nachzuführen, schreibt «LobbyControl». Stattdessen sei die betreffende Studie ganz entfernt worden.

«Wissenschaftliche» Belege fliessen in Lobbyarbeit

Die von Monsanto finanzierten Studien wurden nach ihrer Veröffentlichung durch das Institut zusätzlich in Form von Aufsätzen in zwei Fachzeitschriften publiziert – wovon eine von einem Bundesforschungsinstitut herausgegeben wird, das dem Landwirtschaftsministerium untergeordnet ist. Die Finanzierung durch Monsanto wurde dabei mit keinem Wort ausgewiesen, ausserdem wurde als Autorenschaft die Universität Giessen angegeben. Nun sahen die Aufsätze wie das Resultat universitärer Forschung aus, selbst die Verbindung zum Institut für Agribussines fiel unter den Tisch.

Nachdem die beiden Studien der Öffentlichkeit zugänglich gemacht wurden, spielten sie eine wichtige Rolle in der Lobbyarbeit der Chemie-Industrie. Denn obwohl die scheinbar unabhängigen und wissenschaftlichen Studien keine Rolle bei der Frage spielen, wie sich Glyphosat auf Gesundheit und Umwelt auswirkt, thematisieren sie den Nutzen für die Wirtschaft und die Landwirtschaft. Und natürlich verwendete die Chemie-Industrie diese «wissenschaftlichen» Argumente in der Lobbyschlacht um die Glyphosat-Zulassung in der EU, was diverse Prospekte, Broschüren und Veröffentlichungen belegen.

Weiter verwendete die Chemie-Industrie die Studie nicht nur, ohne die Finanzierung durch Monsanto anzugeben – sondern nutzte die Studienergebnisse in einseitiger oder verzerrter Form. Etwa, in dem die wirtschaftlichen Schäden, die gemäss Studie aufgrund eines Glyphosat-Verbots für die EU entstehen würden, nur anhand der extremsten Szenarien berechnet wurden.

Studien ziehen Kreise in Medien und Politik

Wie «LobbyControl» schreibt, war es aber nicht nur die Chemie-Industrie, die die Studien weiterverbreitete. Die Studienergebnisse wurden in Medienberichten thematisiert, auf sie wurde im Glyphosat-Artikel im deutschsprachigen Wikipedia verwiesen. Sie schafften es gar auf eine Literaturliste des Bundestags. In der Folge verwies zum Beispiel die agrarpolitische Sprecherin der FDP-Fraktion, Christel Happach-Kasan, in einer Bundestagsdebatte auf die Untersuchungen der Universität Giessen. «LobbyControl»: «Dass sie sich dabei auf Monsanto-finanzierte Studien bezog, war ihr vermutlich nicht bewusst.»

Die von Monsanto finanzierten und in Deutschland erschienenen Studien über Glyphosat sind der nächste Fall von aggressiven, ethisch und moralisch verwerflichen Lobby-Methoden, wegen denen der Konzern bereits seit Jahren immer wieder in der Kritik steht. «LobbyControl» fordert von Bayer als neuem Monsanto-Eigentümer Transparenz. Der Konzern müsse umfassend offenlegen, «welche Wissenschaftler und Studien Monsanto für Lobbyzwecke finanzierte». Es reiche nicht, wenn nach einzelnen Recherchen stückchenweise die intransparente Zusammenarbeit mit einzelnen Instituten oder Wissenschaftlerinnen und Wissenschaftlern eingeräumt werde. Weiter wird eine Zusage von der Industrie gefordert, «bei allen Studien im jetzt beginnenden Prozess zur Wiederzulassung von Glyphosat 2022 die Finanzierung klar zu benennen.»

Bayer muss reagieren

In der Zwischenzeit nimmt zumindest die Universität Giessen den Fall zum Anlass, um zu prüfen, ob möglicherweise Regeln zur Angabe von Finanzierungsquellen in der Auftragsforschung in ihre Satzung aufgenommen werden sollten. Auch die Herausgeber der Fachzeitschriften, in denen die entsprechenden Aufsätze erschienen waren, wollen reagieren. Ebenso die Veranstalter einer Pflanzenschutz-Tagung, bei der einer der Autoren 2012 die erste der Glyphosat-Studien vorgestellt hatte.

Was fehlt, ist die Reaktion von Bayer. Der Konzern liess weitere, wichtige Fragen von «LobbyControl» unbeantwortet. Denn Bayer kann nicht behaupten, von den unsauberen Methoden von Monsanto nichts gewusst zu haben: Gemäss «LobbyControl» war Bayer CropScience selbst im Vorstand des Trägervereins des Instituts für Agribusiness vertreten und arbeitete mit dem Institut und mit Schmitz zusammen. Zwischen 2006 und 2016 habe Bayer CropScience sechs Studienprojekte beim Institut in Auftrag gegeben. Kostenpunkt: 63’000 Euro.

***************************************************************

Themenbezogene Interessen (-bindung) der Autorin/des Autors
keine
FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

—————————————————————–

Grafolquellen         :

Oben      —       Bundeshauptveranstaltung des Tag der Regionen 2018 mit Bundeslandwirtschaftsministerin Julia Klöckner

————————————

2.) von Oben     —

Épandeur adapté à l‘épandage sur les vignes.

—————————-

Unten      —          politischen Schmusereihe

Julia Klöckner (links) beim CDU-Parteitag (2014)

  • CC BY-SA 3.0 deHinweise zur Weiternutzung
  • File:CDU Parteitag 2014 by Olaf Kosinsky-12.jpg
  • Erstellt: 2014-12-09 15:21:37

Abgelegt unter Mensch, P.CDU / CSU, Regierung, Umwelt | Keine Kommentare »

Klima und Umweltpolitik

Erstellt von DL-Redaktion am 11. Dezember 2019

Wir brauchen eine Klima und Umweltpolitik frei von Kapital- und geopolitischen Interessen.

Bonn, Bundeskunsthalle, Achim Mohné, 010 - K.jpg

Quelle       :       Scharf  —  Links

Klimadebatte  –   Von G. Karfeld

Vorab zwei Aussagen
1. Deutschlands Anteil des Weltweiten CO2 Ausstoß beträgt 2,2 bis 2,5 Prozent.
2. Ein höherer CO2 Gehalt fördert, das ist unbestritten, das Pflanzenwachstum.

Was können wir also für das Klima tun?
Ich bin kein Klimawissenschaftler, ich beurteile die Situation nach meinen Beobachtungen in

der Natur, durch studieren der natürlichen Kreisläufe, verbunden mit den Eingriffen des Menschen.

Ich beginne mit dem Mikroklima (Kleinklima). Die Südseite eines Hauses hat ein anderes Mikroklima als die Nordseite. Jedes Tal hat ebenfalls je nach Lage und Beschaffenheit, Anteil an Wald, Wiesen, bebautes Land und der Höhe des Grundwasserspiegels, der einen fundamentalen Einfluß auf die Vegetation hat, sein eigenes Mikroklima. Der Grundwasserspiegel eines Tales beeinflußt auch den Wasserhaushalt der höher gelegenen Ebenen. Wo sich in der Regel die Wälder befinden. Wenn also im Tal der Grundwasserspiegel durch Baumaßnahmen abgesenkt wird hat das Einfluß auf die Wasserversorgung in den Höhenlagen. Das ist auch mit ein Grund für das Waldsterben.

Das Mikroklima wird überlagert vom Makroklima, das ist das Klima einer ganzen Region oder eines Kontinents. Auch das Weltklima mit den globalen Windströmungen und die Bedingungen der Meeresströme gehören dazu.

Ein höherer CO2 Gehalt fördert das Pflanzenwachstum. Da wir keinen Einfluß auf den weltweiten CO2 Ausstoß haben, sollten wir diese Eigenschaft des CO2 nutzen. Dazu ist ebenfalls unbestritten Feuchtigkeit sprich Wasser notwendig, wie das derzeitige massive Waldsterben wegen Trockenheit zeigt. Der Mensch hat durch Bebauung, Begradigung der Flüsse und Bäche, Trockenlegung der Moore und Sümpfe massiv in den natürlichen Wasserhaushalt des Ökosystems eingegriffen. Die Folge ist, eine zunehmende Trockenheit, damit verbunden die massive Zunahme des Waldsterben sowie die Gefährdung der Nahrungsmittelsicherheit in der Zukunft. Wir haben keinen Einfluß auf den CO2- Ausstoß in China, Indien oder sonst wo, aber wir haben einen Einfluß auf die Umweltpolitik im Eigenen Land und in der Region in der wir leben. Wir können also das Mikroklima gestalten. Geschieht das im ganzen Land oder gar in ganz Europa, hat das Einfluß auf das Makroklima. Wenn hohe CO2- Werte die Temperaturen erhöhen, wirkt eine hohe Verdunstung von Wasser dieser Erhöhung entgegen.

Annie France-Harrar schreibt in ihrem Buch „Die letzte Chance für eine Zukunft ohne Not“ eine mittelgroße Birke (Betula) schafft an einem schönen Sommertag durchschnittlich 400 Liter Wasser aus der Erde herauf und gibt es in kurzer Frist zum größten Teil wieder an die Luft ab. Und ein Hektar Buchenwald saugt sogar von einem heißen und trockenen Sommermorgen bis zum Abend 30 000 Liter auf.

Daraus wird ersichtlich, dass z.B. ein solcher Buchenwald einen Einfluß auf das Mikroklima vor Ort hat. Er erhöht die Feuchtigkeit in seiner Umgebung. Eine höhere Verdunstung von Wasser führt zu einer Steigerung des Wasserkreislaufs. Verdunstung, Aufstieg in höhere und kühlere Luftschichten, Kondensierung und daraus folgend mehr Niederschlag. Dadurch vermehrte Wolkenbildung, dies führt wiederum zu einer Beschattung und damit zu einer niedrigeren Temperatur. Der dadurch erhöhte Niederschlag aus der kühlen Atmosphäre führt zu einer Abkühlung der Erdoberfläche. Jeder kann dies bei einem Gewitterregen selbst nachvollziehen und in der Realität erleben. So ein Gewitterregen erzeugt häufig eine Abkühlung von 10 bis 12°C. Dies zeigt, dass ein Feuchtes Klima mit einem hohen CO2- Gehalt in der Atmosphäre zurecht kommt. Es fördert das Pflanzenwachstum, was wiederum zu einer vermehrten Speicherung von CO2 führt. Dies ist der Kreislauf der Natur der sich selbst regelt, wenn der Mensch nicht massiv in diesen Regelkreis eingreift. Wir haben in diesen Regelkreis eingegriffen, aber nicht was den CO2- Wert betrifft. Die fossilen Rohstoffe sind gespeicherte CO2 aus früheren Zeiten. Wenn sie jetzt zum Problem werden dann nur weil die Vegetation und der Wasserhaushalt des Ökosystems durch den Menschen stark gestört ist. Wir müssen also über den Wasserhaushalt, die Vegetation auf der Erde wieder in Gang setzen.

Es sollte auch geprüft werden welche Auswirkung die riesigen Plastikteppiche im Meer auf die Verdunstung von Meerwasser haben. Ein Plastikverbot in der Verpackungsindustrie ist überfällig. Warum ist der CO2- Ausstoß der Kunststoffindustrie kein Thema? Der Verpackungsfreie Supermarkt ist heute jeder Zeit realisierbar.

Das E- Auto bringt, was die CO2- Bilanz betrifft, nur wenige Vorteile gegenüber dem Verbrennungsmotor. Mit einrechnen muss man aber noch die dazu notwendige Infrastruktur, die Entsorgung und der Aufwand des Recycling der massenhaft anfallenden Batterien. Dies ist noch gar nicht erforscht. Trotzdem wird die Technik bereits mit Steuergeldern subventioniert. Hier werden nur die Gewinninteressen großer Konzerne bedient. Wasserstofftechnik wird unterdrückt, da Wasserstoff ein Rohstoff ist, bei dem die großen Konzerne sich keinen Claim abstecken und sich ihn aneignen können um den Markt zu kontrollieren und mit ihrem Kartell die Massen auszuplündern.

Karikatur von Gerhard Mester zum Thema Klimawandel gibt es nicht O12816.jpg

Jeder von den Massenmedien propagierte Weg aus der Klimakrise ist unweigerlich mit den Interessen der kapitalistischen Eliten verbunden. Jeder dem die Umwelt und damit ein Leben ohne Not der nachfolgenden Generationen am Herzen liegt, sollte sich in der Sache informieren und die natürlichen Kreisläufe versuchen zu verstehen, was natürlich in diesem komplexen Thema immer nur zum Teil gelingen kann. Die größte Hürde in unserer kapitalistischen Gesellschaft ist aber eine ehrliche Sachlage unabhängig von den Interessen der kapitalistischen Eliten dargestellt zu bekommen. Die verschiedenen Prioritäten auf Grund von Interessen verhindern jeglichen umweltpolitischen Fortschritt. Solange die Umwelt und Klimapolitik für Gewinn- und geopolitische Strategien benutzt wird, ist jeglicher Fortschritt nur sehr schwer zu erreichen. Die Klimapolitik ist auch sehr stark von geopolitischen Interessen des globalen Kapitals beeinflußt. Man muss sich überhaupt von der kapitalistischen Denkweise, die zu den heutigen Umwelt und Klimaproblemen geführt hat, lösen um ihrer Lösung näher zu kommen. Es ist nicht nur ein gutes sondern auch ein besseres Leben ohne die heutige kapitalistische Konsum- und Wettbewerbsgesellschaft möglich. Man muss es nur wollen. Zu gerne sind wir bereit Scheinlösungen zu akzeptieren um den eigenen sozialen Status, mag er auch noch so miserabel sein, zu erhalten. Solange wir am Status Quo festhalten schließen wir jegliche Lösung der Probleme aus und bürden sie den nächsten Generationen auf, die dann für ihre Lösung sehr viel größere Opfer bringen müssen.

Entweder wir fügen uns in unserem Wirken und Leben in den natürlichen Kreisläufen der Natur ein, oder die Menschheit, oder zu mindestens ein großer Teil davon, wird an sich selbst scheitern.

https://www.bav-versand.de/Die%20letzte%20Chance%20f%C3%BCr%20eine%20Zukunft%20ohne%20Not.html?ddb.sessionid=405011574074074429414050115741

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

    ——————————————————————-

Grafikquellen     :

Oben         —         Bonn, Bundeskunsthalle, Achim Mohné, 0,0064 MEGAPIXEL – PLANET EARTH IS BLUE AND THERE‘S NOTHING I CAN’T DO

—————————

Unten            —        Karikatur von Gerhard Mester zum Klimawandel

Abgelegt unter Energiepolitik, International, Positionen, Umwelt | Keine Kommentare »

SUV und das Klima

Erstellt von DL-Redaktion am 9. Dezember 2019

SUVs fressen alle CO2-Einsparungen von PKW auf

File:Platz da für mein SUV 07.jpg

Quelle        :     INFOsperber CH.

Von Daniela Gschweng

Der Trend zum «Strassenpanzer» hält an. SUVs verbrauchen so viel Sprit, dass es alle CO2-Einsparungen bei Kleinwagen aufwiegt.

Mehr als ein Drittel aller verkauften Personenwagen sind SUVs. 39 Prozent aller Konsumenten weltweit kauften im vergangenen Jahr einen der Stadt-Offroader, wenn sie ein neues Auto brauchten, Tendenz seit Jahren steigend. Diese Zahl hat die Internationale Energieagentur IEA Mitte Oktober als Vorabmeldung zum «World Energy Outlook 2019» veröffentlicht. Die Agentur bewertet jedes Jahr den Weltenergiekonsum und prognostiziert in drei möglichen Szenarien die zukünftige Entwicklung.

In den vergangenen zehn Jahren hat sich der Anteil der SUVs weltweit verdoppelt, stellt die Energieagentur fest. In der EU ist schon jeder dritte Neuwagen ein SUV, in den USA fast jeder zweite. Auch die wohlhabende Schweiz setzt auf den allradgetriebenen Wagen: Laut «Blick» haben inzwischen die Hälfte aller Neuwagen 4×4. Für Geländefahrten sind sie meist nicht gedacht, eher für das raue Zürcher Pflaster. Ihre Fahrer loben vor allem das hohe Sicherheitsgefühl und die – im wörtlichen Sinne – gute Übersicht.

Die Vorliebe für grosse, schwere Autos macht sich in Folge an der Tankstelle und auch auf dem Konto bemerkbar: SUVs verbrauchen etwa ein Viertel mehr Energie als ein Mittelklassewagen. Der durchschnittliche CO2-Ausstoss eines Fahrzeugs steigt dadurch drastisch an – so sehr, dass er alle «Gegenmassnahmen» wie effizientere Motoren und sparsamere Autos in der Summe glatt ausradiert.

Fast so schädlich wie die Kohleverbrennung

Die immer grösseren und schwereren Vehikel schaden der Umwelt erheblich mehr als kleinere und leichtere Autos. Trotz aller Massnahmen, die Treibstoff-Verbrennung sauberer und weniger umweltschädlich zu gestalten, ist der globale Treibstoffbedarf zwischen 2010 und 2018 um 5,3 Milliarden Liter (3,3 Millionen Barrels) täglich (!) gestiegen, was ausschliesslich auf SUVs zurückzuführen ist. Das ist die zweitgrösste Steigerung im CO2-Ausstoss nach den Emissionen der Elektrizitätserzeuger (Power).

Verbesserungen bei kleineren Fahrzeugen haben im gleichen Zeitraum zu einer Einsparung von 3,2 Milliarden Liter (2 Millionen Barrels) täglich geführt. Elektrofahrzeuge entlasten die Umwelt noch vergleichsweise wenig – durch den Nicht-Verbrauch von etwa 16 Millionen Litern Treibstoff pro Tag.

Personenwagen mit alternativen Antrieben sind zwar auf dem Vormarsch, noch ist der Marktanteil von Elektro-, Hybrid- und Wasserstoffautos aber gering. Bis 2025 werden etwa 350 Modelle auf dem Markt sein, schätzt die IEA. Dabei handelt es sich vor allem um Kleinfahrzeuge.

Die Präsentation des zukünftigen Pick-ups der Firma Tesla erfuhr kürzlich zwar viel Aufmerksamkeit, ist aber eher die Ausnahme als die Regel.

Den Schweizer Kunden ist das egal: Selbst beim kleinen Marktsegement der Elektro- und Hybridfahrzeuge machten SUVs hierzulande den grössten Anteil aus. Je nach Stromquelle ist auch das keine grosse Entlastung für das Klima. Es sei denn sie specken ab (siehe auch Infosperber: «Warum die Effizienz im Strassenverkehr gesunken ist»).

Die weltweit meisten SUVs sind jedoch Benziner und werden es voraussichtlich auch noch eine Weile bleiben. Wenn der Bedarf weiterhin mit ähnlicher Geschwindigkeit zunimmt wie in den vergangenen zehn Jahren, würden benzingetriebene SUVs bis 2040 die CO2-Einsparungen von fast 150 Millionen Elektroautos zunichtemachen, rechnet die IEA aus.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

keine

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

———————————————————————-

Grafikquellen:

Oben       —             The Platz da für mein SUV?! protest promoted a city limit of 70 and a minimum speed of 250 kph on the Autobahn

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: C.Suthorn / cc-by-sa-4.0 / commons.wikimedia.org
It is not permitted to upload this file to Facebook, Youtube, Twitter and many other social networks!
This file has been released under a license that is incompatible with the terms of service and licensing terms of Facebook, Youtube, Twitter etc.More information is provided by the Legal Team of the Wikimedia Foundation.

This file cannot be used at any pages which use different terms than the license granted here.

 ——————————-

Unten      —       „Kinder wollen Klimagerechtigkeit“

Abgelegt unter Bildung, Energiepolitik, International, Umwelt | Keine Kommentare »

Ein Bericht aus Hongkong

Erstellt von DL-Redaktion am 8. Dezember 2019

Unterwegs mit Helm und Gasmaske

Hung Hum 2011.jpg

Von Verna Yu

Für die Sieben-Millionen-Stadt ist das Unvorhersehbare zum Normalzustand geworden. Ein persönlicher Bericht.

Mir geht es seit Monaten wie vielen Menschen hier: Wir schauen zu, wie sich unsere Stadt von Tag zu Tag mehr in einen Kriegsschauplatz verwandelt. Ein Gefühl von Hilflosigkeit und Furcht nimmt überhand. Jedesmal, wenn ich die Wohnung verlasse, um als Reporterin zu arbeiten, mahnen mich meine Kinder zur Vorsicht: „Pass bloß auf dich auf!“ Wann immer ich Helm und Gasmaske einpacke, fühlt es sich an, als würde ich mich auf ein Schlachtfeld begeben.

Meine Gefühle fahren Achterbahn, noch nie konnte ich so viele Wochen hintereinander nachts nicht schlafen, war ich appetitlos und unfähig an etwas Anderes zu denken als an Straßen, von denen man ständig annehmen muss, dass sie zu Kampfzonen werden. Besonders spürbar war der seelische Ausnahmezustand im Oktober, als die Behörden den Betrieb der U-Bahnen tagelang einstellten. Mich überkam ein surreales Gefühl von Unbehagen. Es stand außer Frage, dass man die Wochenendaktivitäten der Kinder absagen musste, schließlich waren alle öffentlichen Freizeiteinrichtungen geschlossen.

Zugänge verriegelt

Also fuhr ich mit meiner Familie im Taxi ans Meer. Ins Wasser zu gehen, war nicht ohne Risiko, denn kein Rettungsschwimmer tat mehr Dienst. Auf dem Weg zurück hielten uns Straßenbarrikaden auf, die von Demonstranten errichtet waren. Die Kinder wurden unruhig und hatten Angst, dass gleich die Polizei aufkreuzen und Tränengas einsetzen würde. Daher stiegen wir aus dem Taxi und machten uns schnell wie möglich durch die Menge davon. Es blieb eine erste Ahnung, dass diese Art des Bedrohlichen und Unvorhersehbaren zum Normalzustand werden könnte. Als es zuletzt den Sturm auf das Universitätsgelände gab, um die Studenten dort zu vertreiben, war ein Großteil der Stadt wie gelähmt. Beide Seiten, Demonstranten wie Polizisten, blockierten Straßen. Wieder fuhr kein Bus, und die meisten U-Bahn-Zugänge blieben verriegelt.

Sobald die Auseinandersetzungen auch nur aufflackern, bedeutet das: Menschen sind zuhause gefangen und können nicht zur Arbeit erscheinen. Wer das trotzdem schafft, kann nie sicher sein, am gleichen Tag wieder nach Hause zu kommen. Von den Angestellten im Finanzdistrikt, wagt es kaum noch jemand, zum Lunch nach draußen zu gehen. Man ist auch dort vor Tränengas nicht mehr sicher. Wenn Restaurants deshalb schließen oder Konzerte und andere Veranstaltungen abgesagt oder früher beendet werden, erliegt jedes soziale Leben. Auch wenn sie gar nicht verhängt worden ist, man lebt wie unter einer Ausgangssperre. Sogar Hochzeiten werden durchkreuzt – Freunde von mir mussten sich eine andere Kirche suchen, um ihre Gäste nicht Straßen voller Tränengas auszusetzen.

Nur noch auswandern

HongKong market amk.jpg

Alle sind hochgradig erregt, sodass zwischenmenschliche Beziehungen notgedrungen belastet und Familien oder Freundeskreise gespalten werden. Eltern und Kinder reden nicht mehr miteinander. Es wird vermieden, beim Abendessen über Politik zu sprechen. Die Geister scheiden sich an der Frage, ob man sich zum gelben (pro Protest) oder blauen Lager (pro China) bekennt. Ich habe Bekannte, die zur Auswanderung entschlossen sind, eher heute als morgen. Sie fürchten, dass ihre Kinder in einer Gesellschaft aufwachsen, in der es keine Grundwerte mehr gibt. Als überall in der Stadt Schulen geschlossen waren, freuten sich Hongkongs normalerweise stark akademisch gedrillte Kinder über Tage des freien Spielens im Park. Ich wusste nicht, sollte ich lachen oder weinen, wenn ich sie „schwarze Polizisten“ gegen „Demonstranten“ spielen sah.

Quelle         :       Der Freitag          >>>>>       weiterlesen

Verna Yu | The Guardian      —    Übersetzung Carola Torti 

Der Freitag ist Syndication-Partner der britischen Tageszeitung The Guardian

———————————————————————–

Grafikquellen       :

Oben         —        Hung Hum in 2011

————————

Unten      —      Market in Mong Kok, Hong Kong

Abgelegt unter Asien, Feuilleton, Kultur, Umwelt | Keine Kommentare »

Die Müllverursacher

Erstellt von DL-Redaktion am 7. Dezember 2019

AfD – größter aller Umweltverschmutzer/in

Keine AFD 1.png

Von Stefan Weinert

Machen wir uns nichts vor. Bei all dem Streit innerhalb des Diskurs‘ „Klimawandel – Klimaerwärmung – Klimanotstand“, ja oder nein, und wie bekommen wir das in den Griff ?, übersehen wir alle womöglich den gröpßten Umweltvergifter im Land. Das nämlich ist die so genannte „Alternative für Deutschland“, die AfD!!

Wer den Bundesparteitag der AfD in Braunschweig verfolgt hat – bis hin zu dem ZDF-Interview am Sonntag-Abend mit dem neuen und verlogenen AfD – Vorsitzenden Tino Chrupalla (Umvolkung), der sich wenige Stunden zuvor bei seiner Kandidatenrede noch ganz ehrlich, seriös und zahm gab; wem klar ist, dass dieser, so wie auch Jörg Meuthen als weiterer Vorsitzender vom sogenannten völkischen Flügel des Björn Höcke mitgetragen werden und das auch bei den Stellvertreterposten sich mit dem Thüringer Stephan Brandner ebenfalls ein Höcke-Freund durchsetzen konnte, —> der/die weiß, was die Stunde geschlagen hat. 
 
Da nützt es auch nichts, wenn der halbe Saal dem Holocaust-Leugner Gedeon bei seiner Bewerbungsrede (!) zum Parteivorsitz den Rücken kehrt und/oder ihm die Rote Karte zeigt. Da nützt es ebensowenig, wenn Herr Meuthen wieder und wieder sein „Credo“ betet, das da heißt: „Ich dulde in der  AfD keine Rechtsnationalen, keine Holocaustleugner  und keine Antisemiten – für eine solche Partei stehe ich nicht zur Verfügung.“ tut er aber, und wie !! 
 
Bereits im Jahre 2016 habe ich – damals noch auf Facebook und generell im Internet – behauptet, die Afd sei die ideologische Nachfolgepartei der NSDAP von 1922 bis 1945. Die Bezeichnung NSAFD wäre – wenn schon ehrlich –  für diese Rechtsaußenpartei der passende und programmatischste Name . Was nützt dir und mir und unseren Kindern und Enkeln ein lebenswertes Ökosystem für das wir kämpf(t)en, wenn wir politisch und ideologisch im braunen Sumpf versinken. 
File:GarbageLibreville.JPG
 
Wer wirklich meint, das könnte in Deutschland nie wieder passieren, hat die Zeichen der Zeit und die Wirkkraft des faschistischen Virus nicht erkannt. Genauso, wie am 30. Januar 1933 von Papen meinte, mit Hitler leichtes Spiel zu haben und sagte: „In zwei Monaten haben wir Hitler in die Ecke gedrückt, dass er quietscht!“ Die AfD gehört verboten – nichts anderes!!
 
Im Folgenden habe ich alphabetisch die bekanntesten  Verursacher der Umweltvergiftung aufgelistet. Nicht rein zufällig steht hier die AfD an der Spitze.

Der größte Umweltverschmutzer ist/sind:

Auflistung alphabethisch

AfD

Atomkraftwerke

Benziner

Bundeswehr

Diesel

E-Mobile

Flugzeuge

Haushalte

Industriebetriebe

Kohlekraftwerke

Kreuzfahrtschiffe

Landwirtschaft

LKW

Mobilfunkstrahlung

Reisebusse

Tanker

Zigarettenraucher/innen

———————————————————–

Grafikquellen        :

Oben      —         Keine Alternative für Deutschland. Aufkleber gegen die Partei Alternative für Deutschland.

————————————–

Unten     —             Müllproblem in Libreville, der Hauptstadt des Gabun (2013)

Author Oshilumbu5 at German Wikipedia

This work has been released into the public domain by its author, Oshilumbu5 at German Wikipedia. This applies worldwide.

Abgelegt unter Baden-Württemberg, Deutschland, P.AfD, Umwelt | Keine Kommentare »

Was kostet die Welt?

Erstellt von DL-Redaktion am 2. Dezember 2019

Klimapolitik – noch schlechter als ihr Ruf

File:FridaysForFuture Demonstration in Berlin, Berlin, 29.11.2019 (49147056171).jpg

Quelle        :    untergrund-blättle CH.

Von Kritik im Handgemenge

Viele Menschen auf der ganzen Welt machen sich Sorgen über die Erderwärmung.

Zu Recht: Die Wissenschaft gibt immer dramatischere Prognosen über die immensen Schäden des Klimawandels ab. Die Auswirkungen sind aber längst bemerkbar. Dafür tut sich erstaunlich wenig in Sachen Schadstoffreduktion: Kaum ein Staat senkt den Ausstoss tatsächlich. Und was auf nationaler und internationaler Bühne angekündigt wird, bleibt weit hinter dem Pariser Klimaabkommen zurück.

Der weltweite Protest von Fridays For Future fordert von der Politik ein, das einzuhalten, was sie sich vorgenommen hat. Dafür kriegt er viel Lob und Unterstützung. Komischerweise auch von denen, die der Protest kritisiert. Die Lage ist ernst. Da wäre es klug, sich damit auseinander zu setzen, an wen man da appelliert. 30 Jahre Klimapolitik – deren Ergebnisse und Gründe – geben Aufschluss darüber, dass der Staat kein guter Ansprechpartner ist, wenn es darum geht, den Planeten zu retten.

Mensch und Natur – wofür sind sie gut?

Mittlerweile hat es sich bei Vielen rumgesprochen: Wenn die Erderwärmung gebremst werden soll, müsste sich ziemlich viel ändern. Der Ausgangspunkt aller Klimapolitik waren und sind – trotz aller moralischer Appelle in Sachen Urlaubs-Flugreisen und Avocados – die kapitalistischen Unternehmen. Von denen hängt das gesamte Leben (Lohn, Steuern, Staatsschulden, Qualität einer Währung) einer bürgerlichen Volkswirtschaft ab. Daran will keine verantwortungsbewusste Regierung von links bis rechts etwas ändern.

Dass „die Wirtschaft“ florieren muss, da sind sich alle einig. Und das geht so: Unternehmen wollen mit dem, was sie herstellen, mehr einnehmen, als sie dafür ausgegeben haben. Dafür wird Einkauf, Produktion und Verkauf darauf getrimmt, den Gewinn zu steigern. Lohnarbeiter*innen bekommen das zu spüren, wenn sie für weniger, gleichen und manchmal auch mehr Lohn immer mehr zu leisten haben. Genauso gehen Unternehmen auch mit der Natur um: Herausholen, was geht, so günstig wie möglich. Energie- und Rohstoffgewinnung und Abfallentsorgung sind nur Kostenpunkte. Vergiftung der Böden, Flüsse und auch der Atmosphäre kostet die Unternehmen erstmal nichts.

Recycling wird dann gemacht, wenn es sich lohnt, z. B. wenn die Rohstoffe teuer sind – aber wenn nicht, dann nicht. Energie einsparen für den gleichen Output wird dann gemacht, wenn es sich lohnt – wenn nicht, dann nicht. Damit die Geldvermehrung immer umfangreicher vollzogen werden kann, muss die Produktion immer weiter wachsen und damit letztlich auch der Energieverbrauch. Das alles liegt nicht daran, dass Unternehmer*innen oder Manager*innen zu doof oder zu gierig sind, sondern daran, wie die Wirtschaft hierzulande organisiert ist und was ihr Zweck ist: Private Gewinnvermehrung mittels Produktion für den zahlungsfähigen Bedarf.

Die Wirtschaft – wofür ist die gut?

Auch die Politik ist nicht blind, konfliktscheu oder korrupt, wenn sie genau dieses Wirtschaftswachstum auf Kosten von Mensch und Natur fördert. Die Staaten (und Regierungen) der Welt setzen auf die kapitalistische Produktion als eine historisch unvergleichbare Machtquelle. Nie zuvor hat eine Produktion einer Herrschaft so viel Reichtum zugespielt, um ihre Zwecke zu verwirklichen (z.B. Beamte bezahlen, Infrastruktur organisieren). Von A wie Arbeitsagentur bis Z wie Zulassungsstelle benutzt der Staat das Steuergeld, um die Gesellschaft am Laufen zu halten. Damit das gut und immer besser funktioniert, kümmern sich Staaten darum, dass für die Unternehmen genug Energie zuverlässig und billig vorhanden ist. Und dass ihren Unternehmen die ganze Welt als Markt offen steht. Man denke nur an Deutschland mit seiner Autoindustrie, die ihre Karren weltweit absetzt.

Damit andere Staaten, die das gleiche Interesse für ihre Wirtschaft haben, da nicht zwischenfunken, versucht jeder Staat, sich andere Staaten unterzuordnen: In Handels-verträgen versuchen sie der eigenen Wirtschaft möglichst viele Vorteile zu verschaffen. Der Staat macht sich zum Mittel der kapitalistischen Wirtschaft, weil er dadurch stark (die Grünen würden sagen „handlungsfähig“) wird. Der Erfolg der heimischen Wirtschaft ist dabei wiederum das Mittel der Staaten, um sich gegen andere Staaten durchzusetzen. In dieser Konkurrenz um Über- und Unterordnung, die für den Erfolg der eigenen Unter-nehmen geführt wird, ist der Erfolg der eigenen Wirtschaft das entscheidende Machtmittel. Nicht umsonst ist Deutschland als die Wirtschaftsmacht in Europa auch die Führungsmacht.

Umweltschutz – was kostet der Abfall?

Dass die Umwelt bei diesem volkswirtschaftlichen Programm vor die Hunde geht, wird dabei durchaus wahrgenommen. Mehr Leute, die sterben oder Landstriche, die nicht mehr ohne weiteres benutzt werden können, werden hochgerechnet in Kosten für die Volkswirtschaft. Wo die Unternehmen die Menschen und die Umwelt eher als Umsonstladen benutzen, sorgt sich der Staat darum, dass beides auch morgen noch für ihn und die Wirtschaft zur Verfügung steht – deshalb macht er Sozial- und Umweltpolitik.

Dabei hat der Staat ein Problem: Das kostet Geld, ist „eine Belastung für die Wirtschaft“ und verhindert manches profitable Geschäft (z.B. Fracking). Dem Staat stellt sich deshalb immer die Frage, ob das wirklich sein muss. Im Ergebnis wird dann umwelttechnisch manchmal einfach gar nichts gemacht, und stattdessen in öffentlichen Reden die Schäden geleugnet oder kleingeredet. Wenn dann doch was gemacht wird, dann zumeist so: Den Unternehmen wird möglichst viel Zeit gelassen, sich möglichst günstig entsprechend der neuen Vorgaben umzustellen. Im Laufe der Zeit werden dann mal Grenzwerte festgelegt, mal bekommen Verschmutzungen einen Preis – Emissionshandel oder CO2-Steuer.

Klimapolitik – was kostet die Welt?

Wenn die Regierungen der Welt zusammen kommen, um gegen den Klimawandel etwas zu unternehmen, dann sind sie sich in der Regel uneinig. Erstens ganz fundamental darin, wie dringend gehandelt werden muss, denn bis zu welcher Grenze die Erwärmung der Erde noch zu akzeptieren ist, stellt sich für Staaten höchst unterschiedlich dar. Für viele kleine Inselstaaten sind schon 1,5 Grad globale Erwärmung zu viel. Für Länder wie Russland geht selbst eine Erwärmung um 2 Grad sogar mit allerlei erhofften Vorteilen einher. Staaten sind sehr unterschiedlich von den Folgen des Klimawandels betroffen.

Zweitens verfolgen sie unterschiedliche Klimaschutzstrategien, die sich oft genug wider-sprechen und wechselseitig behindern. Denn Staaten verfolgen bestimmte Klimaschutz-Massnahmen sehr gerne und andere wiederum überhaupt nicht – je nach Vorteil für die nationale Wirtschaft. So ist für die meisten Industriestaaten die Abhängigkeit von Öl- und Gaslieferländern schon länger eine ärgerliche Nebenwirkung ihrer Energiepolitik. Die Er-zeugung von Energie jenseits von Verbrennung von Öl und Gas ist deshalb für diese Staaten interessant – und zwar erstmal völlig unabhängig von der Klimapolitik. Zur unabhängigen Energieversorgung der nationalen Wirtschaft setzen deshalb manche Staaten auf die Förderung von erneuerbaren Energien. Je unabhängiger man sich von anderen Energieliefer-anten macht, desto besser kann man gute Öl- und Gaspreise bei den Lieferländern aushandeln.

Wenn dann in diesem Sinne eine neue Industrie aufgebaut wird, ist sofort der wirtschaftspolitische Gedanke da, daraus einen Exportschlager zu machen, wie es mit der Solarenergie in Deutschland bis 2012 versucht wurde. Als Chinas Solarproduktion sich dann doch als konkurrenzfähiger erwiesen hat und von der deutschen Energiesubvention profitierte, wurde die Förderung umgehend wieder eingestellt. Öl- und Gasstaaten und die Transitländer der Rohstoffe finden hingegen die neue Energiepolitik der Industriestaaten naturgemäss nicht gut. Andere Staaten sehen wiederum eine Chance, durch die Bereitstellung grosser Flächen für Biomasse und Solarfelder wenigstens ein bisschen Miete von den kapitalistischen Grossmächten bzw. von deren Unternehmerschaft abzugreifen.

Gibt es in einer Wirtschaft entscheidende Schlüsselindustrien – wie in Deutschland die Autoindustrie – sorgt das für Widerstand gegen Massnahmen, die diese Industrie gefährden. Daher trat die deutsche Regierung, egal ob CDU/SPD, CDU/FDP oder SPD/Grüne, immer wieder auf die Bremse, wenn Frankreich hier ein paar weitergehende Klimaschutzmassnahmen vorschlug. Anders verhält es sich, wenn der deutschen Autoindustrie ihr Spitzenplatz streitig gemacht werden soll, zum Beispiel wenn China die Klima-frage nutzt, um mit nationalen E-Auto-Vorgaben endlich selbst einen Weltautokonzern auf die Beine zu stellen. Da will sich VW nicht abhängen lassen – zu aussichtsreich sind die Absatzchancen in China und darüber hinaus. Das leuchtet auch der Bundesregierung ein, die das Unterfangen unterstützt, bspw. indem sie den Ausbau von Ladestationen beschleunigt.

Fazit – Mit Klimapolitik in die Klimakrise?

So ging und geht die Klimapolitik voran. Massnahmen, die Kostennachteile für die eigene Volkswirtschaft bringen, werden schlichtweg vermieden. Massnahmen, die die eigene Volkswirtschaft voranbringen, zum Beispiel wenn sie Absatzmärkte für eigene „grüne“ Weltmarkt-Champions eröffnen, werden durchgezogen. Der technische Fortschritt ist dabei als Mittel für neues kapitalistisches Wachstum wie immer voll eingeplant – einmal als Mittel für Weltmarktexpansionen nationaler Produkte, und einmal als Hoffnungsträger für zukünftige technische Innovationen. So besteht in der Politik die leise Hoffnung, dass mit einer Erfindung „made in Germany“ der Klimawandel oder seine Folgen abgewendet werden können. Dann erübrigen sich auch Entscheidungen, die schwer fallen, zum Beispiel strenge Emissionsgrenzen.

File:FridaysForFuture Demonstration in Berlin, 20.09.2019 (48895537293).jpg

Das alles meint Merkel, wenn sie die Klimaproteste für ihr ehrenwertes Anliegen lobt und zugleich daran erinnert, dass Vieles zu bedenken ist. „Wir müssen Arbeitsplätze und Wirtschaftskraft auf der einen Seite mit den Zielen des Klimaschutzes versöhnen.“ Und etwas anderes ist auch nicht abzusehen, wenn sich derzeit Bündnis90/Die Grünen fit für die Machtübernahme machen. Trittin als Umweltminister hat in dieser Hinsicht schon mal gezeigt, was zu erwarten ist (Atomausstieg mit langen Laufzeiten, Abwehr von Vorschlägen aus Frankreich für weitergehende Klima-Ziele).

Klimapolitik geht also, aber sie geht in einer kapitalistischen Nationalökonomie ebenso. Dass das ausreichen würde, um Kipppunkte zu vermeiden, ist nicht sehr wahrscheinlich. Von daher ist eine Umweltbewegung, die sich an die Politik wendet, verkehrt. Vielleicht werden durch die Klimapolitik dauerhaft klimaschädliche Stoffe reduziert. Sehr wahrscheinlich ist das nicht. Und wenn, dann mit allen beschriebenen Nebenwirkungen moderner Politik. Es steht daher an, sich gegen die Zwecke und Ziele der herrschenden Politik zu richten. Appelle an Politik und Wirtschaft der Sorte „strengt euch bitte mehr an“ sind dagegen völlig fehl am Platze.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————-

Grafikquellen        :

Oben        —        FridaysForFuture Demonstration in Berlin, Berlin, 29.11.2019

Source FridaysForFuture Demonstration in Berlin, Berlin, 29.11.2019
Author Stefan Müller (climate stuff) from Germany

This image was originally posted to Flickr by Stefan Müller (climate crusty) at https://flickr.com/photos/184802432@N05/48895537293. It was reviewed on 14 October 2019 by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc-by-2.0.

w:en:Creative Commons
attribution
This file is licensed under the Creative Commons Attribution 2.0 Generic license.

—————–

Unten        —         FridaysForFuture Demonstration in Berlin, 20.09.20

Author Stefan Müller

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

This image was originally posted to Flickr by Stefan Müller (climate crusty) at https://flickr.com/photos/184802432@N05/48895537293. It was reviewed on by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc-by-2.0.

Abgelegt unter APO, International, Medien, Umwelt | Keine Kommentare »

Leichen im Keller

Erstellt von DL-Redaktion am 1. Dezember 2019

(Teil 3):  Der vertuschte Quecksilber-Skandal

ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998.tif

Quelle       :          INFOsperber CH.

Von  Frank Garbely

Jahrzehntelang verschwiegen Behörden und die Lonza die Quecksilber-Gefahr. Bis die Deponie saniert ist, können noch Jahre vergehen.

Seit 1978 ist bekannt, dass giftige Chemie- und Industrie-Abfälle der Lonza-Deponie Gamsenried bei Visp das Grundwasser verschmutzen. Doch erst zwölf Jahre später lief die Sanierung der Deponie an. Und es dauerte nochmals rund 20 Jahre, bis die Öffentlichkeit erfuhr, dass die Lonza die Umwelt auch mit Quecksilber verseuchte. Die Walliser Behörden wussten das seit Jahrzehnten, aber sie unternahmen nichts gegen die Quecksilber-Gefahr und vertuschten das Problem. Ob die undichte Deponie überhaupt sanierbar ist, darüber gibt es Zweifel.

Bereits Ende der 1980er Jahre vertrat der Zürcher Geologe Marcos Buser, ein erfahrener Experte im Bereich Entsorgung chemotoxischer Sonderabfälle, die Ansicht, dass sich die Sanierung nicht auf die Deponie beschränken dürfe. Nach seiner Einschätzung war das Grundwasser im Unterstrom der Deponie bis hinunter nach Lalden viel stärker verschmutzt als bisher angenommen. Dabei stützte er sich auf Analysen, welche die Lonza in Auftrag gegeben hatte. Zwischen 1979 und 1986 hatten Forscher der Universität Neuenburg Grundwasser-Analysen durchgeführt. Sie stellten eine starke Verschmutzung des Grundwassers zwischen Gamsen und Lalden fest. Zu den analysierten Stoffen zählten unter anderem: Aniline, Phenol, Ammonium und Chloride.

Die Forscher studierten zudem die räumliche und zeitliche Ausbreitung der diversen Verschmutzungen. Doch die Ergebnisse dieser Analysen wurden nie kommuniziert, sie liegen bis heute unter Verschluss, nicht einmal das Amt für Umweltschutz in Sitten kennt sie. Wie hat sich die Verschmutzung seit den 80er Jahren entwickelt; wie weit talabwärts reicht sie inzwischen, bis Raron oder gar bis Gampel. Oder sackten die Schadstoffe ab und liegen 30 oder 40 Meter tief im Grundwasser?

Experte sagte Scheitern voraus

In seinem Gutachten vom September 1988 zum Sanierungsprojekt gab Marcos Buser der Sanierung kaum Erfolgschancen. Der Experte rechnete damit, dass die Deponie bald wieder das Grundwasser verschmutzen werde. Darum seine Empfehlung: «Sollte die Umweltbelastung durch die Deponie anhalten, werden Sanierungsmassnahmen an der Quelle nötig. Das heisst: Ausräumen der bestehenden Deponie, Nachbehandlung des Lagergutes.»

Nur: Kaum jemand hatte das Gutachten Buser gelesen.

Trotz Bedenken des Gutachters bewilligten Sitten und Brig das Sanierungskonzept. Am 1. Dezember 1990 lief die Sanierung an. In der Folge warteten die Lonza und das Amt für Umwelt regelmässig mit Erfolgsmeldungen auf: Die Sanierung greift. Alles läuft nach Plan.

So geriet die Lonza-Havarie langsam in Vergessenheit, niemand sprach mehr von der Deponie.

Quecksilber auf Wiesen und in Gärten

Doch dann die nächste unliebsame Überraschung: Quecksilberverseuchte Böden zwischen Steg und Visp. Beim Bau der Autobahn stellte man in den Jahren 2009/2010 fest, dass landwirtschaftlich genutzte Felder und private Gärten stellenweise stark mit Quecksilber belastet waren. Woher das Quecksilber kam, war sofort klar: aus der Lonza. Vorerst unklar blieb hingegen: Wie viel Quecksilber lagerte in den Böden?

Die Behörden von Sitten und die Lonza gaben Studien in Auftrag, lieferten eine erste Antwort: 28 Tonnen. Doch diese Zahl war nicht korrekt – einmal mehr. Das zumindest behauptete der Verein Ärztinnen und Ärzte für Umweltschutz (AefU). Er sprach von 200-250 Tonnen Quecksilber. Die Lonza dementierte. Aber der Verein AefU hatte zumindest zum Teil recht. Die Lonza musste ihre eigenen Zahlen nach oben korrigieren, sprach nicht mehr von 28 Tonnen, sondern neu von 50 Tonnen Quecksilber.

Sowohl beim Amt für Umwelt in Sitten wie auch bei der Lonza hatte sich in den letzten zehn Jahren einiges getan. Das Amt in Sitten hatte massiv aufgerüstet, eine ganze Reihe von hochqualifizierten Mitarbeitern angestellt. Und vor allem: Sitten setzte immer stärker auf Transparenz. Das Amt für Umweltschutz richtete eine eigene Website ein, informiert seither laufend über Umweltverschmutzung und den Fortschritt von Sanierungsprogrammen.

Ein ähnlicher Wandel vollzog sich bei der Lonza. Sie kaufte ein ausgewiesenes Spezialisten-Team ein, das besonders grosse Erfahrung mit der Entsorgung von Sondermüll und der Sanierung von Chemie-Deponien mitbrachte. Dieses neue Team begann proaktiv über die Probleme der Lonza mit Umweltverschmutzung zu kommunizieren. Ein schwieriger und auch undankbarer Job. Immer wieder musste und muss das Team geradestehen für Fehler früherer Lonza-Verantwortlicher, für Sünden aus längst vergangener Zeit.

Deponie schon wieder undicht

Die Polemik über das Ausmass der Quecksilber-Verschmutzung sorgte im Wallis jahrelang für heisse Köpfe. Die Lonza kam kaum aus den Schlagzeilen heraus. Dieser Medienrummel um die quecksilber-verseuchten Böden kaschierte einen anderen, womöglich noch grösseren Skandal: Die Lonza-Deponie war erneut undicht.

Die Befürchtungen des Experten Buser hatten sich bewahrheitet. Trotz komplexen und aufwendigen Massnahmen spülte die Deponie weiter Schadstoffe ins Grundwasser. Das zeigten Grundwasseranalysen aus den Jahren 2005-2006. Aber erst ein halbes Jahrzehnt später erfuhr die Öffentlichkeit davon – im Sommer 2011. Damals stufte die Dienststelle für Umwelt die Deponie «als belasteter, sanierungsbedürftiger Standort» ein und verlangte von der Lonza «ein umfassendes Sanierungsprojekt für das ganze Areal der alten Deponie». Die erwähnten Analysen ermittelten im Grundwasser eine ganze Reihe von Schadstoffen, darunter Anilin, Azonol, Phenol, Toluidin, Benzol … Und plötzlich war auch die Rede von Quecksilber.

60 Tonnen Quecksilber lagern in der Deponie

Wie konnte das sein? Warum erst jetzt? Wieso nicht schon 1978, als Geohydrologen festgestellt hatten, dass die Deponie undicht war? Für die Sanierung der maroden Deponie waren damals unzählige Untersuchungen durchgeführt worden. Dutzende von Experten hatten Studien angefertigt. Aber nicht einer hatte im Zusammenhang mit der Deponie Quecksilber erwähnt. Das geschah erst im Jahre 2011. Ein Sprecher der Dienststelle für Umwelt in Sitten erklärt: «Es war unsere Dienstelle, die im Jahr 2011 die Lonza darauf aufmerksam gemacht hatte, dass es auf der Deponie Quecksilber geben muss.» Und plötzlich meldete die Lonza, dass auf der Deponie tatsächlich Quecksilber lagerte, und nicht zu knapp, nämlich 40 bis 60 Tonnen.

Dabei wusste die Lonza: Auf der Deponie lagerte schon immer Quecksilber. Seit dem ersten Tag. Die Deponie war 1918, vor über 100 Jahren, in Betrieb genommen worden.

Quecksilber hatte die Lonza seit 1917 eingesetzt, als Katalysator bei der Produktion von Azetaldehyd. Auch in den 40er Jahren bei der Produktion von Vinylchlorid, zur Herstellung von Gummiersatzstoffen. In den 60er Jahren nahm die Lonza die Petrochemie in Betrieb und konnte so ihre Produktion massiv steigern. Das war aber keineswegs das Ende des Quecksilber-Einsatzes. Im Gegenteil, die Quecksilberverwendung nahm zu und damit schnellte auch der Quecksilberverlust in die Höhe. Erst in jüngster Vergangenheit hat die Lonza jede Nutzung von Quecksilber eingestellt.

Jahrzehntelang vertuscht

Auch die Behörden, speziell die staatlichen Ämter im Bereich Gewässer- und Umweltschutz wussten seit Jahrzehnten, dass die Lonza die Umwelt, u.a. mit Quecksilber, belastete.1) Seit den 1920er Jahren waren in der Rhone zwischen Visp und Leuk immer wieder ganze Fischbestände vergiftet worden. Regelmässig hatte der Staat Experten ins Oberwallis geschickt, um die Ursachen für das Fischsterben zu ermitteln. Das Resultat war jeweils dasselbe: die Industrie-Abwässer der Lonza. Bereits in den 1940er Jahren war im Zusammenhang mit toxischen Abwässern ausdrücklich die Rede von Quecksilber. Spätestens seit 1974 war der Lonza und auch den kantonalen Behörden die Verschmutzung der Rhone mit Quecksilber bekannt. Die Internationale Kommission zum Schutz des Genfersees liess die Sedimente der Rhone untersuchen. Die höchsten Quecksilberwerte wurden im Oberwallis gemessen, und zwar dort, wo die Lonza ihre Abwässer in die Rhone leitete. Die Untersuchungsergebnisse wurden veröffentlicht. Natürlich kannten die Behörden in Sitten diese Untersuchungen, der Kanton war Mitglied der Genfersee Kommission. Doch im Wallis schien niemand beunruhigt, niemand sorgte sich über die massive Quecksilberverschmutzung, niemand stellte Fragen – auch kein Politiker.

Erst seit 2011 ist Quecksilber wieder ein Thema. Erst seit 2011 ist bekannt, dass auf der Lonza-Deponie 40-60 Tonnen Quecksilber liegen und dass die Deponie wieder undicht ist und das Grundwasser verseucht.

Deponie muss dringend neu saniert werden

Jetzt muss die Deponie dringend neu saniert werden. Das kann dauern. Zuerst sind die Experten – Geohydrologen, Chemiker, Bau- und Umwelt-Ingenieure – am Werk. Bis Ende des nächsten Jahres müssen sie eine «Detailuntersuchung» über Inhalt und Zustand der Deponie durchführen, dann eine «Gefährdungsabschätzung» vornehmen, bevor sie die «Variantenstudien» in Angriff nehmen können, um schliesslich ein «Sanierungsprojekt» zu erarbeiten: ein umfangreicher Bericht, der bei den Behörden eingereicht und abgesegnet werden muss. Dann erst wird man beginnen können zu überlegen, welche der vorgeschlagenen Sanierungsmassnahmen ergriffen werden soll. «Die erste Massnahme wird realistischerweise frühestens im Jahre 2022 umgesetzt werden können. Das geht einfach nicht anders», sagt Rémi Luttenbacher, Leiter Umweltprojekte bei der Lonza.

Ist die Deponie überhaupt sanierbar?

Und in dieser langen Zeit werden aus der undichten Deponie weiterhin Schadstoffe ins Grundwasser sickern. Welche Stoffe, in welchen Mengen und in welcher Konzentration? Wie lange noch? Was geschieht mit dem immer stärker verschmutzten Grundwasser? Viele offene Fragen. Genau genommen weiss man noch nicht einmal, ob die 1,5 Millionen Kubikmeter mächtige Deponie überhaupt sanierbar ist. Offen auch die Frage, wer zum Schluss den Schaden bezahlen wird!

Site Lonza de Viège, vu depuis la gare de Lalden 2.JPG

Bleibt noch nachzutragen. Im April dieses Jahres wurde im Grundwasser in Visp und im Bereich der Lonza-Deponie Benzidin, eine hochgiftige und krebserregende Substanz entdeckt. Joël Rossier, der in die Wüste geschickte Chef der Dienststelle Umwelt, schlug Alarm und verlangte sofortige Massnahmen. Die Lonza und auch Rossiers Chef, Staatsrat Melly, dagegen beruhigten. Das Grundwasser sei nicht betroffen, jede Gefahr sei gebannt, erklärten sie wiederholt.

Auch im Fall Benzidin fällt der dürftige Wissensstand der Lonza auf – einmal mehr. Bei der Lonza weiss man zwar, dass das Benzidin von der Deponie ins Grundwasser gelangt. Aber: Wie kam der hochtoxische Stoff auf die Deponie? Das scheint schleierhaft, selbst für die Lonza. «Wir wissen nicht, woher das Benzidin kommt. Die Lonza hatte und hat für keine ihrer Produktionen Benzidin benutzt», sagt ein Sprecher der Lonza.

Was kommt nach Benzidin?

1) Bericht der Geschäftsprüfungskommission (GPK) über das Quecksilberdossier, der dieser Tage veröffentlicht wurde. Der Walliser Grosse Rat (Kantonsrat) wird sich mit dem Bericht in der Dezembersession (10.-13. Dezember) beschäftigen.

———————————-

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

———————————————————-

Teil 1: «Der Fall Rossier»

Teil 2: «Zeitbombe Lonza-Deponie»

Grafikquellen         :

Oben             ––                 ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998

Unten       —      Lonza site of Visp seen from the Lalden station.

Abgelegt unter Kriminelles, Medien, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Angriff auf die VVN-BdA

Erstellt von DL-Redaktion am 1. Dezember 2019

Antifaschismus muss gemeinnützig bleiben! 

Protest again le pen 2002 0241.jpg

Quelle       :          VVN-BdA …

 Von Cornelia Kerth, Dr. Axel Holz

Am 4. November hat das Finanzamt für Körperschaften I des Landes Berlin der Bundesvereinigung der Vereinigung der Verfolgten des Naziregimes – Bund der Antifaschistinnen und Antifaschisten (VVN-BdA) e.V. die Gemeinnützigkeit entzogen. Damit verbunden sind vorerst Steuernachforderungen in fünfstelliger Höhe, die noch in diesem Jahr fällig werden. Weitere erhebliche Nachforderungen sind zu erwarten und auch zukünftig drohen wesentlich höhere steuerliche Belastungen. Damit ist die VVN-BdA in ihrer Existenz bedroht.

Das Finanzamt Berlin handelt damit anders, als das Finanzamt Oberhausen-Süd, das der Landesvereinigung NRW die Gemeinnützigkeit am 22. Oktober gewährt hat. In beiden Fällen war derselbe Vorwurf erhoben worden. Er besteht darin, dass die Landesvereinigung Bayern der VVN-BdA im bayrischen Verfassungsschutzbericht wiederholt als linksextremistisch beeinflusst dargestellt wird. Während das Finanzamt Oberhausen-Süd der Widerrede der VVN-BdA im Anhörungsverfahren entsprach, beharrt das Berliner darauf, dass „der volle Beweis des Gegenteils, als Widerlegung der Vermutung als extremistische Organisation“ nicht erbracht worden sei.

Das bedeutet, dass die Bewertung durch eine nachgeordnete bayrische Landesbehörde, die laut bayrischem Gerichtshof keine Tatsachenbehauptung darstellt, demnach über das Schicksal einer bundesweit arbeitenden zivilgesellschaftlichen Organisation entscheiden dürfen soll.

Von Überlebenden der Konzentrationslager und Gefängnisse 1947 gegründet, ist die VVN-BdA seitdem die größte, älteste, überparteiliche und überkonfessionelle Organisation von Antifaschistinnen und Antifaschisten Deutschlands. Sie vertritt die Interessen von Verfolgten und Widerstandskämpfern, sowie deren Nachkommen, tritt für Frieden und Völkerverständigung ein und hat gegen große gesellschaftliche Widerstände wesentlich dafür gesorgt, dass die Verbrechen des Nazi-Regimes nicht in Vergessenheit geraten sind, u.a. durch den Einsatz für die Errichtung von Gedenkstätten und Erinnerungsorten und vielfache Zeitzeugenarbeit. Sie informiert über aktuelle neofaschistische Umtriebe und organisiert den Widerstand in breiten Bündnissen.

Wir sind entsetzt und empört darüber, dass sich das Berliner Finanzamt die haltlosen Unterstellungen der bayrischen Behörde ungeprüft zu eigen macht. Damit behindert es genau das zivilgesellschaftliche Engagement, das von Regierung und Parteien angesichts schrecklicher rechtsterroristischer Verbrechen allenthalben eingefordert wird.

Wir fordern die Anerkennung der Gemeinnützigkeit für unsere Organisation!

Wir fordern praktische Unterstützung für alle zivilgesellschaftlichen Gruppen und Organisationen, die die Grundwerte des Grundgesetzes gegen rassistische, antisemitische, nationalistische und neofaschistische Angriffe verteidigen

————————————————————–

Grafikquelle          :         Protest against Le Pen, France, 2002.

Abgelegt unter APO, International, Mensch, Umwelt | Keine Kommentare »

Leichen im Keller

Erstellt von DL-Redaktion am 29. November 2019

(Teil 2): Zeitbombe Lonza – Deponie

9 Visp 120818.jpg

Quelle        :     INFOsperber CH.

Von  Frank Garbely

Der geschasste Walliser Umweltchef Joël Rossier war besorgt wegen Altlasten der Lonza-Deponie. Bei den Behörden fand er kaum Gehör.

Seit 1978 ist den Behörden bekannt: Die Deponie ist undicht und versaut das Grundwasser mit chemischen Schadstoffen. Heute, 41 Jahre später, ist die Deponie noch immer undicht, und sie versaut noch immer das Grundwasser, jetzt auch noch mit Benzidin, einem hochgiftigen und krebserregenden Schadstoff.

Jahrzehntelang haben Lonza und Behörden geschwiegen, dann vertuscht. Jetzt versucht man es wieder einmal mit Sanieren. Doch noch weiss man nicht wie; man weiss nicht einmal, ob eine Sanierung überhaupt möglich ist. Und vor allem, keiner kann sagen, wer zum Schluss den Schaden bezahlen wird.

Bodenmann schlägt Alarm

Zuerst war es nur ein Gerücht. In den Jahren 1977-1979 tauchten immer wieder Hydrologen auf und nahmen im Umfeld der Deponie Grundwasserproben. Hans Kalbermatten, damals Besitzer der Thermalquellen in Brigerbad, geriet in Aufruhr und fürchtete schon um sein Geschäft. Kein Wunder, die Deponie lag in unmittelbarer Nähe seines Thermalbades, dazwischen gab es nur die Rhone. Die Lonza wollte Kalbermatten keine klare Auskunft geben. Selbst das Amt für Umwelt Wallis (DUW) in Sitten, Auftraggeber der Hydrologen, hüllte sich in Schweigen.

Schliesslich war es ein junger Briger Gemeinderat, der für Klarheit sorgte: Peter Bodenmann, der spätere Präsident der SP Schweiz und Walliser Staatsrat. Ende April 1980 informierte er die übrigen Gemeinderäte. Aus dem Gerücht wurde ein handfester Skandal. Bodenmann hatte herausgefunden: Die Deponie war tatsächlich undicht, schlimmer noch, die Lonza und das Amt für Umwelt wussten Bescheid – seit zwei Jahren schon. Die Deponie liegt auf Territorium der Stadtgemeinde Brig, aber weder Lonza noch Sitten hatten es für nötig gehalten, die Briger Behörden zu informieren.

Lonza wiegelt ab: Kein Gift

Der Briger Gemeinderat war empört und setzte eine Krisensitzung an. Diese fand am 5. Mai 1980 im Stockalperschloss statt. Eine denkwürdige Sitzung. Das Protokoll zeigt: Sie hatte geradezu Modellcharakter für die Informationspolitik der kommenden Jahrzehnte. Die Lonza und das Amt für Umweltschutz gaben ihr Wissen immer nur scheibchenweise preis. Und meist erst auf öffentlichen Druck.

Jean-Pierre Julen, damals Chef des Amtes für Umweltschutz in Sitten, bestätigte: Die Deponie ist undicht. Er stellte es als eine riesige Überraschung dar: «Alle Experten waren überzeugt, die Deponie sei dicht.» Thaddeus Stachelski, Direktor der Lonza Visp, pflichtete Julen bei: «Selbst wir bei der Lonza sind total überrascht, niemand konnte sich vorstellen, dass die Deponie rinnt.» Gemeinderat Peter Bodenmann kritisierte heftig, dass die Gemeinde nicht rechtzeitig informiert wurde. Julen rechtfertigte sich: «Wir wollten, dass unsere Experten in Ruhe ihre Untersuchungen beenden konnten. Es war noch zu früh, die Gemeinde zu informieren.» Bodenmann wollte wissen, was genau die Experten untersuchten, und verlangte Einblick in ihre Untersuchungsberichte. Jean-Pierre Julen machte nur vage Andeutungen: «Unsere Experten vermuten, dass eventuell chemische Schadstoffe ins Grundwasser sickerten.» Mehr wollte er nicht verraten. Man müsse verhindern, die Bevölkerung unnötig zu beunruhigen, sagte er.

Dann schaltete sich Alfons Egger von der Lonza ein. Egger war langjähriger Vizedrektor und – bis zu seiner Pensionierung im Juni 1988 – auch Chef für Umweltschutz und Sicherheit. Egger nannte ein paar Zahlen und versicherte, die Lonza habe immer genau Buch geführt über die Abfälle, die auf der Deponie landeten. Er verstieg sich sogar zur Aussage, die Deponie stelle keine Gefahr dar. Egger wörtlich zu den Briger Stadträten: «Es handelt sich nicht um Gift, sondern um Produkte im Zersetzungsprozess; man kann nur von Verfaulen reden.»

Das war glatt gelogen. Egger kannte die Untersuchungsergebnisse. Und die waren alles andere als beruhigend. Im Gegenteil, sie dokumentierten eine gravierende Verschmutzung des Grundwassers.

Grundwasser massiv verschmutzt

Das Amt für Umweltschutz in Sitten hatte René Monod vom Hydrologischen Institut in Bulle mit einer Untersuchung beauftragt. Zuerst im Jahre 1972, dann erneut 1978. Der Auftrag: Monod sollte feststellen, welche Auswirkungen die Lonza-Deponie auf das Grundwasser in der Rhoneebene hat. Bereits 1972 stellte Monod geringfügige Verschmutzungen fest. Er fand leichte Konzentrationen von Chloriden, Spuren von Sulfaten, aber auch Ammonium, Nitrat, Nitrit usw.

Im Jahre 1978 wiederholte René Monod seine Untersuchung. Anfang Mai und Mitte November nahm er zwischen Visp und Gamsen diverse Grundwasserproben. Die Ergebnisse liessen keine Zweifel offen. Die Verschmutzung des Grundwassers hatte gewaltig zugenommen. René Monod in seinem Untersuchungsbericht: «Die erhobenen Daten (…) belegen eine schwerwiegende und massive Verschmutzung des Grundwassers in der Rottenebene.» Das Grundwasser war von einer Talseite zur anderen und mindestens bis 1,5 Kilometer unterhalb der Deponie verschmutzt. Monod empfahl weitere Studien. «Wenn keine Massnahmen ergriffen werden, ist zu befürchten, dass die Verschmutzung schlimmer wird und sich zudem weiter ausbreitet», so René Monod.

Ein Jahr später lieferte Monod einen weiteren Bericht. Auch die jüngsten Messergebnisse sprachen eine unmissverständliche Sprache. «Die Verschmutzung muss als sehr stark qualifiziert werden», schreibt Monod. Und: «Inzwischen hat sich die Verschmutzung bis unterhalb Lalden ausgedehnt; sie reicht über 2 Kilometer talabwärts.»

René Monod wies auch zweifelsfrei nach, woher die Verschmutzung stammte: aus der Lonza-Deponie.

Die Monod-Berichte blieben unter Verschluss. Selbst die Briger Gemeinderäte erhielten keinen Einblick. Überhaupt hatten sie grosse Mühe, sich ein Bild der Havarie-Deponie zu verschaffen. Und immer wieder gab es für sie Überraschungen. So stellte sich heraus: Die Lonza verfügte nicht einmal über eine gültige Baubewilligung. Dabei gab es die Deponie seit über 60 Jahren.

Deponie seit 1918 in Betrieb

Die ersten Projektpläne stammten aus dem Jahr 1917. Ein Jahr später wurde die Deponie in Betrieb genommen. Vorerst wurden fast ausschliesslich Kalkschlämme abgelagert. In den 1960er Jahren nahm die Lonza eine Benzinspaltanlage in Betrieb und stellte auf Petrochemie um. Mit einem Schlag änderte sich das Profil der Deponie, auf der jetzt zunehmend auch chemische Schadstoffe entsorgt wurden. Und die Deponie wuchs unaufhörlich, nahm schliesslich gigantische Ausmasse an. 1980 hatte sie sich auf rund 200’000 Quadratmeter ausgebreitet und wies ein Volumen von sage und schreibe 1,5 Mio. Kubikmeter auf, die Chemie- und Industrieabfälle türmten sich streckenweise 17 Meter hoch.

Für alle war klar, die Deponie musste saniert und die Verschmutzung des Grundwassers sofort gestoppt werden. Wegen ihrer gigantischen Grösse ein beinahe aussichtsloses Unterfangen. Die Projektierungsphase dauerte rund zehn Jahre.

Seit 1980 hatten Experten diverse Sanierungs-Methoden erarbeitet. 1988 entschied sich die Lonza schliesslich für ein hochkompliziertes, aufwendiges Verfahren, das den barbarischen Namen «Hydraulische Strategie» bekam. Hauptziel: Das verschmutzte Grundwasser der Deponie muss unter Kontrolle bleiben, damit es abgepumpt und entgiftet werden kann. Leichter gesagt als getan. Um das Schmutzwasser im Deponiebereich zu behalten, muss die Strömungsrichtung des Grundwassers geändert werden. Dazu werden, verteilt auf die ganze Deponie, rund ein Dutzend Brunnen und Pumpstationen installiert. Zuerst werden die Pumpen eingesetzt, um die Strömungsrichtung umzukehren und so zu verhindern, dass das schmutzige Grundwasser den Deponiebereich verlässt. Anschliessend wird mit einem weiteren Pump-Vorgang unter der Deponie das schmutzige Grundwasser eingesammelt. Dieses Schmutzwasser wird danach in der Fabrik Lonza und der Kläranlage Visp chemisch-biologisch behandelt, bevor es in die Rhone geleitet wird.

Die Sanierer sprachen auch von «Auswaschverfahren». Ihre Annahme: Durch sauberes Wasser, aber auch Regen- und Sickerwasser werde die Deponie im Verlaufe der Jahre langsam ausgewaschen. Mit anderen Worten, die Sanierer gingen davon aus, dass die Konzentrationen der Schadstoffe kontinuierlich abnehmen, bis sie schliesslich ganz verschwinden oder wenigstens umweltverträgliche Werte aufweisen werden.

Im Jahr 1988 gaben das Amt für Umweltschutz in Sitten und die Gemeinde Brig der Lonza grünes Licht für ihr Sanierungsprojekt.

Umweltverbände warnen

Einzig das Umweltsekretariat Oberwallis 1) hatte ernsthafte Bedenken. Es engagierte einen Gutachter. Die Wahl fiel auf den bekannten Zürcher Geologen und Sozialwissenschaftler Marcos Buser, einen erfahrenen Experten im Bereich Entsorgung chemotoxischer Sonderabfälle.

ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998.tif

Experte Buser erkannte gleich mehrere Schwachstellen des Sanierungsprojektes. Er kam zum Schluss: «Der Erfolg der anvisierten Sanierung ist ungewiss.» Trotz Sanierung bestehe die Möglichkeit, dass weiterhin Schadstoffe in den Rotten oder in das Grundwasser ausserhalb der Deponie entweichen, stellte Buser fest. Er erinnerte an den «ausgesprochen ungünstigen Standort der Deponie». Sie liegt nämlich in einem früheren Sumpf- und Schilfgebiet. Die Nase der Deponie schwimmt im Grundwasser. Die Schadstoffe stehen also direkt im Kontakt mit dem Grundwasser. Doch die tieferen Schichten des Grundwassers der Deponie werden von der Sanierung nicht erfasst. Nach Einschätzung des Experten Buser bestehe deshalb eine ständige Gefahr, dass aus den tieferen Schichten kontaminiertes Grundwasser ausströme.

Ein weiterer Schwachpunkt: «Umfang und Dauer sind nicht absehbar. Wie lange wird die Sanierung dauern: 10, 50 oder 100 Jahre?», fragte Experte Buser. Aber auf diese Frage gab es keine klare Antwort.

Lonza macht falsche Angaben

Was Experte Buser besonders störte: Die Lonza machte keine oder sogar unrichtige Angaben. Schon wieder. Buser: «Angaben über Abfallmengen sowie die Zusammensetzung sind spärlich. Ein Abfallinventar fehlt, ebenso Hinweise auf problematische Stoffgruppen (z.B. Aniline, Phenole).» Mit anderen Worten, die Lonza verschwieg – oder schlimmer noch – wusste nicht, was auf der Deponie lag.

1) Das Umweltsekretariat Oberwallis wurde von mehreren Umweltverbänden getragen, unter anderem von der Oberwalliser Gruppe für Umwelt und Verkehr (OGUV), Pro Natura und WWF.

*****************************************************************

  • 1. Teil: Der Fall Joël Rossier: Der Walliser Umwelt-Chef trat aus Protest zurück: Das Wallis sei nicht mehr in der Lage, das Umweltrecht korrekt anzuwenden.
  • Lesen Sie die Fortsetzung in den nächsten Tagen: «Der vertuschte Quecksilber-Skandal»

*****************************************************************

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Keine.

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

——————————————————————–

Grafikquelle         :

Oben          —       Visp seen from EXT 31161 from Brig to Burgdorf; in the foreground the Lonza premises.

———————————————-

Unten           —         ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998

Abgelegt unter Europa, Positionen, Regierungs - Werte, Umwelt | Keine Kommentare »

Der Geist der Partisanen

Erstellt von DL-Redaktion am 29. November 2019

Die  Gründe für das Auseinanderfallen Jugoslawiens

File:Bundesarchiv Bild 101I-005-0032-11, Jugoslawien, Polizeieinsatz.jpg

Von Erich ­Rathfelder

Die wirklichen Gründe für das Auseinanderfallen Jugoslawiens sind vielfältig und komplex. Davon aber will Peter Handke nichts wissen.

er Kampf der jugoslawischen Partisanen gegen den Faschismus während des Zweiten Weltkriegs ist bis heute ein Leuchtturm in der Geschichte dieses Kontinents. Welcher Mut gehörte 1941 dazu, den bewaffneten Kampf gegen die deutschen und italienischen Besatzungsmächte und ihre Kollaborateure aufzunehmen! Hitler und Mussolini kontrollierten fast ganz Europa. Deutschland griff die Sowjetunion an. Ein kleiner Haufen von gerade einmal 20.000 kommunistischen Partisanen ohne nennenswerte Bewaffnung wagte ab dem 4. Juli 1941, sich dem zu widersetzen.

Sie kämpften nicht nur gegen die Wehrmacht, die SS und italienische Truppen, sondern auch gegen die Truppen des faschistischen und mörderischen Ustaschastaats in Kroatien, gegen das Nedić-Regime in Serbien und die nationalistischen serbischen Freischärler, die Tschetniks. Und sie gewannen. Nicht nur wegen der klugen militärischen Führung von Josip Broz, genannt Tito, der später Präsident werden und teils autoritär regieren sollte. Die Hauptwaffe der Partisanen war die Parole „Brüderlichkeit und Einheit“. Sie wandten sich gegen den Nationalismus und Faschismus aller Seiten. Aus allen Nationen Jugoslawiens strömten ihnen Kämpfer zu, vor allem, nachdem bekannt wurde, dass 1941 bis 1945 Zehntausende Juden und Roma in das berüchtigte Ustascha-Konzentrationslager Jasenovac gebracht worden waren – mehr als 80.000 Menschen wurden allein dort ermordet. In den Schlachten an der Neretva und in Sutjeska 1943 gelang es ihnen, sich aus der Umklammerung der weit überlegenen vereinigten Truppen aus Wehrmacht, Italienern, kroatischen Ustaschen und serbischen Tschetniks zu befreien. 1943 in Jajce, mitten im Krieg, erarbeiteten sie sogar eine Verfassung für Jugoslawien und auch für Bosnien und Herzegowina, in der die Gleichberechtigung aller Nationen und Bürger des Vielvölkerstaats versprochen wurde.

1945 wurde aus einem zerstörten Agrarstaat mit mehrheitlich Analphabeten binnen 20 Jahren ein moderner Industriestaat. Jugoslawien war unter Titos Führung ein Einparteienstaat, der sich jedoch im Lauf der Zeit liberalisierte. Mit der Arbeiterselbstverwaltung wurden Zeichen gegen den orthodoxen Kommunismus gesetzt. Bis Mitte der 1970er Jahre entstand ein Staat, in dem die Menschen ein Auskommen hatten, mit Schulen für alle, Universitäten, mit Renten und Krankenhäusern, mit dem damals besten Pass der Welt, die Jugoslawen konnten visafrei in den Westen und den Osten reisen. Die Schattenseiten waren Repressionen, derer sich Titos Regime bediente, so etwa im Konflikt mit der Studentenbewegung 1968, den Belgrader Liberalen und dem „Kroatischen Frühling“ 1971. In vielen Bereichen wurden „Brüderlichkeit und Einheit“ aber tatsächlich gelebt, vor allem in der multinationalen und multireligiösen Gesellschaft in Bosnien und Herzegowina.

Bijela, Montenegro - panoramio - ines lukic (8).jpg

Wenn der umstrittene Literaturnobelpreisträger Peter Handke von den Partisanen und diesem Jugoslawien fasziniert ist, dann steht er nicht allein. Die westliche Linke einschließlich der So­zial­demokraten schätzte Jugoslawien und Tito. Der Kampf gegen Faschismus und Nationalismus ist heute in ganz Europa wieder aktuell geworden. Auch in Ex-Jugoslawien selbst. Vor allem die serbischen Nationalisten – aber nicht nur sie – haben ab 1991 Jugoslawien zerstört. Umso unverständlicher ist es, dass sich Handke schon während des Krieges der 90er Jahre auf die Seite des serbischen Nationalismus stellte – und weiterhin stur daran festhält. Im Zeit-Interview in der vergangenen Woche wiederholte er nicht nur nationale Mythologien, sondern zudem die haltlose These, Jugoslawien sei durch die Anerkennung Kroatiens durch Deutschland zerstört worden. Dass Serbien Kroatien schon im Sommer 1991 angegriffen hatte, dass der Krieg also ein halbes Jahr vor der gemeinsamen Anerkennung durch die damaligen EG-Staaten begonnen hatte, ignoriert Handke. Wie auch die serbischen Verbrechen der ethnischen Säuberungen.

Quelle         :         TAZ          >>>>>           weiterlesen

—————————————————————–

Grafikquellen         :

Oben         —         Polizeieinsatz, Soldaten beim Durchsuchen einer Waldhütte

Date 1943

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 101I-005-0032-11 / CC-BY-SA 3.0

—————————–

Unten           —         Bijela, Montenegro  –  Erstellt: ‎7‎. ‎Juni‎ ‎2009

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung 3.0 nicht portiert“ lizenziert.
Namensnennung: ines lukic

Abgelegt unter Europa, Kriegspolitik, Mensch, Umwelt | Keine Kommentare »

Dorf Mühlrose geht unter

Erstellt von DL-Redaktion am 28. November 2019

Mühlrose soll der Braunkohle weichen

File:Wochožanska jama 2.jpg

Aus Mühlrose und Schleife Sabine Seifert

Mühlrose, ganz im Osten der Republik gelegen, soll weg, der Braunkohle wegen. Else und Günter Zech wollen nicht fort. Bei den Noacks war der Umzugs­wagen schon da. Wie sich eine Dorfgemeinschaft schon vor dem Verschwinden auflöst.

as Dorf hat eine Straße, die hinein- und wieder hinausführt: in die selbe Richtung, aus der man gekommen ist. Wer in die andere Richtung fährt, landet nach wenigen Metern im Tagebaugebiet Nochten, wo die Lausitz Energie Bergbau AG (LEAG) möglichst lange Braunkohle zu fördern hofft. Auch die 150 Millionen Tonnen, die unter Mühlrose liegen sollen, will sie noch erschließen. Es könnte das letzte Dorf der Lausitz sein, das den Kohlebaggern weichen muss.

Seit sechs Jahrzehnten knabbert die Kohle an Mühlrose. Das Dorf ist ein Sonderfall. Denn noch steht nicht fest, ob die Kohle überhaupt gebraucht wird und ob abgebaggert werden darf. Dennoch wurde im Frühjahr diesen Jahres ein Umsiedlungsvertrag für die Einwohner unterzeichnet. Ein Großteil möchte umsiedeln. Aber längst nicht alle. Die Dorfgemeinschaft ist gespalten, der Dorffrieden dahin. Die einen kämpfen für ihren Wegzug, die anderen für ihren Verbleib. Die einen sind lauter, die anderen hartnäckig. „Die Seele des Ortes geht verloren“, sagt die Pfarrerin.

200 Einwohner zählt Mühlrose heute, im ostsächsischen Landkreis Görlitz gelegen. Ein hübsches Dorf, umgebaute Drei- oder Viertseithöfe, die typisch sind für das einst sorbische Siedlungsgebiet. Landwirtschaft wird hier schon lange nicht mehr betrieben. „Wo ich geboren bin, das ist schon weggebaggert“, sagt Else Zech. Die 80-Jährige lebt heute nur ein paar Dorfstraßen weiter. Es ist das Elternhaus ihres Mannes Günter, in dem das Paar mit seinem erwachsenen Enkel unter einem Dach lebt.

Günter Zech, der am Silvestertag 81 Jahre alt werden wird, ist in diesem Haus geboren. Er hat ein gelbes X darauf angebracht, ein öffentliches Bekenntnis, dass seine Bewohner bleiben wollen, wie zu hören ist. Nur zwei Häuser im Ort zeigen dieses X, obwohl es acht Höfe sein sollen, die nicht umsiedeln wollen. Zech schätzt die Zahl der Bleibewilligen, der Verunsicherten und Zögernden auf insgesamt 20. „Die Leute sind verängstigt“, sagt er. „Viele trauen sich nicht, die Goschen aufzumachen.“ Im Fall einer späteren Enteignung könnten sie ja schlechter wegkommen. Davor hat er keine Angst – „die wollen doch was von mir“. Kaum einer im Dorf, der nicht jemanden in der Familie hat, der bei der LEAG arbeitet oder gearbeitet hat.

Günter Zech war nie im Tagebau, er fuhr Lastwagen, schon zu DDR-Zeiten. Else Zech hat als Verkäuferin gearbeitet. „Wir haben alles ertragen“, sagt sie. „Dreißig Jahre Kohledreck. Damals konnte man keine Wäsche aufhängen.“ Denn damals führte die Kohleverladebahn noch direkt am Dorf vorbei. Schmutz und Lärm stellen heute kein Problem mehr da, sagen die beiden. Günter und Else Zech, er in blauer Arbeitshose, sie im türkisfarbenen Haushaltskittel, haben im Vorraum des Hauses Platz genommen. Ein Wintergarten ohne Grün, hinter ihnen der orange Heizkessel, auf dem Tisch lehnt eine gerahmte Luftaufnahme von Mühlrose.

Er: „Niemand hat uns gefragt: Und wer will bleiben? Man hat uns mundtot gemacht.“ Sie: „Wir sind nicht einmal zum Reden gekommen.“ Er: „Ich habe nichts dagegen, wenn die, die wegziehen wollen, wegziehen. Dann kommt endlich wieder Ruhe ins Dorf. Aber warum soll man das hier aufgeben?“ Sie: „Wir waren nicht einmal im Urlaub, wir haben alles ins Haus gesteckt. Jetzt sind wir über 80 und haben nie die Welt gesehen.“

Es gibt Fotos vom Mühlroser Gasthof „Zur Erholung“, der nur noch zu besonderen Gelegenheiten öffnet. Der 28. März 2019 war so ein Tag, der Vorstandsvorsitzende der LEAG war da, die Bürgermeister von Trebendorf und Schleife kamen, sogar Sachsens Ministerpräsident Michael Kretschmer von der CDU. Der Umsiedlungsvertrag für Mühlrose wurde unterzeichnet, der Energiekonzern kommt für die Neuansiedlung der Haushalte im Nachbarort Schleife auf, wo am Ortsrand ein Areal für etwa 40 Grundstücke der Neu-Mühlroser erschlossen wird. Auch Einzelumsiedlungen oder ein Umzug in Mietwohnungen werden finanziert, ebenso wie die Umsetzung von Kriegerdenkmal, Glockenturm und Friedhof.

„Wer wohin kommt, das ist alles schon geregelt“, erklärt Enrico Kliemann. Der 44-Jährige ist kommissarischer Ortsvorsteher von Mühlrose, das seit 1999 zur Gemeinde Trebendorf gehört, und er ist Mitglied im Beirat für die Umsiedlung. Kliemann hat einen Raum im Vereinshaus aufgeschlossen, an den Wänden Skizzen von Neu-Mühlrose. Die Bestandsaufnahmen seien fast abgeschlossen. „Wie man’s hat, kriegt man’s wieder.“ Aus Alt wird Neu. Aus einem historischen Dorf eine Neubausiedlung auf dem flachen Acker.

Wie erklärt sich Kliemann, dass von ihm geschätzte 90 Prozent aus Mühlrose wegwollen, wo noch nichts endgültig klar ist? Jahrelang sei nichts investiert worden, sagt Kliemann, nicht bei der Stromversorgung, nicht beim Abwasser, und auch das Internet stagniert bei 2G. Manche Häuser im Dorf hätten Risse wegen der Grundwasserabsenkung durch den Tagebau. „Und selbst wenn das Sonderfeld nicht mehr genehmigt wird, ist Mühlrose von drei Seiten umschlossen.“

Unsicherheit und Verzögerung hätten vielen zugesetzt, da Mühlrose vor ein paar Jahren schon einmal umgesiedelt werden sollte. Damals kam der bereits ausgehandelte Vertrag nicht zustande, weil der schwedische Energiekonzern Vattenfall aus dem Energiegeschäft in der Lausitz ausstieg. Die Mühlroser hatten lange Zeit, sich an den Gedanken eines Umzugs zu gewöhnen. Und mancher mag auch geglaubt haben, dass er materiell etwas hinzugewinnt. Oder sich um Altlasten nicht mehr kümmern muss. „Neue Chancen“, formuliert Kliemann neutral, „die sich woanders auftun.“

Dataja:Mühlrose Tagebau Nochten Kraftwerk Boxberg 2008-05-11.jpg

Waldemar Locke ist der Mann, der am 28. März seine Unterschrift unter den Umsiedlungsvertrag gesetzt hat. Schweren Herzens, das ist selbst am Telefon noch zu hören. Ein Treffen klappt nicht, der Bürgermeister von Trebendorf und Mühlrose, 57 Jahre alt, CDU-Mitglied und seit zwei Jahren im Amt, ist unter der Woche berufstätig. Bei der LEAG. „Es handelt sich um einen rein privatrechtlichen Vertrag“, erklärt er. „Wer umsiedeln will, kann umsiedeln. Wer bleiben will, kann bleiben.“ Fünf Parteien sollen den Vertrag bisher unterschrieben haben. Was passiert mit deren Häusern? Die, so hatte es Kliemann erklärt, sollen bald abgerissen werden. Das Dorf würde also in sich zusammenfallen. Ein Tod auf Raten.

Der Bürgermeister hat Verständnis dafür, dass die Älteren im Dorf nicht entwurzelt werden wollen. „Günter Zech spricht für sich“, sagt er anerkennend, „nicht für das ganze Dorf. Ich akzeptiere nicht, wenn man sagt: Alle wollen umsiedeln. Jeder soll für sich sprechen.“ Locke sagt, seine Unterschrift unter den Vertrag habe er gesetzt, damit die Umzugswilligen „ihre Ruhe haben“.

Qielle        :         TAZ         >>>>>         weiterlesen

————————————————————————

Grafikquellen           :

Unten         —          Blick auf den Tagebau Nochten vom Aussichtsturm bei Weißwasser.

Author Julian Nyča      /       Source       :  Own work
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
No Facebook.svg This file has been released under a license which is incompatible with Facebook’s licensing terms. It is not permitted to upload this file to Facebook.

——————————–

Unten     —        Mühlrose in Sachsen: Blick vom Schutzdamm über einen ausgekohlten Bereich des Tagebaus Nochten zum Kraftwerk Boxberg mit dem Neubaublock R (links), dem Werk 4 (900 MW), dem Werk 3 in der Mitte (2×500 MW) und dem still gelegten alten Kraftwerksteilen (rechts).

žórło Swójske dźěło
awtor René Mettke
Tuta dataja je pod licencu Creative Commons Attribution 3.0 Unported licencowana

Abgelegt unter Regierung, Sachsen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Bolivien: Die Bergbaunation

Erstellt von DL-Redaktion am 26. November 2019

Demokratie und Bodenschätze

20170812 Bolivia 1772 La Paz sRGB (37926540966).jpg

Quelle       :     untergrund-blättle CH.

Amelie Lanier

Wenn man die Geschichte Boliviens nach denjenigen Produkten einteilen wollte, die nach Eduardo Galeano „die Armut des Menschen als Ergebnis des Reichtums der Erde“ verursachen, so kann man dafür die Perioden des Silbers, des Zinns und die der Energieträger Erdöl und Erdgas ansetzen. In Zukunft vielleicht die des Lithiums. An diesen Bodenschätzen entlang entwickelte sich das heutige Bolivien.

Das Silber von Potosí bestimmte die spanische Kolonialzeit, und prägte das damalige Gebiet des heutigen Bolivien insofern, als sich die ganze Organisation der Gesellschaft unter den spanischen Behörden um das Funktionieren dieses Bergwerks und den Abtransport des dort gewonnenen Silbers drehte. Die Landwirtschaft, das Transportwesen und das gesamte gesellschaftliche Leben wurden dem untergeordnet. Die Eingeborenen des Hochlandes wurden versklavt und in den Minen vernutzt. Die spanischen Kolonialherren bedienten sich dafür einer Institution, die die Inkas eingeführt hatten, um in gemeinschaftlicher Arbeit Strassen und Kanäle zu bauen.

Als die einheimische Bevölkerung aufgrund der für sie viel zu schweren Arbeit gehörig dezimiert war, wurden sie durch schwarze Sklaven ergänzt, vor allem aus dem Gebiet der heutigen Guineas. Der „Reiche Hügel“ von Potosí befindet sich nämlich noch dazu auf einer Höhe von über 4000 Meter, wo der Sauerstoffmangel im Zusammenhang mit schwerer Arbeit sehr verkürzend auf das Leben der Arbeitenden wirkt.

Auch die Arbeit in der 1572 in Potosí gegründeten Münzprägeanstalt, die das ganze spanische Kolonialreich mit Silbermünzen versorgte, wurde von Sklaven geleistet. Nach dem Niedergang der Silberproduktion blieb die Münzprägeanstalt weiterhin einer der wichtigsten Wirtschaftsfaktoren des Kolonialreichs. Obwohl auch anderswo solche Häuser bestanden, war die Münze von Potosí mit Abstand die grösste, mit dem grössten Ausstoss an Münzen, weil sie eben an der Quelle stand. Sie war eine wichtige Beute der Unabhängigkeitskriege im 19. Jahrhundert, teilweise wurden die Prägestöcke abmontiert und woanders in Betrieb genommen.

Noch heute sagt man auf Spanisch, wenn man irgendwo eine wirkliche oder vermeintliche Goldgrube entdeckt zu haben scheint: „Es ist ein Potosí wert!“

Das Silber von Potosí war also nicht nur eine Ware wie andere Produkte des Kolonialreichs, wie Zuckerrohr oder Kakao, sondern eine der Grundlagen, mit der das Kolonialreich verwaltet und die Kolonialherrschaft finanziert wurde. Es trug dazu bei, dass Spanien bis zum Schluss den Silberstandard verwendete und der auf Gold beruhende Escudo eine untergeordnete Rolle gegenüber der Silbermünze Real spielte.

Die regionale und überregionale Bedeutung der Silberminen schlug sich jedenfalls nicht in irgendeiner Art von Wohlstand für die Eingeborenen – und der schwarzen, hmmm, Zwangseingeführten – nieder, und darin gleicht die Silber-Periode den nachfolgenden Perioden.

Die Epoche des Zinns, die MNR und die „Revolution“ von 1952

Das Silber verlor im Laufe des 19. Jahrhunderts aus verschiedenen Gründen an Bedeutung und ausserdem waren auch im „Reichen Hügel“ langsam einmal die Vorkommen erschöpft.

Aber das Zinn löste als Geissel der Vielen und Reichtum der Wenigen das Silber gegen Ende des 19. Jahrhunderts ab. Auch heute noch ist Bolivien der 5-tgrösste Zinnproduzent der Welt.

Dazu trug auch der von Bolivien 1884 verlorene Pazifik- oder Salpeterkrieg bei, der Bolivien nicht nur seinen Teil am Salpetergeschäft kostete, sondern auch seinen Zugang zum Meer und damit den Abtransport seiner Bergbauprodukte erschwerte und verteuerte.

Die Bedeutung des Zinns für verschiedene Legierungen in der Industrie und im Maschinenbau war im Laufe des 19. Jahrhunderts gestiegen. Vor allem der Vormarsch der Konservendose erhöhte den Bedarf nach Zinn. Heute ist es zusätzlich für die Glasherstellung unverzichtbar.

So gelang es einem findigen bolivianischen Unternehmer, über Zinnfunde und den Ausbau des Zinnbergbaus zu einem der grössten Zinnhersteller der Welt zu werden. Er erhielt auch Rückendeckung der bolivianischen Eliten, weil es ihm gelang, das chilenische Kapital aus dem bolivianischen Bergbau zu verdrängen.

Patiño war also sozusagen der erste „Nationalisierer“ des Bergbaus. Die Regierung von Paz Estenssoro und die von ihm gegründeten MNR – Revolutionäre Nationalbewegung – verstaatlichte dann 1952 nicht nur die Patiño-Zinnminen, sondern die ganzen damaligen Bergbaubetriebe Boliviens.

Comcipo-Protesta en LaPaz.jpg

Sie kann als ein direkter Vorläufer der MAS von Evo Morales betrachtet werden: Es war eine Regierung und Partei, die die Bodenschätze des Landes verstaatlichen wollte, mit der Absicht, einmal auch diejenigen am stofflichen Reichtum des Landes zu beteiligen, die ihn aus dem Inneren der Erde herausgeholt hatten. Diese Verstaatlichung und die damit einhergehende Absicht der Umverteilung war das, was sie als „Revolution“ bezeichneten.

Damit machten sich die Verstaatlicher nicht nur Freunde im In- und Ausland.

Das eigentliche Problem der MNR-Regierung war aber, dass die Bergleute Boliviens sich von dieser Verstaatlichung eine Verbesserung ihrer Lage erwarteten, die mit den Anforderungen des Weltmarktes in Widerspruch stand. Die bolivianische Regierung wollte durch den Export der verschiedenen Metalle (ausser Zinn und Silber auch noch Wolfram, Zink, Kupfer usw.) Devisen auf dem Weltmarkt erlösen, um damit verschiedene gute Taten, aber auch Investitionen in den Bergbau zu finanzieren.

Um an diese Devisen kommen zu können, hätten die Bergleute genauso weiter schuften müssen wie bisher, zu Hungerlöhnen und unter gesundheitsschädlichen Bedingungen. Letztere knüpften aber an die Verstaatlichung die Forderung, dass es ihnen jetzt besser gehen sollte, und so führte diese zu einer Serie von Streiks, dem Rückgang der Produktion und einer daraus folgenden Ebbe in der Staatskasse, was dann schliesslich der Grund für den Militärputsch von 1964 war. Der Gewaltapparat selber stiess nämlich an die Grenzen seiner Finanzierung.

Dieser Zyklus holt früher oder später alle ein, die die nationalen Reichtümer in Staatshand zentralisieren, auf dem Weltmarkt verscherbeln, und die Gewinne dann mit der Giesskanne über die Bevölkerung ausschütten wollen. Die Sache geht spätestens dann schief, wenn die Weltmarktpreise für diese national hergestellten Produkte fallen, und sich die Rechnung Einnahmen => Staatsnotwendigkeiten + Investitionen + Versorgungsleistungen nicht mehr ausgeht.

Statt Staat privat!

Auf den Sturz der Regierung von Paz Estenssoro folgten Militärregierungen, oftmals sehr kurzlebig, und Zivilregierungen, während sich das Missverhältnis von Einnahmen und Ausgaben weiterhin reproduzierte. Solange, bis mit Hilfe von IWF und Weltbank die Reprivatisierung als Allheilmittel entdeckt wurde.

Um die Sache ganz gut zu machen, wurde zusätzlich zu auch noch das Wasser als Ressource entdeckt, mit der sich gut Geld machen liesse – zum Wohle der Allgemeinheit, selbstverständlich.

(Das Inka-Reich entstand und hielt sich deshalb, weil es die Kriege auf dem Andenhochland um das Wasser beendete und eine zentrale und effiziente Verwaltung des Wassers schuf. Dergleichen ist in Bolivien bis heute nicht gelungen.)

Das bescherte Bolivien im Jahr 2000 ff. den Wasserkrieg, wo die Bevölkerung von Cochabamba die Rücknahme der Wasserprivatisierung und des Wassergesetzes erzwang. Damals schloss sich Evo Morales als Vertreter der Coca-Bauern diesen Forderungen an – mehr oder weniger: Wasser für alle, Coca für alle – und begann seine politische Karriere.

Die Energieträger

Genauso wie mit den Bergbauprodukten ist in Bolivien das Interesse, die Energieträger aus Kohlenwasserstoffen – die seit Anfang des 20. Jahrhunderts in Bolivien untersucht und abgebaut worden waren – zu verstaatlichen, nicht neu. Bereits in den 30-er Jahren ging das ein Präsident an, ganz ohne soziales Engagement, sondern einfach, um diesen strategischen Rohstoff im Sinne von Militär und Staatskasse durch staatlich kontrollierte einheimische Firmen zu fördern. Damals wurde die US-Firma Standard Oil hinauskomplimentiert.

Damals bereits stellte sich aber heraus, dass ohne ausländisches Kapital weder die nötigen Prospektierungen noch die Förderung, noch die Raffinierung angegangen werden konnten. Dazu kam der erbärmliche Zustand aller Transportverbindungen. Eine aus den USA während des II. Weltkriegs zwecks Kooperation nach Bolivien geschickte Expertendelegation empfahl unter anderem, vielleicht einmal die wichtigsten Strassen zu asphaltieren.

Choqueyapu 022.jpg

Und so ging die gleiche Angelegenheit wieder los: Ohne ausländisches Kapital gibt es keinen Zugriff auf die nationalen Reichtümer. Ist es einmal da, hat investiert und sich breit gemacht, so will es eben auch möglichst viel Gewinn einstreifen und ihn nicht am Ende mit gierigen bolivianischen Steuerbehörden teilen.

Nach der Verstaatlichung und der Gründung der staatlichen Ölfirma YPFB dümpelte sie eine Zeitlang vor sich hin, bis sie die Regierung Paz Estenssoro als Finanzierungsquelle für die inzwischen verstaatlichte (sonstige) Bergbauindustrie entdeckte. Der Verkauf von Schürfrechten für Öl sollte das Geld in die Staatskasse bringen, das dort für die Entwicklung des Zinn-, Silber- und Sonstwas-Bergbaus nötig war. Und so wurden Konzessionen für 40 Jahre vergeben, bis in die 90-er Jahre also.

Die Ölfirma, die sich an die Bohrarbeit machte, entdeckte Erdgas – für das sie gar keine Konzession hatte, weil daran gar nicht gedacht worden war. Die US-Firma Gulf Oil Company bot an, der bolivianischen Industrie Erdgas kostenlos zu liefern, wenn sie nur mit dem Rest machen könne, was sie wolle.

Man muss hier erwähnen, dass sich der Gasmarkt in den späten 50-er Jahren erst entwickelte. Bisher hatte man das überschüssige Gas meistens abgefackelt. Sowohl bezüglich der Verwendungsmöglichkeiten als auch des Transportes und der Förderkosten war alles neu, was der Ölfirma sehr freie Hand bei der Festsetzung der Preise liess.

Als die bolivianische Regierung 1969 die Verträge mit der Gulf Oil Company kündigte, mit Berufung auf neue Bedingungen, und die Energieträger wieder verstaatlichte, verhängten die USA ein Embargo über bolivianisches Erdöl und seine Derivate. (Kennen wir das nicht von irgendwo?)

Nach dem Putsch von Hugo Banzer 1971 wurden die Karten wieder neu aufgemischt. Die staatliche bolivianische Firma YPFB blieb bestehen, aber als eine Art leere Hülse, die Betrieb und Prospektion an Vertragspartner verpachtete. Dem legte die zivile Regierung Paz Zamora 1990 noch ein Schäuferl dazu, indem sie Gewinn-Garantien gab, um Investoren in diesen Sektor anzuziehen.

Dann wurden noch Joint Ventures genehmigt, und so um das Millenium herum war auf einer viel höheren Stufenleiter die gleiche Situation da wie früher einmal beim Bergbau: Es war klar, dass Bolivien grosse Reserven an Öl und Gas hatte, sie wurden auf dem Weltmarkt auch nachgefragt, aber private ausländische (USA & Argentinien) Firmen hatten die Hand drauf und die Gewinne flossen grösstenteils in ihre Taschen.

Neue Steuern sowie Gerüchte über geplante Exporte von Öl und Gas ins Ausland waren schliesslich der Grund, warum der Volkszorn sich in Aufständen entlud. Nachdem der damalige Präsident Schiessbefehl gegeben hatte, mit dem Ergebnis von 70 Todesopfern, war er genötigt, ins Ausland zu fliehen. Dort sitzt er bis heute.

Sein Nachfolger setzte zur Beruhigung der Gemüter ein Referendum über die Verstaatlichung der Energieträger an, das mit grosser Mehrheit für dieselbige stimmte. Als das Parlament versuchte, diese zu verwässern, musste wieder einmal gewählt werden, und so erstarkte auch die Partei von Evo Morales (MAS), mit dem Versprechen der Verstaatlichung der Energieträger, die mit Mehrheit im bolivianischen als Gesetz beschlossen wurde. Damals wurde auch festgelegt, dass zwischen Abgaben und Steuern 50% der Wertschöpfung in die Staatskasse fliessen müssen.

Die Verstaatlichung geschah übrigens durch Aktienkäufe, nicht durch Enteignung, da es dafür gar keine gesetzlichen Grundlagen in Bolivien gibt. Sie liessen sich im Parlament nicht durchsetzen. Mit den Einnahmen aus den Energieträgern wurde tatsächlich in Bolivien einiges in Bildung, Gesundheit und Infrastruktur investiert. Die Giesskanne funktionierte. Das gestehen der bolivianischen Regierung auch ihre Gegner zu.

Das Problem liegt auf der anderen Seite, bei den Einkünften.

Es wurden nicht alle Öl- und Gasfelder verstaatlicht, da der Staat gar nicht das nötige Kapital hätte, um sie alle zu erschliessen und zu betreiben. Ähnliches gilt für die Raffinerien. Die Verträge wurden neu verhandelt, und eben um die staatliche Entnahme für soziale Zwecke nicht zu gefährden, wurde kein Prozentsatz für Investitionen hineingeschrieben. Das heisst, weder die privaten noch sie staatlichen Firmen investierten viel, und die Produktion und vor allem die Raffinerieleistung ging zurück. Das wiederum heisst, dass Bolivien teilweise Treibstoff zu Weltmarktpreisen importieren muss – während es seine Rohprodukte aus Mangel an Transportmöglichkeiten (Pipelines, Flüssiggas-Terminals, Hafenanlagen) unter dem Weltmarktpreis verkaufen muss.

2005 standen Öl- und Gaspreise ungefähr so hoch wie heute, nach einigen Höhenflügen und Einbrüchen. Dennoch hat sich aus den oben genannten Gründen die Ratio zwischen Einnahmen und Ausgaben für Energieträger seither verschlechtert.

Der Agrarsektor und Evo Morales

Der Agrarsektor stand in Bolivien aufgrund der Wichtigkeit der Bergbauprodukte immer im Hintergrund. Der Hunger und die Unterernährung gehören zur Folklore Boliviens. Auf dem für intensive Produktion ungeeigneten Hochland quälen sich die Eingeborenen mit Trockenheit und Kälte herum, in den Niederungen haben sich teilweise Grossgrundbesitzer breit gemacht. Bolivien verfügt aber wie viele andere Länder Lateinamerikas auch über Dschungel: Unbebaute Flächen, wo vielleicht noch irgendwelche traditionell lebenden Eingeborenen hausen, und deren Besitzverhältnisse nicht ganz geklärt sind. Und diese Gebiete bieten sich an, wenn andere Einkommensquellen versagen, so auch heute.

Morales und seine Familie zogen als Kolonisten in den Dschungel und machten dort Flächen urbar, weil sie auf dem Hochland aufgrund von Missernten und Frost nicht mehr überleben konnten Und sie widmeten sich – neben anderen Pflanzen – dem Anbau von Coca.

Die Cocapflanze ist ein traditionelles Grundnahrungsmittel des Andenhochlandes, wo vieles an Nährstoffen und Vitaminen drin ist, das sich die armen Leute, also die Mehrheit der Bevölkerung der Anden, auf andere Weise gar nicht besorgen könnten. Ausserdem hilft es, die grosse Höhe zu ertragen und dennoch schwer arbeiten zu können. Ohne das Coca hätte die Silberproduktion von Potosí gar nicht funktionieren können. Schon die spanischen Kolonialbehörden sorgten deshalb dafür, dass es die Arbeiter der Bergwerke in ausreichender Menge erhielten. Es stellte sie aufgrund der beruhigenden und gleichzeitig anregenden Wirkung nämlich auch ruhig. Erst recht wurden sie von moderneren Bergbaufirmen dazu angehalten, ordentlich Coca zu konsumieren, um sich für die Anforderungen des Kapitals fit zu halten.

Ausserdem hielt es die Ureinwohner seit jeher bei ihren Festen bei Stimmung, im Zusammenhang mit Tanz und Gesang, so wie bei uns der Alkohol.

Das Mitte des 19. Jahrhunderts erstmals erzeugte Derivat Kokain wurde als Anästhetikum und Droge für psychische Erkrankungen eingesetzt, und wird in der Medizin teilweise heute noch verwendet, während sein Konsum und Besitz in den meisten Ländern der Welt heute strafbar ist.

Die bolivianischen Bauern, die das Coca anbauten, gerieten dadurch in den 80-er Jahren zwischen 2 Feuer. Einerseits war das Zeug für die Bolivianer bitter notwendig, andererseits fragten es die kolumbianischen Drogenbarone als Rohstoff für Kokain nach – dual use, ideal für den Produzenten – und drittens versuchte die exterritorial agierende US-Drogenbehörde DEA, den Anbau zu verhindern und die Pflanzungen zu zerstören.

In diesem Hin und Her wuchs Evo Morales in Verteidigung der angestammten Traditionen der bolivianischen Bevölkerung zu einer kämpferischen Autorität heran und griff nach den Sternen des höchsten Amtes im Staat.

Er machte sich also erstens durch die als Aktienkauf betriebene Rückholung der Bodenschätze in bolivianischen Staatsbesitz bei den USA unbeliebt. (Es waren vor allem US-Unternehmen, deren Beteiligung hier reduziert wurde.) Zweitens durch Festhalten daran, dass die Bolivianer zu entscheiden hätten, was in Bolivien angebaut wird.

Der „Regionalismo“ und die Provinz Santa Cruz

Die Stadt, die irreführenderweise „Santa Cruz im Gebirge“ heisst – sie liegt in der Ebene – war lange eine Art vergessene Ecke Boliviens, ohne Bodenschätze und Bergwerke, und wegen der fehlenden Strassen auch ohne Handelsverbindungen. Die Strasse des Silbers führte über das heutige Argentinien, rund um Santa Cruz war nichts ausser Urwald und Sümpfen. Die paar Grundherren und sonstigen Notabeln des Ortes versauerten hinter den 7 Bergen und konnten nicht einmal ihre landwirtschaftlichen Produkte in die in der näheren Umgebung ohnehin recht bescheidenen Metropolen transportieren, um irgendwelche kleineren Luxusgüter für sich einzukaufen. Auch ihr Lobbyismus für eine Eisenbahnlinie verhallte in Sucre und La Paz lange ungehört, weil einfach kein Geld dafür da war und auch kein ausländisches Kapital in diese Gegend investieren wollte.

Das änderte sich, als um die Wende zum 20. Jahrhundert in der Provinz Öl entdeckt wurde. Auf einmal kamen Fremde hierher, Kapital, bald eine Strasse, schliesslich gab es sogar einen Krieg wegen der Transportwege nach Süden, und Santa Cruz stieg zur wohlhabendsten Stadt Boliviens auf. Es stellte schliesslich auch einen Präsidenten, den Diktator Hugo Banzer, der ein weiteres dazu beitrug, Santa Cruz Privilegien aller Art zuzuschanzen.

Hier in Santa Cruz machte sich Morales unbeliebt, weil mit seinem Amtsantritt das Gerangel losging, wem eigentlich die Einnahmen aus den so umstrittenen Energieträgern zustanden? Den regionalen Institutionen oder dem zentralen Budget? Das Ganze wurde von den international gut vernetzten Lokalpolitikern von Santa Cruz und deren medialen Sprachrohren mit schönen Titeln über „rückschrittliche“, Koka kauende Indianer, die nicht wirtschaften können, und „fortschrittliche“, mit dem Finanzkapital der Welt verschwägerte und moderne Glaspaläste errichtende lokale Unternehmer ausgetragen. Und ebenso mit Zentralismus gegen Föderalismus, „Selbstbestimmung“, usw.

Hier, in dieser Gegend hat Morales besonders wenig Freunde unter den Besitzenden, aber viele unter den Blossfüssigen – die wiederum von der Mittelklasse aufwärts nicht wohlgelitten sind, und die viele Santacruzeños gerne von dort vertreiben möchten.

Das Militär

war zwar lange unterversorgt und entsprechend schwach, aber spielt in Bolivien eine doppelt wichtige Rolle. Natürlich muss es die Einheit nach innen wahren und hin und wieder aufständische Bergarbeiter, Bauern oder Bewohner von El Alto, der Zwillingsstadt von La Paz, niederhalten, notfalls auch mit scharfer Munition und mit Toten.

Aber Bolivien hat seit seiner Unabhängigkeit mehrere Kriege geführt und sie allesamt verloren. Das Territorium dieses Staates ist deshalb geschrumpft, es verlor den Zugang zum Meer, die Salpetervorkommen und den Hafen von Antofagasta im Pazifikkrieg, in anderen Kriegen Teile Amazoniens und des Chaco. Jeder Nachbarstaat hat sich ein Stück von Bolivien genommen. Die nationale Schmach sitzt bei den Bolivianern tief und das Militär wird deswegen doch auf eine widersprüchliche Art akzeptiert und verehrt, als Bollwerk gegen äussere Feinde und letzten Garant für die nationale Selbstbehauptung.

Das war auch der Grund, warum die kämpferischen Gewerkschaften die Militärdiktaturen eine Zeitlang geduldet haben.

Die Demokratie, die Verfassung und der Putsch

Als Evo Morales seine erste Wahl gewann, ging er in den Präsidentenpalast und schaute sein zukünftiges Büro an. Er fand, dass das Büro daneben vom CIA benutzt wurde. Seine Vorgänger, sicher jedenfalls „Goni“, fragten bei jeder Entscheidung nach, ob das den USA ohnehin recht wäre. Morales forderte die US-Botschaft auf, das Büro zu räumen – was auch geschah. Er machte sich auch hiermit unbeliebt.

Er war 14 Jahre an der Macht, aber vorher schon sehr präsent in der bolivianischen Politik, spätestens seit dem Wasserkrieg. Er sah sich als eine Art Landesvater, ohne den gar nichts geht. Deswegen sah er in der Amtszeitbeschränkung einen Verstoss gegen seine ureigensten Rechte als Führer. Und er setzte diese Amtszeitbeschränkung ausser Kraft, indem er erst ein Referendum ansetzte, in dem sein Anliegen mit knapper Mehrheit, aber doch zurückgewiesen wurde. Dann liess er sich vom Obersten Gerichtshof bestätigen, dass damit gegen sein Menschenrecht auf praktisch unbeschränktes Regieren verstossen würde. Und ging mit Schwung daran, sich wiederwählen zu lassen.

Er hat da etwas über die Demokratie nicht ganz verstanden, oder sie zumindest zu eigenwillig interpretiert. Die Demokratie samt ihrem Procedere besteht nämlich nicht nur darin, dass sich die Regierenden wählen und dadurch in ihrer Machtausübung bestätigen lassen müssen.

File:La Paz, Teleferico- Linea Amarilla.JPG

Es geht auch darum, dass die Kontinuität der Macht über den Wechsel der sie ausübenden Figuren bewerkstelligt wird. Damit ist klar, dass die abstrakten Prinzipien von Freiheit und Gleichheit – Freiheit des Eigentums und Gleichheit vor dem Gesetz, also Unterordnung unter das Gewaltmonopol – unabhängig von den jeweiligen Vollstreckern dieser Prinzipien gelten sollen. Deshalb gibt es in allen demokratischen Verfassungen diese Beschränkung, meistens auf zwei Amtsperioden, die z.B. in den USA nach dem Ableben von FD Roosevelt eingeführt wurde, damit so etwas wie seine 4-malige Wiederwahl nicht mehr vorkommt.

Eine ständige und womöglich erbliche Herrschaftsausübung, wie sie Monarchen oder Diktatoren treiben, verbieten die Grossmächte, die allen Staaten Demokratie vorschreiben wollen, und sind entsprechend sauer, wenn sich andere Staaten darüber hinwegsetzen. In Bolivien wird so etwas nicht geduldet.

Nach einigen Fehlschlägen in Sachen Regime Change wurde jetzt sehr vorsichtig vorgegangen. Auf das Referendum, den Gerichtsbeschluss und die Ankündigung der Wiederwahl folgten keine Donnerwetter aus Washington, Brüssel und ähnlichen Metropolen der Meinungsbildung. Es wurden keine Medienkampagnen gegen den „Diktator“ angezettelt. Sein Wahlkampf wurde beinahe wohlwollend kommentiert. Aber irgendwer sorgte dafür, dass alle wichtigen Institutionen wussten, was sie zu tun hatten. Dass nämlich Militär, Polizei, Gewerkschaftsführung, Santa Cruz-Politiker usw. an einem Strang ziehen, Kasperln mit Bibeln in der Hand auftauchen; dass plötzlich als Bauern verkleidete Oppositionelle oder „einfache Leute aus dem Volk“ vor laufenden Kameras Wahllokale stürmen usw. – das weist schon auf eine sehr weit gediehene Koordination hin, ebenso wie der Umstand, dass es Morales fast nicht gelang, das Land zu verlassen.

Evo Morales konnte sich deswegen so lange halten, weil er viele Gegensätze im Land ein Stück weit schlichten konnte und das Vertrauen der Volksmassen hatte. Es wird nicht möglich sein, ihn durch eine ähnlich integrative Figur zu ersetzen.

Che Guevara suchte sich deshalb Bolivien aus, weil er meinte, das Land sei zentral gelegen und vereinige alle Widersprüche Lateinamerikas in sich. Wenn es gelingt, dieses Land zu kippen, so seine Ansicht, dann würde der Rest der Nachbarstaaten folgen. In einer sehr abstrakten Weise haben die Drahtzieher des Sturzes von Morales vielleicht ähnliche Pläne, um in Sachen Hinterhof voranzukommen.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————

Grafikquellen       :

Unten       —        Looking down on La Paz from just below the canyon rim where El Alto is located. The large green field is Simón Bolívar Stadium (Estadio Libertador Simón Bolívar) which is most often used for soccer matches being the home field for Club Bolívar. Here the yellow line of cable car system Mi Teleférico connects the lower valley of La Paz with the city El Alto. Photo taken 2017. La Paz (elev.3,240m/11,942ft) was founded in the Andes by the Spaniards in 1548 in a canyon created by the Choqueyapu River. The administrative capital of Bolivia shifted to La Paz in 1898 while Sucre remained the constitutional and judiciary capital. On the western rim of the canyon on the Altiplano (High Plain) is the satellite city of El Alto (The Heights; elev. 4,150m/13,615ft) where there is flat land for the airport. The area was uninhabited until 1903 when the railroad reached the canyon rim and railway workers settled there to staff the railyards and depots. The district was politically separated from La Paz in 1985 and then formally incorporated as a city in 1987. Today El Alto is the second-largest city in Bolivia (after Santa Cruz) and the highest major metropolis in the world. The population is mostly indigenous, primarily Aymara. On Google Earth: canyon-rim viewpoint 16°31’3.04″S, 68° 8’59.57″W

——————————

2.) von Oben        —     Protesters from the Potosí Civic Committee blockade central streets in La Paz, Bolivia, as part of a 2015 mobilization.

————————————-

3.) von Oben         —        Río Choqueyapu before Ruta 3 at km 22, facing south

——————————————-

Unten        —       La Paz, Teleférico, gelbe Linie

Author Grullab

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

Abgelegt unter Amerika, Feuilleton, Regierung, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Die Artenvielfalt stirbt

Erstellt von DL-Redaktion am 26. November 2019

Die Artenvielfalt stirbt – und wir schauen zu

2014 Borneo Luyten-De-Hauwere-Bornean orangutan-06.jpg

von Tanja Busse

Wir befinden uns mitten im sechsten großen Artensterben der Erdgeschichte.[1] Das erste liegt etwa 500 Mio. Jahre zurück: Damals brachen so viele Vulkane aus, dass sich die Zusammensetzung der Meere und der Atmosphäre stark veränderte und in der Folge viele Arten ausstarben. Vor 443 Mio. Jahren driftete dann der Urkontinent Gondwana nach Süden und die Erde kühlte sich ab. Dabei starben vermutlich mehr als 85 Prozent aller Meeresbewohner. Als größtes Massenaussterben aller Zeiten aber gilt der Übergang vom Erdaltertum zum Erdmittelalter etwa zweihundert Mio. Jahre später, bei dem nach gigantischen Vulkanausbrüchen in Sibirien beinahe alles Leben weltweit vernichtet wurde. Das große Sterben zog sich damals mindestens über Tausende von Jahren hin. Erdgeschichtlich gesehen war das ein recht schnelles Aussterben in kurzer Zeit, aber im Vergleich zu dem, was heute passiert, war es slow motion.

Bis vor etwa 200 Jahren wussten die Naturforscher nicht einmal, dass Arten aussterben können. Sie konnten es sich nicht vorstellen, weil es die Idee des Aussterbens einfach nicht gab. In der Zeit vor Darwin hatte jedes Lebewesen seinen Platz in einer immerwährenden göttlichen Ordnung – obwohl damals längst Knochen von ausgestorbenen Tieren entdeckt worden waren. Erst der Naturforscher Georges Cuvier hatte – bei der Betrachtung des Backenzahns eines Mastodons – einen Aha-Moment, der ihn zu der Erkenntnis brachte, dass es früher Tierarten gegeben haben musste, die es jetzt offenbar nicht mehr gab. Dass diese Arten also ausgestorben sein mussten. Er entdeckte, dass das Leben selbst eine Geschichte hat.[2] Das war ein Gedanke, der bis dahin undenkbar gewesen war. Was wir uns heute wiederum kaum mehr vorstellen können, weil es für uns so offensichtlich ist. Keiner, der im Berliner Naturkundemuseum unter dem riesigen Brachiosaurierskelett entlangspaziert ist, könnte noch bezweifeln, dass Arten aussterben können. Doch früher war das eine disruptive Information, und viele Wissenschaftler verweigerten sich dem neuen Paradigma. Vielleicht werden sich die Menschen in 200 Jahren nicht vorstellen können, dass wir Menschen des frühen 21. Jahrhundert so blind vor der globalen Bedrohung standen wie einst Cuviers Zeitgenossen vor den Mammutknochen?

Heute wissen wir, dass das Aussterben von Arten etwas völlig Normales ist, Evolution eben. Die Wissenschaftler bezeichnen das gewöhnliche Entstehen und Vergehen von Arten in Zeiten ohne kosmische oder geologische Katastrophen als Hintergrundrate. Bei Säugetieren nimmt man an, dass etwa zwei von zehntausend Arten pro Jahrhundert aussterben.

Der mexikanische Biologe Gerardo Ceballos und seine Kollegen haben diese Rate mit den in den letzten Jahrhunderten ausgestorben Säugetierarten verglichen (ohne die vielen gefährdeten und vom Aussterben bedrohten mitzurechnen) und sie sind zu dem beunruhigenden Schluss gekommen, dass die aktuelle Aussterberate bis zu hundert Mal höher als die Hintergrundrate liegt. Andere Forscher gehen vom Tausendfachen aus. In Zukunft könnte die Aussterberate sogar zehntausend Mal so hoch sein.[3] Doch selbst Ceballos vorsichtige Schätzungen lassen nur einen Schluss zu: nämlich, dass wir uns tatsächlich mitten im sechsten Massenaussterben der Erdgeschichte befinden.[4]

Die Menschheit hat versagt

Das ist eine ungeheure Erkenntnis, die jahrelang ungeheuer gelassen aufgenommen wurde. Außer ein paar Wissenschaftlern und Naturschützern hat diese Tatsache die Medien und die Menschen viel zu lange kaum interessiert. Erst als der Weltbiodiversitätsrat IPBES im Mai 2019 die ungeheure Zahl von einer Million bedrohter Arten verkündete, machte das Massensterben Schlagzeilen auf den Titelseiten.

So weit der Blick reicht: Bild Mitte – Palmölplantagen.

Dabei schreien die Forscher ihre Erkenntnisse schon sehr lang sehr laut in die Welt hinaus. 1992 veröffentlichte der Physik-Nobelpreisträger Henry Kendall eine Warnung an die Menschheit, der sich 1700 Wissenschaftler, darunter viele Nobelpreisträger anschlossen: Die Menschheit befinde sich auf Kollisionskurs mit der Natur. Von den vielen Zerstörungen natürlicher Ressourcen sei der irreversible Verlust der Arten besonders ernst zu nehmen, schrieben Kendall und seine Kollegen vor einem Vierteljahrhundert. Kendall war Mitbegründer der Union of Concerned Scientists, der Vereinigung besorgter Wissenschaftler, die sich nicht damit begnügen, Entscheidungsträgern Forschungsergebnisse auf den Tisch zu legen. Sie fordern vielmehr science-based action, also politisches Handeln, das aus der Arbeit der Wissenschaftler die richtigen Schlüsse zieht – zur Rettung der Menschheit. Kendall ist 1999 gestorben, er hat nicht erleben müssen, dass die US-Amerikaner 2016 einen Präsidenten gewählt haben, der alle wissenschaftliche Evidenz ignoriert und selbst ausgedachte „alternative Fakten“ an ihre Stelle setzt. 2017 wiederholten Kendalls Nachfolger seine Warnung, und dieses Mal unterschrieben mehr als 15 000 Wissenschaftler aus der ganzen Welt. In „Warning to humanity, a second notice“bringen sie die Entwicklung seit 1992 auf den Punkt: Mit Ausnahme des Lochs in der Ozonschicht ist kein Problem gelöst worden, im Gegenteil. „Humanity has failed“, schreibt das Autorenteam um den Ökologen William J. Ripple. Die Menschheit hat versagt. Sie hat nicht genug unternommen, um den möglicherweise katastrophalen Klimawandel zu bremsen. Und darüber hinaus hat sie ein Massenaussterben entfesselt – das sechste in 540 Mrd. Jahren – das bis zum Ende dieses Jahrhunderts viele der gegenwärtigen Lebensformen auslöschen könnte.[5]

Fatale Apokalypseblindheit

Der Philosoph Günther Anders, der Ex-Mann von Hannah Arendt, hat über die Haltung vieler Menschen in den Jahren nach dem Zweiten Weltkrieg gegenüber der atomaren Bedrohung geschrieben und sie als Apokalypseblindheit bezeichnet. Mit der Erfindung von Atombomben hat sich die Menschheit als Ganze in die Lage gebracht, sich mit ihren eigenen Waffen selbst auslöschen zu können. Und die ganze Welt, wie wir sie kennen, gleich mit. Eine entsetzliche Erkenntnis, offenbar zu entsetzlich, um sich damit auseinanderzusetzen. Was bliebe übrig, wenn die Bombe eingesetzt würde? „Ein Trümmerfeld, unter dem alles, was Geschichte einmal gewesen, begraben läge. Und wenn der Mensch doch überlebte, dann nicht als geschichtliches Wesen, sondern als ein erbärmlicher Überrest: als verseuchte Natur in verseuchter Natur.“ So habe Albert Einstein die Lage beurteilt, schreibt Günther Anders und er ergänzt: „Und wir lesen es in den Zeitungen. Und wie reagieren wir darauf? Eben so, wie wir auf Zeitungsnachrichten reagieren: gar nicht.“[6]

Warum aber ist das so, warum wiederholt sich die Blindheit gegenüber den nuklearen Gefahren heute gegenüber dem Artensterben? Günther Anders glaubte, dass die Gefahr zu groß sei für unser Vorstellungsvermögen. Dass wir unseren eigenen Produkten und deren Folgen phantasie- und gefühlsmäßig nicht gewachsen seien. Anfang der fünfziger Jahre hat der Philosoph das geschrieben. Ein Vierteljahrhundert später, 1979, ergänzte Anders: „Die drei Hauptthesen: dass wir der Perfektion unserer Produkte nicht gewachsen sind; dass wir mehr herstellen als vorstellen und verantworten können: und dass wir glauben, das, was wir können, auch zu dürfen, nein: zu sollen, nein: zu müssen – diese drei Grundthesen sind angesichts der im letzten Vierteljahrhundert offenbar gewordenen Umweltgefahren leider aktueller und brisanter als damals.“[7]

Die chillige Ruhe, mit der wir bis vor Kurzem die länger werdenden Roten Listen ignoriert haben, gibt Günther Anders ein Vierteljahrhundert nach seinem Tod noch einmal Recht. Die Gelbbauchunke verschwindet? Der Feldhamster? Der Schierlingswasserfenchel? Schade, aber auch nicht sooo schlimm, also für uns nicht, wir Menschen sterben ja nicht aus, wir werden ja immer mehr und es geht uns immer besser. Diese Alltagserfahrung hat uns lange Zeit apokalypseblind gemacht. Dass das stille Verschwinden der possierlichen kleinen Tierchen um uns herum Teil eines globalen Massenaussterbens sein könnte, das auch das Leben der Menschen bedrohen wird, haben wir lange Zeit einfach nicht verstanden. Das übersteigt, hätte Günther Anders gesagt, unser Vorstellungsvermögen, dazu waren wir zu apokalypseblind, nein: dazu wurden wir zu lange apokalypseblind gemacht.

Es verschwinden nicht nur die Bienen

Doch immerhin, das ändert sich, seit die Krefelder Studie über das große Insektensterben ein weltweites Medienecho ausgelöst hat.[8] Die Krefelder Entomologen haben einen Nerv getroffen. Sie haben uns aus einem Schlaf gerissen und aufgeweckt.

So standen im Februar 2019 Millionen Bayern bei Regen und Kälte vor den Rathäusern Schlange, um für das Volksbegehren Artenvielfalt zu unterzeichnen. Und die Warnung des Weltbiodiversitätsrates, des IPBES – eine Million Arten vom Aussterben bedroht! – hat es in die Nachrichten und auf die Titelseiten der großen Zeitungen gebracht. Dass gehandelt werden muss, steht jetzt im Raum. Immerhin. Doch gleichzeitig ist die Diskussion auf merkwürdige Weise auf Insekten und vor allem auf Bienen beschränkt geblieben. Dieser enge Fokus könnte zu falschen Entwarnungen verleiten, fürchtet der Entomologe Udo Heimbach, weil wir über die Gefährdung vieler anderer Arten so viel weniger wissen.

Seit 2017 wird sehr viel über Blühstreifen als Beitrag zum Insektenschutz geredet, als könnte man mit einer schmalen bunten Blumenzierde um Äcker und Betonwüsten unsere lebensvernichtende Landnutzung umkehren. Ökologen wie Thomas Fartmann halten nicht viel von solchen Blühstreifen, vor allem nicht im konventionellen Ackerbau, weil sie die verbliebenen Insekten an die Ränder von Feldern mit gefährlicher Ackerchemie locken: Ökologische Falle nennt man das.

Viele Landwirte haben solche Streifen angelegt, weil sie beunruhigt waren über die Funde der Entomologen und selbst etwas gegen das Verschwinden der Insekten tun wollen. Die Kritik der Ökologen hat sie deshalb getroffen. Denn natürlich sind blühende Ackerränder besser als gar keine Ränder. Und die Blühstreifen haben noch einen großen Wert, den Ökologen vielleicht nicht erkennen: In der landwirtschaftlichen Ausbildung spielt Biodiversität so gut wie keine Rolle. Für die viele Landwirte sind die Blüten am Ackerrand ein erster Schritt zu Naturschutz auf den eigenen Flächen. So kann man die einjährigen Blühstreifen entlang der Agrar- oder Betonwüsten als Versuch interpretieren, das business as usual weiterzuführen wie bisher, nur eben mit kleinen Korrekturen, etwas verziert sozusagen, als Zeichen für die trügerische Hoffnung, dass ein paar Sommerblüten am Feldrand reichen werden, um die Insekten in ihrer ganzen Vielfalt wieder aufzupäppeln. Aber man kann sie auch als Zeichen deuten, dass viele Landwirte bereit sind für eine andere, vielfältigere Landwirtschaft. Blühstreifen sind nicht genug, aber sie sind die Symbole eines Aufbruchs auf dem Land.

Biodiversität ist eine Überlebensfrage für die Menschheit

Quelle          :      Blätter           >>>>>            weiterlesen

—————————————————————-

Grafikquellen      :

Oben             —       Bornean Orangutan (Pongo_pygmaeus)

—————————–

2.)       von Oben       —      Zerstörung des Regenwaldes

—————————————

Unten         —         Protest gegen Neonicotinoide auf der Demonstration Wir haben es satt! 2013.

Abgelegt unter International, Mensch, Regierung, Umwelt | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 26. November 2019

Von Kreuzberg über Mölln zur Nordsee

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ebru Taşdemir

Wenn ich mal rauskomme aus meinem Kreuzberger Dorf und unterwegs bin in Deutschland, denke ich oft den Satz „Ach nee, sieh an, auch das ist Deutschland“. Vor allem geschieht das, wenn ich in Gegenden bin, wo ich a) ziemlich voreingenommen hinfahre (Sachsen, Brandenburg, you name it) und überrascht bin, doch wenigstens eine coole oder zumindest freundliche Person dort zu treffen, oder b) wenn ich in Gegenden fahre, die in solch einem krassen Gegensatz zu dem stehen, was ich aus meinem Berliner Alltag kenne.

In der vergangenen Woche war ich zum ersten Mal an der Nordsee. Auf einer der größten Nordseeinseln, auf Norderney, um genau zu sein – rein beruflich. Gibt Schlimmeres, würden die Norddeutschen einen Arbeitstermin auf Norderney kommentieren, während man sich bei uns in Berlin schon mega rufend und jubelnd in die nächste Düne werfen würde. Nicht wundern also, in dieser Woche gibt es fast nur Nachrichten von der Insel.

An meinem Anreisetag bekomme ich noch über Twitter mit, dass Idil Baydar die Möllner Rede im Exil doch in Frankfurt gehalten hat, trotz konkreter Morddrohungen. Das Stresspotenzial, dass im Vorfeld durch solch eine Morddrohung aufgebaut wurde, hat die Kabarettistin durch eine enorme Entschlossenheit, diese Rede zu halten, abgebaut. Die Möllner Rede im Exil wird seit dem rechtsradikalen Brandanschlag in Mölln 1992 von Freunden und der Familie Arslan organisiert. Ayşe, Yeliz und Großmutter Bahide Arslan starben in den Flammen, viele der Familienmitglieder überlebten schwer verletzt, so wie Ibrahim Arslan. Anlässlich des Gedenkens erinnerte die Stadt Mölln jedes Jahr an den Mord, doch ab Jahr vier nach Mölln fand man es besser, nicht mehr die Familie entscheiden zu lassen, wer diese Rede hält. Die Möllner Rede wird seitdem im Exil gehalten, in diesem Jahr eben in Frankfurt, Idil Baydar sollte sie halten. Das die Comedienne Baydar schon mehrere Morddrohungen in diesem Jahr erhalten hat, macht diese Rede umso aktueller. Nun wurde sie also unter Polizeischutz gehalten. Seltsamerweise war das 1. Frankfurter Polizeirevier damit beauftragt, wie die Kollegin Ayesha Khan in der taz vom 18. 11. berichtete. Aus diesem Revier wurden die rassistischen Drohfaxe an die NSU-Opfer-Anwältin Seda Başay-Yıldız verschickt. Auch das ist Deutschland. Während ich also am Montag noch nachlese, wie die Veranstaltung war, trinken Rentnerpärchen gemütlich ihren Kaffee.

Berliner Möwenclan ?

Ich komme ja auch von einer Insel. Berlin vor dem Mauerfall. Es ist natürlich kein Vergleich zu dem Inselstatus von Norderney. Berlin verband ich mit dem Inselvolk der Linken, Arbeiter*innen und Aussteiger, Wohlstand trug man nicht auf die Berliner Straßen. Anders dagegen auf der Nordseeinsel: gediegene Boutiquen, wenige, silbern glänzende Mülleimer, aus denen nichts quillt, nirgends ein Döner und sogar die Fast-Food-Läden sind eher Bistros mit Sektchen oder Schnäppsken zum Schnitzelbrötchen.

Quelle          :          TAZ            >>>>>           weiterlesen

—————————————————————–

Grafikquellen       :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Berlin, Feuilleton, Mensch, Umwelt | Keine Kommentare »

Der Tod von Venedig

Erstellt von DL-Redaktion am 24. November 2019

 Tourismus bis zum Kollaps

File:Navire de croisière dans le canal de la Giudecca (Venise) (6156556391).jpg

Von Susanna Böhme-Kuby

„Wer aber vom Kapitalismus nicht reden will, der sollte auch vom Tourismus schweigen”, so könnte man den bekannten Ausspruch Max Horkheimers abwandeln. Denn seit seinem Beginn vor etwa 150 Jahren hat sich der moderne Tourismus weltweit zu einer hochprofitablen Industrie entwickelt, die große Mengen von Menschen und Kapital bewegt. Reisten 1959 noch 25 Millionen Menschen durch die Welt, so ist ihre Zahl inzwischen auf jährlich 1,4 Milliarden angeschwollen, und für das Jahr 2030 werden sogar ganze 2 Milliarden prognostiziert. Die Tourismusindustrie boomt also – doch mit ihrem Wachstum steigen zugleich auch ihre desaströsen ökologischen und sozialen Folgen.

Besonders schmerzlich zu spüren sind sie in Italien und im (Noch-)UNESCO-Weltkulturerbe Venedig. Die reiche Region Venetien ist die meistbesuchte Italiens: Jährlich zieht es viele Millionen Touristen in die nordöstliche Region, die mit fast 70 Mio. Übernachtungen ein Zehntel des dortigen Bruttosozialprodukts produzieren – davon fast 12 Mio. Übernachtungen in der Gemeinde Venedig. Tendenz: steigend. Erklärtes Ziel des Regionalpräsidenten Luca Zaia von der rechtsradikalen Lega ist denn auch die Ausdehnung der Branche von Venedig auf die gesamte Region. Schließlich zeigt ein internationaler Vergleich, dass Italien insgesamt gesehen in seinen Aufnahmekapazitäten noch entwicklungsfähig ist, da es weniger Touristen pro Einwohner aufnimmt als andere Länder. Das wollen investitionsstarke Regionen wie Venetien ausnutzen. Um noch mehr Besucher anzulocken, setzt Zaia dabei insbesondere auf den sogenannten Erlebnistourismus, also auf „emotionale” Angebote und „Events”, die „einzigartige Erfahrungen” anpreisen und sich schon anderswo zunehmender Beliebtheit erfreuen. Moderne Kreuzfahrer mögen eben nach wie vor den Blick auf Venedigs Dogenpalast vom Oberdeck genießen können, ganz gleich, ob sie damit die Stadt überfordern und das Ökosystem der Lagune zerstören.

Inzwischen subsumiert Zaia das ganze vielgestaltige Venetien unter den Werbeslogan: „The Land of Venice”. Mit dem unmissverständlichen Motto: „Buy Venice” eröffnete er 2017 denn auch eine Tourismusmesse im venezianischen Mestre. Investoren aus 47 „Buyer“-Nationen beteiligten sich am Ausverkauf der Stadt und der Region, erstmalig dabei auch China und Indien. Die so dringenden politischen Antworten auf die sozialen und ökologischen Probleme der Bevölkerung rücken damit in weite Ferne. Seit 1945 sind mit dem Auszug von über 100 000 Einwohnern aus der Inselstadt aufs Festland auch deren Lebensgrundlagen, differenzierte und kreative Arbeitsplätze, Wohnraum und die entsprechenden Infrastrukturen verschwunden. Heute leben im Zentrum weniger als 53 000 Menschen, dazu weitere 30 000 auf den Laguneninseln, dagegen 180 000 Menschen auf dem Festland.

Die lange Tradition des privatwirtschaftlichen Chaos

Um die Entwicklung dahin zu verstehen, lohnt ein kurzer Blick auf die kapitalistische Geschichte des Belpaese. Denn der Ausverkauf Venedigs steht in einer langen privatwirtschaftlichen Tradition der fortdauernden Dominanz von Renten und Renditen über tatsächlich erwirtschaftete Profite in der Industrie. Von der Staatsgründung (1861/1866) bis zur Weltwirtschaftskrise von 1929 dominierte ein stark lokal orientiertes und konzentriertes Familienkapital die nationale Entwicklung. Es war dann erst ausgerechnet das Mussolini-Regime, das sich in den 1930er Jahren an einem nachhaltigen öffentlichen Investitionsprogramm à la Keynes versuchte. Doch spätestens beim Wiederaufbau nach 1945 überwog wieder das privatwirtschaftliche Chaos.

Strukturmaßnahmen wie öffentlicher Wohnungsbau blieben verschwindend klein, trotz starken Bevölkerungsdrucks auf die Städte in den industriellen Zentren seit den 1950er Jahren – vor allem im Norden, aber auch im Süden, wie in Neapel, wo Bodenspekulation vorherrschte. Die durch Arbeitslosigkeit und die Migration in den Norden Europas ausgelöste Landflucht ließ ganze Dörfer nicht nur in Süditalien verfallen. In der Toskana und in Umbrien beispielsweise wurden viele verlassene Bauerngehöfte ab den 1960er Jahren als Ferienobjekte ausgebaut, meist von Ausländern.

Erst Ende der 1960er Jahre begannen lokale Verwaltungen Bebauungspläne zu erstellen, konnten damit aber landesweit nur noch wenig Raubbau verhindern. Die regionalen Unterschiede waren und bleiben dabei groß: Man blicke nur in die fast unberührt anmutende Landschaft um Volterra und durchfahre dann die amorphen Ränder der meisten Städte oder die immens verbaute Ebene um den Vesuv zwischen Neapel und Sorrent.

Hintergrund ist, dass Gewinne und Renditen damals im Immobiliensektor leichter und schneller realisierbar waren als anderswo, was langfristig zu einer Überkapazität an vorhandenem Wohnraum führte. Italiens Familien investierten schon von jeher wenn möglich in die eigene „casa” – ein Haus oder eine Eigentumswohnung in der Stadt. Der wachsende italienische Mittelstand kaufte dann seit den 1960/1970er Jahren auch Zweitwohnungen in den vielen Feriengebieten. Diese stehen heute, aufgrund der langanhaltenden Krise und trotz Preisverfalls, zunehmend zum Verkauf.

Die in den 1980er Jahren schleichend einsetzende Deindustrialisierung, die im letzten Jahrzehnt ihren bisherigen Höhepunkt fand und etwa 25 Prozent des einstigen Industriepotentials kostete, hat in den betroffenen Städten zu großen sozialen Verwerfungen geführt. So öffneten sich Räume für eine schier unbegrenzte „Touristifizierung“, gewissermaßen als Ersatzindustrie. Insbesondere die berühmten Kunstmetropolen Mittel- und Norditaliens, aber verstärkt auch südliche Städte wie Neapel und Palermo ziehen seitdem viel internationales Immobilienkapital an und werden von immer größeren Touristenmassen durchstreift. Mit dem Siegeszug des schrankenlosen Neoliberalismus und seiner fatalen Fortschrittsideologie unter dem ersten sozialistischen Regierungschef eines nationalen Mitte-links-Bündnisses, Bettino Craxi, kam es seit den 1980er Jahren zu massiven Deregulierungen in der Wirtschaft. Liberalisierung und Privatisierung setzten sich gerade in Venedig rasch durch, wo der Druck seitens des Kapitals besonders stark war. Das EXPO 2000-Projekt in der Lagune konnte zwar damals auch durch den Widerstand der Venezianer noch verhindert werden. Doch der Immobilienmarkt blieb weiter dem freien Spiel der Kräfte überlassen. Der Exodus aus der Insel-Stadt aufs Festland verstärkte sich und inzwischen hat auch Airbnb den Mietwohnungsmarkt erobert, so dass es heute mehr Wohnraum für Touristen und Bewohner auf Zeit gibt als für Einheimische. Das geht zu Lasten des städtischen Lebens, das immer mehr zur Hintergrundkulisse degradiert wird, und zu Lasten der Umwelt, die den Overtourism nicht mehr abfedern kann.[1]

Ein ökologisches Desaster

Acqua alta del 15 novembre 2019.jpg

Insbesondere die Touristenfracht der inzwischen über 600 Kreuzfahrtschiffe, die jährlich die kleine Lagunenstadt ansteuern, birgt eine enorme ökologische Gefahr. Im vergangenen Jahr schifften sie mehr als 1,5 Millionen Menschen in die Stadt. An einem einzigen Sommerwochenende durchqueren 10 bis 16 schwimmende Hochhäuser den Giudecca-Kanal und entlassen bis zu 50 000 Urlauber in die historischen Gassen. Weniger augenfällig als die Menschenmassen, aber noch viel gravierender, ist die starke Luftverschmutzung durch die schwimmenden Hotelburgen: Ein Schiff stößt Abgase von 15 000 Autos aus, allerdings aus noch viel schädlicherem, schweröllastigem Treibstoff.[2] Darüber hinaus schädigen die Kreuzfahrtschiffe nachhaltig das Fundament der Lagune, denn ihre mächtigen Antriebe verstärken die Erosion und spülen die Sedimente fort. Sie zerstören also das gesamte Ökosystem der Lagune, die entscheidende Lebensbedingung Venedigs. Doch dass die Stadt ohne die Lagune nicht sein kann, verdrängen die Entscheidungsträger schon seit einem Jahrhundert weitgehend. Dabei bildet diese Tatsache die Grundlage der berühmten Legge speciale von 1973, ein Gesetz, das nach der großen Flut von 1966 den Auftrag formulierte, die Lagune nicht nur zu erhalten, sondern wiederherzustellen – und das zumindest de jure noch in Kraft ist. Dass auch nach jahrelanger Debatte die „Grandi Navi” nach wie vor schamlos das Becken vor San Marco durchqueren – ungeachtet sogar jüngster Unfälle – zeigt, wie mächtig die Oligopole der Kreuzfahrtlinien sind. Sie haben sich längst in Venedigs Hafen eingekauft und dominieren die Aktiengesellschaft Venezia Terminal Passeggeri. Die Megaschiffe wollen in Venedig anlegen – koste es, was es wolle. Seit die Havarie der „Costa Concordia“ 2012 strengere Auflagen nach sich zog, wurden in Venedig diverse Alternativprojekte für das Anlegen der Schiffe entwickelt, darunter zwei Offshore-Varianten vor Chioggia und Cavallino. Sie alle lösen jedoch das Problem der Lagunenbelastung nicht im Geringsten. Geht es nach der Stadtverwaltung, sollen die Schiffe lediglich aus der Skyline der Stadtmitte verschwinden, aber weiter quer durch die Lagune von Malamocco zu den Handelshäfen nach Marghera und Fusina fahren dürfen. Das wurde von der Weltpresse erleichtert aufgenommen, jedoch in Unkenntnis der Lokalität und der Tatsache, dass dafür alte Kanäle der Lagune, wie der berüchtigte Canale dei Petroli, noch tiefer und breiter ausgebaggert und sogar massiv befestigt werden müssten. Mit dem Umweltschutz der Lagune wäre das aber absolut unvereinbar und würde obendrein mit den – ihrerseits ökologisch hochproblematischen – Hochwassersperranlagen (MoSE) kollidieren. Nicht auszumalen wären außerdem die Schäden einer möglichen Kollision mit den großen Öltankern. Aber eine Umleitung der Megaschiffe ins nicht weit entfernte Triest, wo es bereits Aufnahmekapazitäten gäbe, wird offiziell nicht einmal angedacht.

Quelle      :          Blätter         >>>>>            weiterlesen

——————————————————————-

Grafikquellen        :

Oben       —          Plusieurs navires de croisière et paquebots empruntent chaque jour le canal de la Giudecca (Photo Annie Dalbéra)

Author dalbera from Paris, France

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on by the administrator or reviewer File Upload Bot (Magnus Manske), who confirmed that it was available on Flickr under the stated license on that date.

—————————-

Unten      —          Acqua alta del 15 novembre 2019

Abgelegt unter Europa, Flucht und Zuwanderung, Innere Sicherheit, Umwelt | Keine Kommentare »

Dürre in Südafrika

Erstellt von DL-Redaktion am 20. November 2019

Das einsame Nashorn

Fil:Waterberg Nashorn3.jpg

Ein Schlagloch von Illja Trojanow

Eine Reise durch Südafrika ist Anschauungsunterricht in Sachen Klimakatastrophe. Der Regen bleibt aus, Farmer gehen pleite, Hotels schließen.

Dolly ist blind und gefräßig. Nicht ungewöhnlich für ein Breitmaulnashorn. Dolly teilt sich ein Wasserloch mit einigen Wasserböcken, Gnus und zwei Giraffen. Dolly muss täglich gefüttert werden, mit einem Ballen Luzerne. Ansonsten würde sie verhungern. Denn es wächst schon seit Jahren kein Gras mehr in der trockenen Karoo in Südafrika, seit sieben Jahren hat es nicht mehr richtig geregnet. Dolly frisst etwa 100 Euro im Monat weg. Die Eigentümer der Farm Bultfontein leisten sich mit letzten Kräften die Gesellschaft dieses Nashorns, als sei es ein Totem der Zuversicht. Solange es vor der eigenen Veranda mampft, gibt es noch Hoffnung.

Aber es wird zunehmend schwieriger, weil gemäß kapitalistischer Logik die Preise für Luzerne in die Höhe geschossen sind. Also haben sich die Farmer mit anderen zusammengetan, um Futter mit einem Lastwagen aus entfernten Gebieten her­anzuschaffen, wo die Preise niedriger sind. Die Hausherrin Carin muss in einem nahe gelegenen Städtchen als Lehrerin arbeiten, ihr Mann auf dem Bau.

Ansonsten würden sie nicht über die Runden kommen. Einige Nachbarn mussten schon ihre Farmen aufgeben und in die Städte ziehen. Das Überleben unter dem Diktat der Trockenheit ist ökonomisch schwierig, wenn die Fütterung der Schafe mehr kostet, als diese auf dem Markt einbringen. Öffentliche Unterstützung bleibt aus.

Wer dieser Tage durch Südafrika reist, erhält Anschauungsunterricht in Sachen Klimakatas­trophe. Nicht nur in der Karoo bleibt der Regen aus. Auch in der Provinz Northern Cape, wo sogar die Kakteen teilweise verdorrt sind. Die Namaqua-Wüste, berühmt für ihre Blumenpracht im September, ist inzwischen eine sandfeste Wüste und die Blumen, dieses Symbol des widerspenstigen Lebens in mageren Zeiten, sind zwar auch dieses Jahr erblüht, aber nur kurz und vereinzelt, um schnell wieder zu verschwinden – wie ein flüchtiger Traum.

Endgültigkeit der Ereignisse wird evident

In dem kleinen Binnenstaat Lesotho warten die Menschen seit drei Jahren auf Regen. Brandnarben ziehen sich über die spektakulären Hänge. „Der Berg stand in Flammen“, erzählt ein Einheimischer, „so was hatten wir noch nie erlebt.“ Ein mächtiger Bergfluss, der einst Felsen verschoben hat, als seien es Kieselsteine, ist nur noch ein Rinnsal, in Jauchen waschen die Dorfbewohner ihre Kleidung, neben ihnen die durstigen Nutztiere. Die luxuriöse Maliba Lodge, die über ein eigenes Bohrloch verfügt, teilt das hochgepumpte Grundwasser mit den nahe gelegenen Gemeinden, aber wenn es nicht bald regnet, so der Manager, werde man die Türen des Hotels schließen müssen.

In den schön eingerichteten Hütten steht noch jeweils eine Badewanne, die allerdings alles andere als einladend wirkt. Im Gegenteil: Die Vorstellung, angesichts der Trockenheit, die der Gast jenseits des Fensters zu Gesicht bekommt, Wasser zu verschwenden, erscheint hochgradig pervers. So dürften es wohl die meisten Gäste empfinden. Im globalen Zusammenhang füllen wir Wohlhabendere jedoch weiterhin bedenkenlos unsere Badewannen mit dem flüssigen Stoff, der mit Privilegien verbunden ist.

Zwei Folgen von ökologischen Desastern werden angesichts solcher Zustände schmerzhaft evident: die Endgültigkeit der Ereignisse und die autoritären Notwendigkeiten. Wenn das Wasser ausgeht, gibt es keine Lösungen mehr, keine Reaktionsmöglichkeiten, keine raffinierten technologischen Adaptionen. Die Optionen sind buchstäblich zerronnen. Es gibt nur Flucht oder Tod. Beides ist nur schwer rückgängig zu machen.

Quelle         :       TAZ         >>>>>          weiterlesen

——————————————————————

Grafikquellen     :

Oben      —         Laufendes Breitmaulnashorn in Namibia

Opphavsperson Ikiwaner
Tillatelse
(Gjenbruk av denne filen)
GNU Free Documentation License v1.2 only

————————

Unten        —            Pustynia Namib

Abgelegt unter Afrika, Positionen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Der Begriff der Herrschaft

Erstellt von DL-Redaktion am 17. November 2019

Ohne Herrschaft ginge vieles nicht
und das wäre gut so!

File:Moscow City - 2009-08.jpg

Quelle          :          untergrund-blättle  CH.

Von  Jörg Bergstedt Gruppe Gegenbilder

Grundanforderungen emanzipatorischer Politik.  Der folgende Text ist der Versuch, den Begriff der Herrschaft zu fassen und einen Rahmen zu stecken für die Debatte um herrschaftsfreie Gesellschaft. Zudem soll er die Rahmenbedingungen und Strategien emanzipatorischer Politik ausleuchten und ansatzweise abstecken.

Der Text steht neben anderen, die das Phänomen „Herrschaft“ zu beschreiben versucht haben – unterscheidet sich aber vor allem dadurch, dass er sehr stark auf eine Praxis gesellschaftlicher Veränderung und gesellschaftlichen Handelns ausgerichtet ist.

Eine bessere Welt – das reicht

Eine Gesellschaft „Freier Menschen in Freien Vereinbarungen“ ist eine konkrete Utopie, deren genaue Form nicht abgeschätzt werden kann. Zu gross ist der Unterschied zu den herrschaftsförmigen Gesellschaften der Gegenwart und Vergangenheit – und damit zu schwierig die Vorhersagbarkeit des individuellen und sozialen Verhaltens von Menschen ohne Zwangsverhältnisse. Anzunehmen ist, ist nach einem Prozess des Abbau bekannter Herrschaftsverhältnisse noch weitere zum Vorschein kommen – die Emanzipation, d.h. die Loslösung und Überwindung von Zwängen, von Herrschaft und Beherrschung aller Art, wird ein langer, wahrscheinlich immerwährender Prozess.

Der Entwurf einer einheitlichen Utopie als zukünftiger Gesellschaftsform im herrschaftsförmigen Hier und Jetzt würde eine Vorgabe sein, die eher eine Beschränkung als einer Befreiung gleich käme. Daher sind Zukunftsentwürfe nur Möglichkeiten, jedoch ihre Beschreibung wichtig, da sie beschreiben – wenn auch aus der aktuellen Perspektive -, dass schon jetzt herrschaftsärmere Entwicklungen denkbar und erstrebenswert sind.

Eine abschliessende Diskussion über die Details, über Machbarkeit und notwendige Vereinbarungen in der Zukunft wird angesichts des durch Herrschaftsverhältnisse beschränkten Horizontes, der eigenen Zurichtung auf herrschaftsförmige Wahrnehmung von Menschen und Gesellschaft sowie der nicht vorhandenen Erfahrungen kaum zu führen sein. Viele Möglichkeiten werden aus der heutigen Sicht gar nicht vorstellbar sein, so dass eine Festlegung einer Selbstbeschränkung gleich käme.

Zudem muss noch ein weiteres Hindernis in der Diskussion ausgeräumt werden. Eine Analyse von Herrschaft und der Entwurf von Ideen und Konzepten einer herrschaftsfreien Gesellschaft muss nicht zu einer perfekten Welt führen.Es reicht, gegenüber dem heutigen Zustand erstens eine spürbare Abnahme von gewaltförmigen Beziehungen zwischen Menschen zu erlangen und zweitens die Situation so zu gestalten, dass ein immerwährender Prozess möglich ist. Das würde reichen, um die Entwürfe als erstrebenswert zu empfinden und dafür einzutreten.

Worum geht es?

Die Fragestellung nach einer herrschaftsfreien Gesellschaft ist also nicht die nach dessen exakter Form. „Wie sieht eine utopische Gesellschaft aus?“ ist zwar eine interessante Frage und bietet viel Raum für anregende Diskussionen. Wichtiger aber ist die nach den Verhältnissen, unter denen sich Gesellschaft entwickelt: Was stärkt heute und in herrschaftsförmigen Gesellschaften die Konkurrenz und untergräbt Kooperation?

Was fördert gewaltförmiges Verhalten und Herrschaft zwischen Menschen? Umgekehrt, d.h. positiv formuliert für die gewollte Utopie, lautet die Frage: Welche Rahmenbedingungen fördern kooperatives und behindern konkurrierendes Verhalten? Unter welchen Bedingungen gehen Menschen gleichberechtigt miteinander um, entwickeln ihre eigenen Potentiale, aber organisieren die eigene Selbstentfaltung so, dass sich die anderen Menschen auch selbst entfalten können?

Der Mensch ist ein Wolf – wir brauchen den Staat?

Bei der Beantwortung solcher Fragen kommen viele Menschen zu der Auffassung, dass nur eine starke Moral den Menschen bändigen kann. Der Egoismus des Menschen stehe der Neigung zur Kooperation gegenüber – als Gegenmittel werden der Staat als aufklärerisch-kontrollierender Überbau, eine Religion oder der Appell an die Selbstzügelung genannt.

Doch hinter diesen Auffassungen verbergen sich zwei entscheidende Irrtümer: • Alle Versuche, statt dem vom Egoismus angetriebenen Menschen ein soziales und am Interesse anderer Wesen zu schaffen, sind Formen der Fremdbestimmung – selbst wenn appellativ an das Gute im Innern angeknüpft werden sollte. Denn schlechtes Gewissen ist Fremdbestimmung, es orientiert sich an Erwartungshaltungen anderer, an Angst und normativen Setzungen. Gesetze, Moral, Esoterik und Religion sind ohnehin Wertesysteme, die von aussen kommen und den Menschen steuern.

• Den Egoismus überwinden zu wollen, bedeutet den Verzicht auf den impulsivsten, energiegeladensten Antrieb des Menschen. Der Versuch wird meistens scheitern, weil der Egoismus zu stark ist. Wo er gebrochen wird, bleibt oft ein kraftloses, persönlichkeitsschwaches Wesen zurück.

Der Egoismus als Triebfeder

Tatsächlich wäre wichtig, genau das stark zu machen und kooperativ zu nutzen, was den Menschen im Kern antreibt: Sein Egoismus, der Wille nach einem besseren Leben, das Bedürfnis nach Sicherheit bzw. Geborgenheit, Lust und Befriedigung, Selbstentfaltung und Innovation – alles also Ziele, die vom Egoismus gespeist werden. Die gesellschaftlichen Rahmenbedingungen müssen so sein, dass diese Motivation die freie Kooperation fördert.

Wenn es besser für ein gutes Leben usw., kooperativ zu handeln, dann wird das auch eher geschehen. Gesucht sind also Rahmenbedingungen, unter denen der Antrieb zu einem besseren Leben, der Egoismus der Menschen, weitestmöglich das kooperative Verhalten fördert und konkurrierende Beziehungen verdrängt. Mit dieser Sichtweise erledigt sich auch die Frage nach dem Menschenbild.

Was ist der Mensch? Ist er gut oder schlecht, wenn er von Zwängen befreit ist? Mit der Idee der „Freien Menschen in Freien Vereinbarungen“ werden nicht die Menschen beschrieben, sondern die Rahmenbedingungen.

Es geht um die Frage, welche Rahmenbedingungen maximal kooperatives Verhalten fördern und welche eher konkurrierendes, Dominanz ausübendes Verhalten hervorbringen. Für dieses Ziel ist unerheblich, wie der Mensch an sich ist.

So oder so ist das Ziel, kooperatives gegenüber konkurrierendem Verhalten attraktiv zu machen. Das Ergebnis wird der Prozess zu immer mehr kooperativ-gleichberechtigten Beziehungen zwischen Menschen und der Abbau von Konkurrenz und gewaltförmigen Verhältnissen sein – von welchem Menschenbild und welcher Anfangssituation auch immer ausgegangen wird.

Die erhoffte Verbesserung, das mehr an Kooperation und das weniger an Konkurrenz ist die ausreichende Motivation zum Handeln.

Was fördert Konkurrenz?

Konkurrenz und Kooperation sind keine neuen Formen menschlichen Miteinanders. Sie finden im Hier und Jetzt bereits statt. Sichtbar ist auch heute bereits, was Konkurrenz fördert und was Kooperation fördert. Das kann erste Anhaltspunkt geben, welche Rahmenbedingungen eine herrschaftsfreie Gesellschaft fördern – und welche sie verhindern.

Das gibt nicht nur Grundlagen für die utopischen Entwürfe, sondern auch Ansatzpunkte für Veränderungen im Alltag und in der politischen Praxis. Zudem bietet sie einen grundlegenden Massstab zur Beurteilung politischer Forderungen und konkreter Projekte.

Daher sollen im folgenden die bereits heute spürbaren Aspekte aufgezählt werden.

• Jede Form institutioneller Herrschaft fördert Konkurrenz, weil in der Position des/r Herrschenden die Ausübung von Konkurrenz einfacher möglich ist. Zudem lassen sich die Folgen besser abschätzen. Wer also z.B. ein Interesse an einem Stück Land, einem Produkt, einem Rohstoff u.ä. hat, kann leichter konkurrierend agieren (statt sich mit anderen Menschen gleichberechtigt zu einigen), wenn eine durchsetzungsstarke Herrschaftsstruktur das konkurrierende, d.h. andere ungefragt benachteiligende Verhalten absichert.

Entweder die Person oder Gruppe ist selbst in einer herrschenden Position oder kann per behördlichem Verfahren einen Rechtsanspruch absichern (Kauf, Genehmigung …) und somit gegen KonkurrentInnen mit den Apparaten der Herrschaft drohen. In allen diesen Fällen ist konkurrierendes Verhalten einfach möglich, zudem können Folgen wie Proteste durch die Repressionsorgane der benutzten Herrschaftsstruktur zurückgewiesen oder per Einschüchterung vorab verhindert werden.

• Marktförmige Herrschaftsverhältnisse wie materielle Abhängigkeiten fördern ebenfalls die Konkurrenz. Wer keine Chance hat, sich selbst ausserhalb der herrschaftsförmigen Beziehung (z.B. zum Arbeitgeber, LandbesitzerIn u.ä.) zu organisieren, ist auf die Kooperation angewiesen – kann also nicht ohne erhebliche Gefahren aus ihr aussteigen. Das sichert wiederum die Person, die über den bevorzugten Zugang zu Ressourcen verfügt, ab. Sie kann sich meist beliebig konkurrierend verhalten, weil sie in der überlegenen Position ist.

• Unterschiedliche Handlungsmöglichkeiten fördern Konkurrenz. Wer über mehr Zeit, Wissen, Kraft, Geld, andere Ressourcen, Beziehungen usw. verfügt, kann im Kontakt mit anderen Menschen dieses unter Bedingungen stellen und somit oftmals die Regeln diktieren, unter denen dieses „Mehr“ zur Verfügung gestellt werden kann. Der „Tauschwert“ der Person und seines Besitzes sind grösser.

• Fremdbestimmte sowie nicht oder nur schwer trennbare Beziehungen zwischen Menschen brechen Selbstbestimmung und schaffen Zwang statt freier Kooperation, z.B. Kleinfamilien, Zwangsverwandtschaft, Ehe, aber auch ArbeitnehmerInnenschaft, Schulklassen usw.

• Herrschaft verringert Kommunikation, weil diese unnötig wird. Handlungen, die durch Herrschaft abgesichert sind, bedürfen weder der Zustimmung noch überhaupt der Kommunikation mit betroffenen oder aus anderen Gründen interessierten Menschen. Die Folgen eines durch Herrschaft abgestützten Verhaltens können ohne Absprache bzw. Zustimmung der Betroffenen auf andere Menschen abgewälzt werden. Auf diesem Prinzip basiert im Kern die Zerstörung der Umwelt, denn diese bedeutet auch immer eine Zerstörung oder Einschränkung der natürlichen Lebensgrundlagen und der Qualität des Lebensumfeldes von Menschen.

Alle Herrschaftsformen wirken konkurrenzsteigernd und antiemanzipatorisch, aber sie unterscheiden sich dadurch, dass einige auf sozialisierten, aber willensmässig veränderbaren Haltungen beruhen, andere wie Staat und Marktzwang eine über das individuelle hinausgehende Systemhaftigkeit haben, u.a. die Selbstverwertung des Wertes oder der Hang von Herrschaft zur eigenen Ausdehnung zwecks Selbstabsicherung.

Was fördert Kooperation?

Kooperation hat überall dort eine bessere Chance, wo solche oder vergleichbare Bedingungen fehlen. Kooperation und Konkurrenz bilden dabei eine Spanne – mit den beiden (utopischen) Polen der totalen Fremdbestimmung und der freien Gesellschaft. Je nach Bedingungen können sich individuelle und gesellschaftliche Verhältnisse dem einen oder anderen Pol annähern.

Das Bild der Spanne zwischen Kooperation und Konkurrenz ist beliebig oft wiederholbar – in den Beziehungen des Alltag, in der materiellen Reproduktion (Arbeit, Haushalt, Konsum), in politischen oder anderen Gruppen, in Projekten oder im gesellschaftlichen Umfeld (informelle Kontakte, gesellschaftliche Arbeitsteilung, Verwaltungen, Staat). Jegliches Herrschaftsverhältnis stärkt Konkurrenz.

Verschärfung von Herrschaftsverhältnissen, Ausbau von Herrschaftsstrukturen, neue Erwartungshaltungen usw. verändert die Situation immer stärker zum konkurrierenden Pol, während der Abbau von all diesem die Kooperation stärkt. Wo Herrschaft in all seinen Facetten fehlt, existiert nur noch die Gesellschaft der „Freien Menschen in Freien Vereinbarungen“.

Antrieb dafür ist der Egoismus als Drang zum besseren Leben. Innerhalb von Herrschaft ist ein besseres Leben meist über Konkurrenz organisierbar. Was ich habe, hat jemand anders nicht – egal ob das Eis, der Arbeitsplatz, die/der PartnerIn oder ein Buch. Die Verrechtlichung mit den dahinterstehenden Herrschaftsstrukturen schafft diese Situation. In einer herrschafts- und (damit einhergehend) verwertungsfreien Gesellschaft sieht das anders aus.

Weiterhin bleibt der Egoismus, der Wille zum besseren Leben der Hauptantrieb des Menschen. Nun ist aber alles, weil ein Mensch für sich verbessert, auch eine Chance für alle anderen.

Sie können das Neugeschaffene auch nutzen oder zumindest reproduzieren. Was die/der Einzelne schafft, ist selbst dann ein Vorteil für alle, wenn er/sie es zunächst nur für sich gemacht hat. Und weil das so ist, ist auch die Chance am grössten, die freie Entfaltung aller anderen zu wollen – denn deren Ideen und Produktivität, deren Musik, Kunst oder was auch immer kann mir ebenfalls zum besseren Leben dienen, denn es ist nicht mehr exklusiv.

Beispiele für Rahmenbedingungen, unter denen Egoismus und Kooperation zusammenfallen:

• Wenn alles Wissen frei wäre von Eigentumsrecht in Form von Patenten, Lizenzen, Copyright usw., würde alles, was einmal erfunden oder erdacht ist, sofort allen helfen. Neue Techniken wären theoretisch überall nachbaubar und sogar weiterentwickelbar – so profitiert auch die Person oder Gruppe, die den ersten Schritt gemacht hat, von der Kooperation, weil andere dann ihr Werk verbessern. Und da Technik dem besseren Leben und nicht mehr dem Profit dienen, ist die Chance am grössten, dass sich alle freuen, wenn andere die eigene Idee übernehmen und weiterentwickeln. Auf der Spanne von Konkurrenz und Kooperation ist das komplett freie Wissen ein starker Antrieb Richtung Kooperation.

• Wenn Land und Boden nicht mehr Einzelnen gehören würde, sondern die jeweils in einer Gegend Wohnenden gleichberechtigt darüber entscheiden, würden die Bedürfnisse und Träume der Menschen in den Vordergrund treten. Profitinteressen wären nicht mehr durchsetzungsfähig.

• Wenn Produkte frei wären, müsste nicht mehr jede Person Waren oder Geld (als Gegenwert von Ware) horten, sondern das eigene Leben wäre am besten und auch am sichersten, wenn es einen gemeinsamen Reichtum gäbe, auf den jedeR Einzelne zurückgreifen könnte. Wenn mehr als genug zu essen da ist, ist auch für jeden Menschen genug da, da es keine erzwungene Aufteilung gäbe. Wo dagegen Eigentumsrechte mit Herrschaftsausübung zwischen den Menschen stehen, müssten alle für sich horten und für sich Sicherheit schaffen. Das würde Konkurrenz bedeuten und die Wahrscheinlichkeit steigern, dass tatsächlich einige zu wenig haben würden.

• Offensichtlich ist, dass gesellschaftlicher Reichtum schneller zu erreichen und grösser ist als individueller Reichtum. Wenn alles allen gehört, haben auch alle alles. Unter den Verhältnissen von Privatbesitz muss jede Person selbst alles beschaffen – Essen, Bohrmaschinen (auch wenn nur einmal im Jahr benutzt), Zweitwagen, Abflussreinigungsdraht, Laptop, Eismaschine, Entsafter, Deutsch-Spanisch-Lexikon usw. – und zudem Zeit investieren in die Sicherung des individuellen Reichtums. Sofort könnte schon heute überall ein deutlich grösserer Reichtum entstehen, wenn nur wenige Menschen jeweils als soziale Basisgruppe ihren materiellen Besitz teilen – umfassend ausgestattete Computer- und Werkräume, Küchen und Bibliotheken wären die sofortige Folge.

• Die Effizienz der eigenen Tätigkeit würde steigen, weil Kontroll- und Überwachungstätigkeiten wegfallen würden.

Diese Vorschläge können schon heute verwirklicht werden. Projekte und Forderungen dieser Art wären erste Schritte zu einer herrschaftsfreien Utopie. Diese würde dann die Chancen der Freien Kooperation noch weit deutlicher ausbauen – und damit die Tendenz des Verhaltens von Menschen auf dem Strang von Konkurrenz bis zu Kooperation sehr stark zu letzterer verschieben.

Was ist Herrschaft?

Herrschaft zu beschreiben, ist nicht einfach. Sie ist ein Verhältnis zwischen Menschen, das durch unterschiedliche Möglichkeiten des Handelns gekennzeichnet ist, die gegeneinander gerichtet werden können.

Herrschaft umfasst dabei Mittel der direkten Beherrschung (Gewalt, Entzug der Lebensmöglichkeiten, Freiheitsentzug), der Beeinflussung (gerichtete Kommunikation über Bildung, Medien, Öffentlichkeitsarbeit usw.), institutionalisierte, d.h. dauerhaft, einseitig nicht oder nur schwer aufhebbar unterschiedliche Handlungsmöglichkeiten (Reichtum, Zugang zu Wissen und Ressourcen, körperliche Leistungsfähigkeit usw.) und Selbstbestimmung brechenden Rollenzuweisungen (direkte Anweisung, gesellschaftliche Kategorien und erziehende Zurichtung auf Rollen in Gesellschaft, Arbeitswelt, Familie usw. – oft an Geschlecht, Herkunft, Alter oder Ausbildung orientiert).

File:Frankfurt-Skyline.jpg

Auch die Möglichkeit zur Androhung solcher Mittel oder Fremdbestimmung ist bereits ein Herrschaftsverhältnis. Solche gewaltförmigen oder -bedrohten Beziehungen können zwischen Menschen oder Institutionen und Menschen bestehen und gegeneinander gerichtet werden.

Es gibt verschiedene Definitionen, die versuchen, das komplexe Phänomen Herrschaft zu fassen. Dabei teilen sie die Herrschaft nach ihren Wirkungsprinzipien, nach Herrschenden oder Beherrschten ein. All diese Einteilungen dienen allein dem Versuch, Herrschaft begrifflich zu fassen und damit durchschaubar zu machen.

In der Realität ist die Unterscheidung in verschiedene Herrschaftslogiken nicht vollständig möglich.

Herrschaft wirkt komplex, die verschiedenen Wirkungsformen überlagern und verstärken sich ständig. Es gibt weder eine einfache Einzelform von Herrschaftsausübung noch eine einfache Strategie gegen eine solche, separierbare Herrschaftsform. Auch die im Folgenden entworfene Beschreibung von Herrschaft dient vor allem der besseren Klärung, sie ist nicht tatsächlich so teilbar.

Herrschaft als Institution: Oben und Unten ganz fühlbar

Die bekannteste Form der Herrschaft ist die der direkten Beherrschung. Gewaltanwendung ist die auffälligste von ihnen. Herrschaft per direkter Gewaltanwendung zielt auf momentane oder absolute Unterwerfung der Person(en), gegen die Gewalt angewendet wird.

Beispiele sind Kinder, die von ihren Eltern geschlagen werden, jede andere Form der körperlichen Gewalt zum Zweck der Beherrschung in menschlichen Beziehungen, die zwangsweise Verhaftung durch Polizei oder der erzwungene Aufenthalt in Gefängnis, Psychiatrie u.ä. über Gewalt gegen Menschen bestimmter Hautfarbe, Geschlechter oder sozialem Status bis hin zum Krieg.

Die Androhung der Anwendung von Gewalt wirkt ähnlich der tatsächlichen Anwendung, sie kann daher gleichgesetzt werden. Das gilt auch für das als Drohung wirkende Potential der Gewaltanwendung, selbst wenn keine Drohung ausgesprochen wird.

Die unterschiedlichen Möglichkeiten direkter Gewaltanwendung schaffen schon dann eine Dominanz, wenn eine Anwendung von Gewalt im Bereich des Möglichen und Vorstellbaren liegt. Diese Form ist zwischen Menschen verschiedenen Geschlechts, Nationalität, Alters, Bildungsgrades usw. sowie zwischen Institutionen und von ihnen abhängigen Menschen häufiger als die tatsächliche Anwendung oder Androhung von Gewalt. Sie ist in der Regel nicht nötig, ein Herrschaftsverhältnis entsteht dennoch. Geschieht sie gelegentlich doch, erhöht sie zugleich auch die Glaubwürdigkeit der latenten Drohung.

Zur direkten Herrschaft gehört neben der Androhung von Gewalt in Beziehungen zwischen Personen oder Personengruppen auch die Herrschaft der Institutionen, also der Polizei, Justiz, der Ämter (Ausländeramt, Finanzamt, Baubehörde usw.), Schulen und Hochschulen, des Militärs (zur Zeit noch vor allem gegenüber Menschen und Institutionen im Ausland) usw. Sie verfügen über das Recht, Denken und Handeln von Menschen zu beeinflussen und diese Beeinflussung auch mit der Androhung von Gewalt durchzusetzen.

Diese Form direkter Gewaltanwendung bzw. ihrer Androhung ist zwar nach wie vor stark verbreitet, aber wird in modernen Herrschaftssysteme Stück für Stück durch die Mittel der manipulativen Beeinflussung sowie die Schaffung von Verhältnissen ersetzt, deren Zwang nicht auf direkter Gewalt besteht.

Zumindest ist das das Ziel moderner Herrschaftssysteme, da direkte Gewaltanwendung die dahinterstehenden Herrschaftsformen offensichtlicher werden lässt als Formen der Verhaltenssteuerung ohne direkte Gewaltwendung. In den modernen „Demokratien“ dehnen sich daher die weniger offensichtlichen Herrschaftsformen immer mehr aus, die in den folgenden Punkten beschrieben werden.

Marktförmige Zwänge, Kapitalverteilung und ökonomische Abhängigkeit

Der Mensch braucht Reproduktion und er will Genuss – materielle wie immaterielle. Er kann diese autark (für sich), in kleinen autarken bis umfassend selbstorganisiert-kooperativen Gruppen erreichen (Subsistenz) oder über den Markt. Marktwirtschaft ist eine Verregelung der Befriedigung von Bedürfnissen. Sie schreibt die Formen vor, wie Mensch an Waren und Dienstleistungen kommt – und wie er an den Gegenwert kommt, um wiederum Waren und Dienstleistungen zu erhalten (Geld oder andere Tauschwerte).

Dabei kann der Markt anonym sein, d.h. ProduzentInnen von Waren und KonsumentInnen kennen und begegnen sich nicht, oder direkt, z.B. beim direkten Tausch. In beiden Fällen ist aber das Prinzip von Wert, Wertung und Verwertung voll entwickelt.

Es schafft die Zwänge. Der Markt selbst ist damit eine Herrschaftsform, ein Regelwerk.

Dieses Regelwerk bestimmt Unterschiede zwischen den Menschen. Es gilt die totale Konkurrenz, d.h. im Markt ist es immer so, dass der Vorteil des einen der Nachteil des anderen (meist eines Dritten, nicht der direkt Handelnden) ist. Das ist oft sehr brutal, weil es Menschen in materielle Not und Abhängigkeit treibt. Die aktuelle Politik des Neoliberalismus hat zudem totalitären Charakter, weil es die Regeln des Marktes in jeder Region der Welt und auf jede Lebenssituation ausdehnen will. Die Verbindung mit den direkten Herrschaftsformen ist eng: Ohne direkte Herrschaftsformen gäbe es keinen Markt.

Die Verwertung basiert auf Eigentumsrecht und den Zwang zur Verwertung im sogenannten „freien Markt“. Hinter diesem Zwang stehen direkte Herrschaftsverhältnisse.

Daher gibt es Zweifel, ob die marktförmige Herrschaft, die Kapitalverhältnisse und der Verwertungszwang überhaupt als besondere Herrschaftslogik abgetrennt werden können. Dieser Zweifel ist berechtigt – kein Markt ohne Staat (oder eine ähnlich wirkende Herrschaftsform).

Daher sind auch alle politischen Strategien, den Markt über eine Stärkung des Staates (Reregulierung, Steuern, Gesetze usw.) einzuschränken, schon vom Ansatz hier falsch. Dennoch scheint berechtigt, diese Herrschaftsform von der personalen zu unterscheiden.

Sie funktionieren zwar auf der Basis und mit ständiger Androhung personaler Herrschaftsverhältnisse, wirken aber auch dort fort, wo diese nicht selbst sichtbar werden. Der Markt ist ein Regelwerk, dass aufgrund allgemeiner Akzeptanz sehr reibungslos funktioniert – trotz seiner offensichtlichen Brutalität für die VerliererInnen sowie den Zwang zur fremdbestimmten Ausbeutung von Denk- und Arbeitskraft fast aller Menschen.

Die dauernde Zuschreibung von Werten für alle materiellen Dinge (Stoffe, Produkte, immer mehr auch des Menschen, seiner Organe, Arbeits- und Zeugungsfähigkeit, Gene usw.) und allen Wissens zum Zweck der Verwertung, also des Kaufs und Verkaufs, der Mehrwertabschöpfung, des Tauschs oder der Kapitalakkumulation kommt einer kontinuierlichen, sich selbst reproduzierenden Verwertungs“maschine“ gleich.

Machbarkeitsorientierung statt Verwirklichung von Hoffnungen

Eng zusammen mit allen anderen Herrschaftsformen und durchaus auch als Ausdrucksform der anderen zu begreifen ist der Aspekt, dass Menschen nicht das tun, wonach sie sich sehnen und was sie wollen, sondern nach dem, was unter den gegebenen Umständen als machbar erscheint und wozu der Mut reicht. Die Alltagsgestaltung der meisten Menschen ist eine Aneinanderreihung von Handlungen, die mit ihren eigenen Vorstellungen, wie sich ihr Leben entwickeln soll, wenig zu tun hat.

Entscheidender Richtungsgeber ist vielmehr die Gesamtheit der äusseren Einflüsse – von Verboten und Drohungen über wirtschaftliche (Schein-)Machbarkeit bis zu Ängsten vor sozialer Isolation, Risiken, Unsicherheiten usw.

Praktisch unterbleiben meist schon die Versuche, eigene Sehnsüchte oder Utopien, oft aber auch nur ganz kleine Veränderungen umzusetzen, dass heisst ein Stadium, in dem Scheitern oder Erfolg möglich würden, wird gar nicht erst erreicht. Die Orientierung am scheinbar Möglichen und Angesagten wird im Laufe der Zeit zur neuen Normalität, als Handlungsimpuls verbleibt die Abweichung vom eigentlich Gewünschten. Eine permanente Verdrängung der Enttäuschung begleitet das Dasein, wird aber ebenfalls zur neuen Normalität.

Die Herrschaft in den Köpfen: Diskurs, Kategorien, Erwartungen, Standards

Markt und institutionelle Herrschaft (vor allem der Staat und von ihm legitimierte Institutionen) sind direkt sicht- und spürbar. Doch Herrschaft ist komplexer. Durch gesellschaftliche Zurichtung (Erziehung, Erwartungshaltungen, Anschauung gesellschaftlicher Praxis als „Normalität“), Sprache, gerichtete Kommunikation und die Propagierung von Standards (technische Normen, „das machen alle so“ oder „so ist das nun mal“, Verhaltenskodex usw.) entstehen Fremdbestimmung und unterschiedliches Wertigkeitsempfinden zwischen Menschen.

Alle werden in ihrem Leben für eine bestimmte soziale „Rolle“ beeinflusst, d.h. „konstruiert“ wurden.

Frauen gegenüber Männern, Jugendliche gegenüber Erwachsenen, Menschen ohne Abschluss gegenüber solchen mit akademischem Grad, Arme gegenüber Reichen, ArbeitnehmerInnen gegenüber ArbeitgeberInnen oder Selbständigen, sog. Behinderte gegenüber „Gesunden“, Nichtdeutsche gegenüber Deutschen (und jeweils umgekehrt) – diese und viele Unterschiede bestehen auch dann, wenn Menschen frei aller sonstigen Herrschaftsverhältnisse wären. Das ist nicht Schuld der Menschen oder ihrer Zusammenschlüsse, aber nichtsdestotrotz der Fall. Es ist auch nicht einheitlich, denn die oben genannten Personenkreise sind keine einheitlichen Gruppen – aber in der Tendenz sind sie gesellschaftlich „konstruiert“, d.h. ihnen wird über Jahre und Jahrzehnte eine gesellschaftliche Rolle, Erwartungshaltung und ein Selbstwertgefühl vermittelt. Innerhalb dessen leben sie „funktional“ in den realen Gesellschaftsverhältnissen, d.h. sie empfinden ihre Position als richtig für sich selbst, nehmen sie deshalb nicht mehr als konstruiert wahr und wehren sich nicht gegen diese.

Die Verbindung mit direkten und marktförmigen Herrschaftsformen: Diskurse sind beeinflussbar – über Bildung, Medien, Streuung gezielter Informationen sowie über Wissenschaft. Gerade letztere hat viel dazu beigetragen, biologistische Normen zu schaffen. Dass Frauen gefühlsbetonter sind, dass Schwarze sportlicher, aber weniger intelligent sind, dass Minderjährige nicht mündig sind, was als behindert gilt – all das hat seinen Hintergrund in wissenschaftlichen Diskursen und dem ständigen Weitertragen im Alltag.

File:Athens skyline.JPG

Die Institutionen der Herrschaft nutzen die Diskurse und beeinflussen sie über ihre herausgehobenen Möglichkeiten. Beispiele der letzten Jahre sind die humanitären Kriegen (weitgehend gelungener Diskurs), der Wohlstand durch globale Märkte (in grossen Teil gescheitert, weil offensive Proteste ihrerseits wieder Diskurse stark prägten) oder das Gute an der Demokratie einschliesslich der Verschleierung ihrer Herrschaftsförmigkeit (weitgehend gelungen).

Zu unterscheiden ist Herrschaft von den Begriffen „Macht“ und „Möglichkeit“. Macht bezeichnet die Möglichkeit zur direkten Ausübung von Zwang gegenüber anderen Menschen, die aber nicht kontinuierlich auf den bestehenden Rahmenbedingungen beruht, sondern auf das konkrete Verhältnis zwischen den Menschen bzw. einzelnen Gruppen.

Zudem wird der Begriff auch im Sinne von „Möglichkeiten“ benutzt: „Ich habe die Macht zu …“. Dabei wird nicht mehr zwingend von einem Verhältnis zwischen Menschen ausgegangen, sondern in dieser Bedeutung ähnelt Macht dem Begriff „Fähigkeit“. Für eine emanzipatorische Debatte erscheint das Wort „Möglichkeit“ zielgenauer.

Mit „gleichberechtigte Möglichkeit“ z.B. zur Reproduktion, zur Rohstoffnutzung usw. ist dann gemeint, dass die Menschen auf alle gesellschaftlichen Ressourcen gleichberechtigt zugreifen können, d.h. die Vielfalt der Welt und die unterschiedlichen Lebensentwürfe entstehen durch freien Willen – nicht mehr durch soziale Herkunft, Reichtum usw.

Die Konstruktion und Instrumentalisierung kollektiver Identitäten

Menschen treten nicht nur als Individuum, sondern auch als Gruppe auf. Nur in wenigen Fällen jedoch sind diese Gruppen das Ergebnis freier Vereinbarung, also die gleichberechtigte Einigung auf eine gemeinsame Organisierung unter Sicherung der Autonomie des Einzelnen.

Die meisten Gruppen basieren auf der Schaffung kollektiver Identität und/oder der Erzwingung der Mitwirkung in einer Gruppe. Kollektive Identität: Durch Festlegung scheinbar gemeinsamer Eigenschaften der zu einer identitären Gruppe zusammengefassten Menschen entsteht ein Kollektiv. Regelmässig ist das verbunden mit einem offensiven Bezug auf das „Wir“ im Sinne einer Konstruktion des gemeinsamen Seins und des gemeinsamen Willens.

Typisch ist zudem die Abgrenzung gegen das Andere – oft ist diese Abgrenzung der Hauptvorgang der Bildung kollektiver Identität.

Daher ist Ausgrenzung in einer Gesellschaft kollektiver Identitäten der Normalzustand und findet auf allen Ebenen der Gesellschaft und in fast allen Gruppen und Zusammenhängen von Menschen (gesellschaftliche Subräume) statt.

Kollektive Identität besteht aus der Definierung des Identitäres, also des die Menschen Verbindenden. Hier können diskursive Herrschaftselemente wie die Zurichtung auf Geschlecht, sozialer Gruppe, Nation, Verein usw. ebenso wirken wie die Entwicklung bestimmter Verhaltens-, Kleidungs- oder Sprachcodes als verbindendes Element einer identitären Gruppe. Sympathie und Antipathie beruhen auf diesen Identitäten.

Abgrenzung gegen das „Andere“ schärft das Erleben des Menschen mit gleichen Eigenschaften als soziales Umfeld. Das Kollektive entsteht durch die Wahrnehmung und Formulierung des Identitären als Gleiches und Gemeinsames. Am häufigsten geschieht das durch den Einsatz des Wortes „Wir“ – verstärkt wiederum in Verbindung mit der Abgrenzung gegenüber dem Anderen als „Ihr“ oder „Du“.

„Wir“ bezeichnet dann eine kollektive Identität, wenn es nicht einen tatsächlichen Ablauf beschreibt („Wir waren gestern in X-Stadt“ oder „wir haben überlegt, die und die Sache jetzt zu machen“), sondern als vereinnahmendes Wort genutzt wird, d.h. also durch die Nutzung die Kollektivität hergestellt wird. Ein solches „Wir“ schafft erst den gemeinsamen Willen. Daher ist es ein typischer Teil dominanten Sprachstils, als „Wir“ zu sprechen und damit eine Entscheidungsfindung oder eine Vielfalt selbstbestimmter Meinungen durch eine kollektive Identität zu ersetzen.

Allerdings sind auch andere Sprachformen als das „Wir“ möglich, z.B. der Verweis auf Traditionen („Es ist schon immer so gewesen“ u.ä.). Auch hier wird Einheitlichkeit dadurch hergestellt, dass sie beschrieben wird. Ein kollektiv-identitäres „Wir“ unterscheidet sich vom beschreibenden „Wir“ also dadurch, dass der zeitliche Ablauf umgekehrt ist. Das beschreibende „Wir“ versucht, einen Prozess im Nachhinein zu beschreiben.

Das kollektiv-identitäre „Wir“ schafft die Einheitlichkeit durch die Benutzung des „Wir“. Erzwungene Mitgliedschaft in Gruppen: Teil eines Kollektivs zu sein, ohne gefragt zu werden bzw. sich dazu frei entscheiden zu können, ist immer Herrschaft. Solcher Zwang entsteht durch Definition ohne Rücksprache, z.B. die Festlegung von Nationalität, Geschlecht, die Anmeldung an einer Schule, in einem Verein oder die nicht lösbare Bindung in eine Familie.

Vor allem für jüngere Menschen ist diese Ausübung von Zwang alltäglich. Ebenso entsteht Zwang, wenn es keine Alternative zur Mitgliedschaft in einer Gruppe gibt oder ein Verzicht mit erheblichen Nachteilen verbunden wäre. Schliesslich führen Vermischungen mit anderen Typen von Herrschaft zu Zwängen, z.B. die Zurichtung durch Erziehung, Medien usw. in einer Weise, die Menschen so konditioniert, dass sie sich zum Teil einer Gruppe machen.

Kollektive Identitäten und erzwungene Mitgliedschaften erfordern die Existenz von Personen, die die Identität (das „Wir“) definieren oder einen Zwang ausüben. Sie sind niemals Ergebnis eines gleichberechtigten Einigungsprozesses, also einer Organisierung von unten.

Diese würde immer klären, dass die sich organisierenden Menschen je nach Fragestellung unterschiedliche Auffassungen haben und niemand in der Lage wäre, ohne Klärung der Auffassungen in einem Sprachstil des „Wir“ aufzutreten.

Beispiele für kollektive Identitäten:

• Volk und Vaterland: Beide entstehen durch die Konstruktion einer kollektiven Identität über die Beschreibung scheinbarer gleicher Eigenschaften, Traditionen, Umwelt, Fähigkeiten usw. sowie die Abgrenzung gegen das Andere, was von aussen kommt und das „Wir“ direkt oder zumindest in der völkischen Reinheit bedroht.

Ein Volk entsteht nie durch die Einigung von Menschen darauf, ein Volk sein zu wollen, sondern durch Benennung des Kollektivs und der Benutzung des „Wir“ als kollektive Identität. „Wir Deutschen“ ist das Ergebnis einer Organisierung von Menschen zwischen Flensburg und Konstanz, sondern eine Formulierung, die die Identität erst schafft.

• Nation: Im Gegensatz zum Volk ist die Nationalität eine erzwungene Mitgliedschaft durch formalen Akt in der Regel bei der Geburt. Sie ist herrschaftsförmig, weil zumindest kraft Geburt ohne Einwilligung durch die betroffene Person. Ähnlich wirkt die Zwangszugehörigkeit zu einer Familie, einer Religion, einem Geschlecht u.ä., die oft auch bereits bei der Geburt entschieden wird und ab dann das Leben prägt.

• Identitäre Gruppen: Die meisten Cliquen, religiösen oder politischen Gruppen sind identitäre Kollektive, denn ihre Mitglieder unterwerfen sich mehr oder weniger deutlichen Codes an Verhalten, Sprache und manchmal sogar Aussehen (Kleidung, Frisur). Zudem gibt es meist ein „Wir“, das über ein beschreibendes Wort hinausgeht, und klare Unterschiede darin, wer dieses „Wir“ wie einsetzt und damit die Identität der Gruppe prägt.

Es ist Standard auch und gerade in politischen Zusammenhängen, dass einige Menschen privilegiert sind, Verhalten, Organisierungsform und politische Position der Gruppe zu definieren – nach aussen und nach innen. Ständige Aus- und Abgrenzungen gegenüber dem „Anderen“ sind die wenig überraschende Begleiterscheinung und zeigen nicht nur die herrschaftsförmige Organisierung, sondern sind für diese auch wichtig.

Denken in der Metaebene und ihr Fehlen

Eigentlich zeichnet genau das den Menschen aus und unterscheidet ihn nach dem Stand der Wissenschaft grundlegend von allen anderen Lebewesen: Er kann sich ausserhalb seiner selbst stellen und quasi aus der Vogelperspektive sich selbst und sein Umfeld betrachten. Dadurch sind Reflexionen des eigenen Handelns, das Planen von Strategien, das Abschätzen zukünftiger Entwicklungen und das Abwägen verschiedener Optionen möglich.

Tatsächlich verzichten die meisten Menschen in fast allen Situationen auf diese Fähigkeit des menschlichen Gehirns und Bewusstseins.

Das ist eine Folge von Zurichtung und des mangelnden Willens, sein eigenes Leben zu gestalten.

– Erziehung und die fremdbestimmte Ausrichtung des eigenen Lebens auf vorgegebene Lebenswege sind wichtige Gründe dafür, das Menschen sich nur innerhalb des Gewohnten bewegen. Selbst die Ausbruchsversuche bleiben dem Bewährten verhaftet, d.h. auch Protestkulturen z.B. unter Jugendlichen sind nur Wiederholungen im kollektiv-identitären Dasein. Das „Funktionieren“ im Gewohnten vermittelt Erfolgsgefühl und Geborgenheit.

– In einer Gesellschaft, die vorgegebene Lebensorientierungen belohnt, ist das Verharren in diesen einfacher als der Weg selbstorganisierten, kreativen Verhaltens. Der dauernde Druck der Verhältnisse und des sozialen Umfelds zur Normalität macht Selbstbestimmung zu einem kraftzehrenden Dauerkrieg zwischen der handelnden Person und allem drumherum. Demgegenüber ist selbst die Verweigerung attraktiv, weil die plurale Gesellschaft längst Nischen für den zeitweisen Ausstieg aus der dauernden Verwertungslogik geschaffen hat.

In der Folge verzichten die meisten Menschen auf die Benutzung ihrer Denkfähigkeit zur Metaebene, d.h. zur selbstbestimmten Gestaltung ihres Lebens. Dieses setzt voraus, dass der Mensch sich einen Überblick über seine Handlungsmöglichkeiten verschafft, um zwischen diesen wählen oder sich neue schaffen zu können.

Das Denken in der Metaebene analysiert den Zugang zu Ressourcen oder die sozialen Verhältnisse innerhalb einer Gruppe ebenso wie Reaktionen eines Umfelds, Gefährdungen oder vieles andere.

Innerhalb sozialer Gruppen fehlt solches Denken oft ganz. Die Personen, die zumindest teilweise in der Metaebene denken, erreichen schnell eine dominante Stellung. Oftmals reduziert sich ihr Denken auch auf bestimmte Bereiche, z.B. die Handlungsfähigkeit der politischen Gruppe, WG, Familie oder den Betrieb: Ist genug Geld da? Stimmt das Miteinander? Wo sind Konflikte? Solche und ähnliche Fragen analysieren die Lage in der Gruppe aus einer Metaebene.

Aerial of the U.S. Capitol under restoration 04879v.jpg

Wer so denkt, hat einen Vorsprung an Handlungsmöglichkeiten gegenüber denen, die auf solche Betrachtungen verzichten. Das schafft ständig Unterschiede. Wer mehr Überblick über die Potentiale und Konflikte in einer Gruppe hat, verfügt über mehr Handlungs- und Steuerungsmöglichkeiten. Allerdings führt die Dominanz nicht zum Glück – ganz im Gegenteil: Verzweiflung und Frust sind bei denen, die aus der Metaebene schauen, eher das Alltag. Denn der Zustand der meisten Gruppen ist aus Effizienz- und herrschaftskritischer Sicht katastrophal. Nur merkt mensch das gar nicht, wenn niemals ein Blick aus der Vogelperspektive auf das eigene Dasein versucht wird.

Herrschaft als alles durchdringender, sich ständig reproduzierender Systemkern

Herrschaft ist überall und tritt in verschiedenen Formen auf. Ebenso reproduziert sich Herrschaft auf sehr unterschiedliche Weise. Die institutionellen Formen werden über formale Herrschaft organisiert. Sie treten innerhalb der Gesellschaft im Grossen (Regierungen, Konzern-Hierarchien, Bildungssystem usw.) wie im Kleinen (Vereine, Familien, Arbeitsplatz/Ausbildung usw.) auf, sind also überall präsent, überlagern und beeinflussen sich. Fast immer ist jeder Mensch in jedem Augenblick in mehreren formalen Herrschaftsverhältnissen gefangen.

Noch durchdringender sind die beiden anderen Typen von Herrschaftsverhältnissen: Erstens das marktförmige, also die ständige Notwendigkeit zur markt- und meist geldförmigen Reproduktion sowie die Taxierung aller Dinge und immer öfter auch von Menschen nach ihrem Warenwert. Zweitens das diskursive, also die Normen, Erwartungshaltungen, Zurichtungen und Rollenlogiken zwischen den Menschen. Sie beherrschen den Alltag der Menschen in jeder Minute.

Menschen richten ihr Verhalten nach den Erwartungshaltungen des sozialen Umfeldes aus, taxieren einander nach Nützlichkeit, versuchen ihre Rolle auszufüllen und fordern von anderen selbiges ein – vielmals sehr unterschwellig, aber deshalb nicht weniger wirksam. Ob mensch einkaufen geht oder nur spazieren, ob mensch schläft oder wacht, fernguckt oder fussball spielt – immer gelten die Normen, immer ist definiert, was sich in diesem Moment und für die konkrete Person gehört. Regeln, Wertkategorien und mehr durchziehen das gesamte Leben („Bio-Macht“).

Dieses „System“ Herrschaft durchzieht nicht nur alles, sondern es reproduziert sich ständig neu. (Fast) alle Menschen sind nicht nur beherrscht durch Institutionen, Rollen und Erwartungshaltungen, Normen und Zurichtungen, Inwertsetzung und Verkauf der eigenen Fähigkeiten, sondern agieren auch selbst als aktives Subjekt zur Herstellung von Herrschaft.

Menschen werden zugerichtet und richten zu. So durchdringt Herrschaft alle Beziehungen zwischen Menschen. Besonders offensichtlich wird das bei der Betrachtungsweise der Gesellschaft als eine räumliche Einheit.

Der Gesamtraum ist herrschaftsförmig organisiert, es gibt die Institutionen der Macht, die Kontrolle, die Regeln und Gesetze sowie eine Vielzahl subtiler Formen der Normierung und Zurichtung.. Der Gesamtraum kann in viele Subräume zerlegt werden – und immer wieder finden sich die gleichen Logiken von Herrschaft. Immer und immer weiter ist Gesellschaft bis in kleinste Zellen menschlichen Zusammenlebens zerteilbar.

Die Zellen überschneiden sich, kaum ein Mensch ist nur Teil einer Familie oder nur Teil der MieterInnen in einem Haus, der ArbeitnehmerInnen am Arbeitsplatz, der SchülerInnen in einer Klasse usw. Aber in jeder Zelle spiegelt sich das volle Programm von Herrschaft wieder.

Diese Zellen sind ständig im Fluss, sie vergehen und andere entstehen neu. Diese Neuentstehung ist der deutlichste Punkt, wie Herrschaft funktioniert und allgegenwärtig ist bzw. sich reproduziert. Wo neue soziale Gruppen entstehen, z.B. Vereine, Firmen, Familien oder eben auch politische Gruppen und Zentren, so ist jedes Mal theoretisch zunächst ein leerer Raum geschaffen.

Die Frage der Herrschaft muss sich dort neu regeln. Es spricht nichts dafür, dass es ein Naturgesetz ist, wie sich Herrschaft dort organisiert, denn es gibt keinen Hinweis, dass das „System“ von Herrschaft auch aus biologischer Sicht irgendwie schlüssig oder auch nur erfolgreich wäre. Dennoch wird Herrschaft in jedem neu geschaffenen Raum wieder neu hergestellt.

Die Logiken gleichen denen des Umfeldes mit einer Tendenz zur ganz allmählichen, stetigen Modernisierung der Formen von Herrschaft, ohne selbige ganz oder teilweise zu überwinden.

Die diskursiven Vorgaben sorgen dafür, dass Menschen sofort in ihre Rollen springen und sich so „wie von selbst“ Verhaltensweisen reproduzieren, die die AkteurInnen auch vorher in anderen Subräumen zeigten. Veränderungen, bei Menschen immer möglich, bewegen sich in den Kanälen des Normalen und Normierten, d.h. Personen springen von einer Rolle zur anderen, aber nie raus aus den gesellschaftlich vorgedachten, diskursiv geprägten Rollentypen.

Meist verbinden sich die diskursiven Verhältnisse mit den marktförmigen Zwängen, die in allen Subräumen reproduziert werden – Reiche bleiben reicher als andere, ständig wird über Geld und davon abhängige Möglichkeiten nachgedacht usw. Und schliesslich kommen die institutionellen Herrschaftsverhältnisse hinzu: Wer kommt ans Konto ran, hat die Schlüssel zu einem Raum, kann nach aussen vertreten, ist formaleR ChefIn, wird von aussen als Autorität angesprochen oder dargestellt usw.

Herrschaft ist etwas, was sich selbst immer wiederherstellt. Das ist Normalität. Emanzipation ist daher nur als energischer und aktiver Gegenprozess vorstellbar. Die politische Bewegung ist das beeindruckendste Beispiel für die Überlegenheit des allumfassenden „Systems“ Herrschaft selbst gegenüber dem formulierten Willen der AkteurInnen. In krassem Gegensatz zu den eigenen Slogans, ständigen Beteuerungen und politischen Positionen sind politischen Zusammenhänge insgesamt und in jedem Subraum von Hierarchien und genormten Verhalten intensiv durchzogen.

Zurichtungen, Erwartungenshaltungen, unterschiedliche Möglichkeiten, die ständige Sortierung nach Nützlichkeit oder auch formale Hierarchien prägen den Alltag politischer Arbeit. In jeder neuen Gruppe und in jedem neuen Projekt reproduziert sich diese Herrschaft ständig – und sie gleicht den Logiken von Herrschaft, wie sie in der Gesellschaft auch insgesamt gelten. Insofern ist politische Bewegung ein fester Bestandteil des „Systems“ – sie ist ebenso an der Aufrechterhaltung von Herrschaft beteiligt wie jeder andere Teil von Gesellschaft.

Das ist nicht überraschend, sondern entspricht der Logik einer sich diskursiv, marktförmig und institutionell im gesamten Leben verankernden und überall reproduzierenden Herrschaft.

Aber es ist fatal. Politische Bewegung ist nicht das Gegenmodell zur Herrschaft, sondern eher „zuständig“ für die Organisierung von Herrschaft in den Subräumen politischer Arbeit. Sie ist damit systembildend, ob sie will oder nicht. Noch mehr: Gerade die Selbstreproduktion von Herrschaft in „linken“ politischen Gruppen führt zur Modernisierung von Herrschaft, weil dort verkrustete, allzu offensichtliche oder uneffiziente Führungstechnologien offensiver in Frage gestellt und durch neue Techniken ersetzt werden.

Auch von daher ist nicht überraschend, dass es gerade Ex-„Linke“ sind, die nach Erklimmen der Karriereleiter später an anderer Stelle der Gesellschaft Herrschaft moderner umsetzen und erneuern – siehe die effizienten neoliberalen „Reformen“ gerade rot-grüner oder rot-roter Koalitionen oder die Modernisierung zentralistischer NGO-Strukturen durch die instrumentellen Herrschaftsverhältnisse bei Attac. Doch auch die „linksradikalen“ Organisierung mit Plena, Delegiertenräte und Orga-Gruppen sind nur Modernisierung überkommener Strukturen wie Mitgliederversammlungen usw.

Offen bleibt aber die Frage, ob das so sein muss (z.B. weil der Mensch „so ist“ oder weil er Herrschaft und Orientierung braucht) oder es aufgrund der überwältigenden Prägung von Gesellschaft durch das Prinzip „Herrschaft“, aufgrund von Zwängen und Erwartungshaltungen nur unendlich schwer fällt, diese Vereinnahmung zu sprengen. Vieles spricht für zweiteres – oder anders gesagt: Eine Aussage darüber, ob Herrschaft überwindbar und ein Leben freier Menschen in freien Vereinbarungen möglich ist, kann nur über den Versuch und die Auswertung desselben erfolgen.

Dabei ist der Versuch ein dauernder Prozess, denn Befreiung im emanzipatorischen Sinne kann nur das ständige Zurückdrängen von Herrschaftsförmigkeit in allen Ebenen von Gesellschaft und allen Facetten von Leben sein mit einem offenen Ausgang, welche Gesellschaft dann entsteht und sich wieder weiterentwickelt und wie sich Menschen von ihren Möglichkeiten selbstbestimmten Lebens verändern.

In politischen Gruppen, die wie alle kleinen und grossen Strukturen als Subräume der Gesellschaft gesehen werden können – also teil-eigenständig, aber ebenso intensiv verwoben mit allen -, können für die ständige Reproduktion von Herrschaft klare Gründe erkannt werden:

• Akzeptanz der formalen Zwänge von aussen (Geld, gesetzlicher Rahmen für Rechtsformen, Räume, Versammlungsrecht, Strafrecht usw.).

• Selbstreproduktion von Normierungen, Dominanzen, Rollenverhalten usw. in den Gruppen und Netzen.

• Durchsetzung eines kollektiv-identitären „Wir“, Aufbau kollektiver Identitäten, d.h. der Organisierung nach sozialen Codes verbunden mit ständigen Ab- und Ausgrenzungen gegenüber dem „Anderen“.

• Effizienzstreben (nicht als solches das Problem) unter den herrschenden Bedingungen, die Erfolg an gesellschaftskonformes Verhalten zu binden scheinen.

• Integration strategisch erfahrener Politaktivisten in herrschaftsförmige Organisationsformen (z.B. „Aufsaugen“ durch die NGOs).

Jedenfalls sollte gelten: Im Fall, dass Herrschaft weder genetisch noch naturgesetzlich erforderlich ist, wäre es ein „Muss“ für eine politische Praxis mit emanzipatorischem Anspruch, das Zurückdrängen von Herrschaft, also von Normierungen, äusseren Zwängen, internen Hierarchien usw. zu versuchen.

Sonst ist alles nur Schein – Emanzipation kann es nur geben, wenn der Ausbruch wenigstens versucht wird und eine politische Bewegung nicht selbst die Herstellung von Herrschaft in den politischen Subräumen bedeutet.

Gleiches gilt für die Menschen, die Emanzipation anstreben, für ihre Lebensbereiche. Familien, (Nicht)Arbeitsplatz, Freizeittreffen … alles kann nur einfach Reproduktion von Herrschaft sein oder zum Kampffeld der wichtigsten gesellschaftlichen „Schlacht“ werden – der um die ständige Wiederherstellung und Erneuerung von Herrschaft oder deren Überwindung.

Konkrete Politik als Förderung von Kooperation

Politische Forderungen und konkrete Projekte müssen kooperatives Verhalten fördern, Handlungsmöglichkeiten erweitern und Fremdbestimmung abbauen. Die beschriebenen Bedingungen einer Gesellschaft, in der Konkurrenz unattraktiv sowie Kooperation vorteilhaft für jeden Menschen wird, müssen als Massstab für die politische Praxis dienen – zumindest dann, wenn sie einen emanzipatorischen Charakter haben soll.

Das behaupten zwar fast alle politischen Gruppen aus den Bewegungen im Umweltschutz, zu sozialen Fragen, feministische oder Queer-Zusammenhänge bis hin zu internationalen Themen, Frieden oder allgemein den Menschenrechten und menschenwürdigen Lebensbedingungen. In ihrer Praxis aber missachten sie, was Kooperation fördert oder blockiert.

Daher seien an dieser Stelle in kurzer Form politische Grundpositionen benannt, die als Rahmen für emanzipatorische Politik und Projekte dienen können. Herrschaft abwickeln! Herrschaft verbessert die Möglichkeit zum konkurrierenden Verhalten.

Daher ist es immer falsch, neue Herrschaft zu fordern, um die Folgen der bisherigen mildern zu können. Für Reformen bedeutet das, dass jeder Vorschlag und jeder Schritt auch dem Abbau von Herrschaft dienen muss.

Neue Gesetze oder Veränderungen von Institutionen müssen die Freiräume der Menschen vergrössern und nicht deren Leben weiter verregeln, Kontrolle unterwerfen und Unterschiede ausgleichen, die auf Herrschaftsverhältnissen beruhen. Und sie sollten Ansatzpunkte für weitere Prozesse aufbauen.

Revolutionäre Forderungen oder Umstürze müssen ebenfalls Herrschaft beenden oder abbauen, müssen Prozesse der immerwährenden Befreiung schaffen statt eines neuen Status Quo, der dann wiederum herrschaftsförmig verteidigt wird.

Verwertung und Profit abschaffen!

Verwertung und Profit basieren bereits auf institutionellen Herrschaftsverhältnissen, fügen dieser dann durch die weitere Elemente der Unterdrückung, Diskriminierung usw. hinzu. Das wichtigste Herrschaftsinstrument, ohne das Verwertung nicht möglich ist, ist das Eigentum – im weitesten Sinne, d.h. zum einen an materiellen Dingen, Boden, Rohstoffen, zum anderen aber auch an Wissen, Wort und Bild, Genen, Lebensgrundlagen, Kommunikationswegen usw. Die Tatsache, dass Verwertung und Profit von Herrschaftsstrukturen abhängen, widerlegen auch das oft benannte Bild eines Gegensatzes von Staat und Markt.

Ohne Herrschaftsstrukturen (also in den allermeisten Fällen der Staat) wäre Verwertung nicht durchsetzbar. Wer Staat und Markt als Gegenpole darstellt, verschleiert das allumfassende „System“ Herrschaft und trägt damit zu ihrer Absicherung bei.

Eigentum aufheben: Freies Wissen und Freie Produkte!

Gemeinschaftseigentum, Allmende, Copyleft usw. sind Begriffe für Versuche der Überwindung von Konkurrenz bereits heute. Sowohl politische Forderungen als auch die konkrete Praxis können so organisiert sein, dass sie immer wieder Projekte, einzelne Zellen und Prozesse schaffen, die der Verwertungslogik entrissen sind – Kommunikation, Häuser und Plätze, Software oder Maschinen …

Demokratisierung von Flächen- und Rohstoffnutzung!

Herrschaft bedeutet nicht nur das Vermögen, Entscheidungen anderer zu beeinflussen, sondern auch, eigene Entscheidungen so zu treffen, dass andere die Folgen ertragen müssen. Auf dieser Grundlage findet die Umweltzerstörung statt – Umweltzerstörung ist also ohne Herrschaft nicht vorstellbar. Das Gegenbild ist ein emanzipatorischer Umweltschutz: Die Menschen werden zu AkteurInnen. Die Strassen, Häuserblöcke und Landschaften müssen den Menschen gehören, die in ihnen leben. Niemand kann über Flächen und Orte bestimmen, ohne selbst betroffen zu sein.

„Demokratisierung von Flächen- und Rohstoffverbrauch“ heisst das Gegenkonzept zu Ordnungsrecht oder dem kapitalistischen Instrument Ökosteuer. Vision ist eine Welt von unten. Die kleinen Schritte dahin bestehen aus konkreten Projekte, die die Menschen zu den EntscheiderInnen machen: Windanlagen, die den Menschen drumherum gehören (statt teurer Grossanlagen ohne örtliche Akzeptanz), Stromnetze im Besitz der BürgerInnen, ökologische Bauernhöfe im Gemeinschaftsbesitz, lokale Ökonomien ohne Apparate und vieles mehr.

Nationen, Geschlechter, Rassen, Behinderungen, Unmündigkeit, Psychiatrisierung und alle anderen Kategorien überwinden!

Nicht nur die Diskriminierung nach diesen Kategorien, sondern ihre Bildung ist bereits Herrschaft. Sie treibt Menschen in eine bestimmte „Ecke“, also Rolle in dieser Gesellschaft – mit den Erwartungshaltungen und den Reaktionen anderer Menschen. Eine konkrete Praxis sowie politische Forderungen müssen Diskriminierungen aufgrund der Kategorien und die Kategorien selbst aufheben.

Standardisierung und Normung aufheben!

„Norm“alität brechen! Gesetzliche, technische und diskursive Normen durchziehen den Alltag, sie regeln und prägen Verhalten und Erwartungen. Wer aus der „Norm“ fällt, verliert Akzeptanz und muss mit repressiven Reaktionen rechnen – des Staates oder des sozialen Umfeld.

Herrschaft demaskieren!

Verbunden mit jeder Herrschaft ist ihre Verschleierung. Herrschaft kann nur überleben, wenn sie ihre eigene Akzeptanz beschafft. Wo sie darauf verzichtet oder die Akzeptanzbeschaffung nicht gelingt, verliert die Herrschaft ihre Basis, d.h. die Beherrschten wünschen sich nicht nur eine Änderungen, sondern fordern sie bzw. setzen sie durch.

Als Akzeptanzbeschaffung für Herrschaft dienen: Biologismen; Scheinzwänge und -gesetzmässigkeiten; Religionen, Ideologien, Esoterik; Belohnung und Abhängigkeit; „There is no alternative“, d.h. die Vermittlung der Alternativlosigkeit; Integration von Kritik und Abweichung: Teile und herrsche.

Diese und andere Formen von Herrschaft zu enttarnen, anzugreifen und, wenn möglich, Alternativen zu benennen, gehört zum Weg der Befreiung. Der quadratmeterweise Aufbau von Freiräumen in Alltag und Politik sowie der Widerstand samt Demaskierung gegenüber Herrschaft fördern sich gegenseitig und sind zusammen die Motivation, solche emanzipatorische Praxis auch als dauerhaften Prozess zu entwickeln.

Praktische Formen von Widerstand

Konkrete politische Forderungen auch im Hier & Jetzt sind wichtig. Sie ersetzen aber nicht die politische Aktion. Auch für diese muss gelten, dass sie nur als herrschaftskritisch gelten kann, wenn sie solche Positionen transportiert. Das tun viele politische Aktivitäten heute nicht – ganz im Gegenteil fordern sie den Zugriff des Staates ein (im Sinne der jeweiligen politischen AkteurInnen) oder träumen gar von mehr Staatlichkeit (neue Behörden, Kontrollgremien, Gerichtshöfe usw.). Andere setzen auf Marktmechanismen, z.B. Effizienzstrategien oder Geldanlage.

Zudem schaffen sie ständig neue Subsysteme, die selbst wieder von Herrschaft durchzogen sind. Viele sich als „linksradikal“ verstehende Projekte vermitteln einen autoritären Charakter von Gesellschaft, kokettieren mit der Ausgrenzung von Menschen (z.B. ihren politischen GegnerInnen) oder treten selbst uniformiert bis militaristisch auf. Im folgenden sollen einige Aspekte einer emanzipatorischen politischen Praxis benannt werden.

„Emanzipatorisch“ als zentrale Kategorie

Politische Positionen und Strukturen werden zur Zeit nach sehr verschiedenen Kategorien bewertet. Klassisch in vielen politischen Gruppen ist die Einteilung nach „links“ und „rechts“.

Was genau links und was rechts ist, lässt sich aber kaum noch klären. Galt früher „links“ wenigstens noch annähernd als internationalistisch, aufklärerisch, fortschrittlich oder sozial(istisch), so agieren heute sehr verschiedene Strömungen mit diesem Begriff, unterstützen z.B. reaktionäre nationale Befreiungsarmeen, die in ihrer Ideologie (nationalistisch, religiös-fundamentalistisch oder anderes) und Struktur (militaristisch-mackerig, feudal usw.) aus emanzipatorischer Sicht schlicht widerlich sind, oder konservative bis biologistische Naturromantiker.

Die Globalisierung aus der kapitalistischen Mitte ist deutlich dynamischer als jede internationale Perspektive der „Linken“, CDU, F.D.P. und end-sozialdemokratisierte SPDlerInnen setzen auf Fortschritt. Mit der oft zu lesenden Analyse, der Kapitalismus oder die Globalisierung käme von „Rechts“ ist spätestens jegliche politische Schärfe verloren. Um ein klareres Bild politischer Positionen zeichnen zu können, sind präzisere Analysen wichtig.

Bei Reduzierung auf ein Begriffspaar bietet sich eher „emanzipatorisch“ und „anti-emanzipatorisch“ an. Danach wäre das Ziel „emanzipatorischer Politik“ die Loslösung aus Zwängen und Zurichtung aller Art, der Abbau von Fremdbestimmung, von institutioneller und diskursiver Herrschaft, die Schaffung von FreiRäumen und die Erweiterung von Reproduktions- und Handlungsmöglichkeiten – gleichberechtigt für alle einschliesslich dem Zugang zu allen Ressourcen.

Bei genauerer Betrachtung aktueller politischer Positionen fällt auf, dass dieses Ziel kaum eine politische Gruppe verfolgt (siehe die Quellenanalyse im Buch „Nachhaltig, modern, staatstreu“, www.projektwerkstatt.de/materialien).

FreiRäume schaffen

Jede politische Gruppe und jede Aktion, jedes Projekt und jeder neu geschaffene soziale Ort kann entweder selbst Herrschaftsverhältnisse reproduzieren oder sich als Kampffeld dagegen begreifen. Letzteres hat zwei Richtungen: Zum einen der Widerstand gegen die Zwänge von aussen, die aktive Organisierung von Unabhängigkeit, die Nicht-Übernahme gesellschaftlich prägender Organisierungs- und eventuell Rechtsformen. Zum anderen die interne offensive nichthierarchische Organisierung.

Dieses bedeutet einen dauernden aktiven Prozess gegen die Selbstwiederherstellung von Herrschaft über die Zurichtungen der beteiligten Personen und vorhandene Unterschiede im Zugang zu Wissen, Ressourcen usw. Beides, die Zwänge und Erwartungshaltungen von aussen sowie die interne Selbstreproduktion von Dominanzen, stärken sich gegenseitig.

FreiRäume schaffen ist der Versuch, Experimentierfelder zu eröffnen und Strategien der Überwindung von Herrschaftsverhältnissen zu entwickeln. FreiRäume sind dabei nicht nur, aber auch örtlich gemeint. Jede Gruppe und sogar jeder zeitlich begrenzte Zusammenhang kann als ein solcher „FreiRaum“ begriffen und gestaltet werden.

Selbstverständlich gilt das auch für bestehende Gruppen, Zusammenhänge und Räume, die in Richtung des Abbaus von Zwängen und Zurichtungen sowie gleichberechtigter Handlungsmöglichkeiten entwickelt werden können.

Visionäre Ansätze sichtbar machen

Das Richtige im Falschen zu schaffen, ist nicht möglich. Das Richtige im Falschen zu versuchen, aber sehr wohl. Das bietet dann viele Handlungsmöglichkeiten, zum einen tatsächliche Erleichterungen im Alltag, zum anderen das Aufzeigen von möglichen Richtungen und die darauf aufbauende Debatte um herrschaftsfreie Utopien. Als ein Beispiel von vielen seien hier Umsonstläden genannt. Es wäre extrem verfehlt, in ihnen bereits selbst ein grosses Stück Vision zu sehen.

Zwar ist richtig, dass ein solcher Laden sowohl die materielle Not von Menschen lindern kann als auch solchen, die selbstorganisierter zu leben versuchen, den Zwang zu Lohnarbeit und ständiger Geldbeschaffung reduziert. Wichtiger aber ist aus politischer Sicht die Chance, rund um einen Umsonstladen die Diskussion um eine verwertungsfreie Gesellschaft zu führen. Auch Linux und freie Software ist so ein Beispiel – es ist teilweise gut gelungen, an das konkrete Projekt eine Debatte über Visionen anzuhängen (siehe z.B. www.oekonux.de).

Völlig verfehlt ist jedoch die Annahme, Linux sei bereits selbst Praxis visionärer Gesellschaft.

Wie peinlich war es, als sich Linux-Fans darüber freuten, dass die Software jetzt auch im Bundestag Verwendung findet (vielleicht demnächst Cruise Missiles mit Linux-Programmierung?) oder die SPD im bayrischen Landtagswahlkampf mit „Mehr Linux. Mehr Freiheit“ auf Plakaten warb. Nur die kreative Verbindung von visionär ausgerichteten Projekten im Hier & Jetzt und einer intensiven Vermittlung darüber hinaus gehender Ideen gibt Chancen.

Reibung erzeugt Wärme

Der Angriff auf das Herrschaftsförmige schafft nicht allein die Herrschaftsfreiheit. Diese Erkenntnis ist banal – und doch kein Grund, das Widerständige sein zu lassen. Ganz im Gegenteil bietet die kluge direkte Aktion die Chance zur darüber hinaus gehenden Vermittlung, ganz ähnlich dem visionären Baustein im Hier & Jetzt.

Wer in den Konsumtempeln der Republik Entwertungsaktionen macht (Barcode mit anderen Botschaften überkleben, Preisschild auf Null setzen, Zettel in Bücher und Zeitschriften einlegen …), wer per Aufkleber geschlechterrollen-trainierendes Spielzeug verändert oder per Improvisationstheater den Wahlkampf demaskiert, kann dadurch Ansätze für intensive Kommunikation schaffen.

Das genau ist auch das Ziel der direkten Aktion – und nicht die Selbstbestätigung mittels Durchführung der immer selben Aktionsformen, wie es in der „Linken“ zur Zeit üblich ist. Wer Normalität brechen will, muss das vom Inhalt und der Aktionsform auch tun. Dazu kann auch Militanz gehören, aber für sie gelten die gleichen Überlegungen. Sie müssen emanzipatorische Ziele vermitteln, Kommunikation erzeugen und führen (zu kreativen Widerstandsformen siehe im Internet: www.direct-action.de.vu).

Sich selbst als Teil einer visionären Gesellschaft begreifen

Ob nun „linke“ oder „emanzipatorische“ Politik – sie ist immer Teil der Gesellschaft. Es gibt kein „Draussen“. Wer Fremdbestimmung abbauen und Selbstbestimmung stärken will, kann das auch dort tun, wo es am schnellsten möglich sein könnte: Im eigenen Lebensumfeld. Politische Gruppen sind ein Teil davon – neben Arbeit, Ausbildung, FreundInnenkreis, Familie, Hobbygruppen usw.

Sie alle sind zur Zeit Orte der Selbstreproduktion von Herrschaft, der formalen und informellen Dominanzen, der Bildung kollektiver Identitäten oft mit Aus- und Abgrenzung.

Sie könnten aber auch Experimentierfelder für andere Formen der Kooperation, der Entscheidungsfindung von unten usw. sein – wie der Demaskierung der vorhandenen Herrschaftsverhältnisse in der Gruppe, des Experimentierens mit Methoden, der Reflexion und Weiterentwicklung, der aktiven Herstellung gleichberechtigten Zugangs zu allen Ressourcen und des Verzichts auf zentrale Entscheidungsfindung, egal ob „von oben“ (Vorstand u.ä.) oder „von unten“ (Basisdemokratie).

Gerade politische Gruppen und Projekte sind für solche Auseinandersetzungen und Versuche geeignet, da sich hier die konkrete Handlung mit der Diskussion um politische Ziele und Strategien mischt und sich interne und externe Praxis einander motivieren und vorantreiben

—————————————————————-

Grafikquellen       :

Oben         —          Moscow-City, August 2009

Urheber Dmitry A. Mottl       /        Quelle     —    Eigenes Werk

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

———————————-

2.) von Oben        —    Skyline inof Frankfurt am Main.

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.
Namensnennung: Carlos Delgado

—————————

3.)  von Oben          —        Skyline ofAthens, seen from the Akropolis

Urheber Orlovic      /        Quelle       —    Eigenes Werl
Namensnennung Weitergabe unter gleichen Bedingungen This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International, 3.0 Unported, 2.5 Generic, 2.0 Generic and 1.0 Generic license.

————————

Unten         —      Aerial of the U.S. Capitol under restoration, Washington, D.C.

Abgelegt unter International, Kultur, Mensch, Umwelt | Keine Kommentare »

Stadtgespräch aus Venedig

Erstellt von DL-Redaktion am 15. November 2019

Venedig unter Wasser – Schöne Katastrophe

Chilone-San Marco Flooded.jpg

Kommt alle her, welche vom Mühsal überlastet sind, hier könnt ihr mir folgen und lernen über das Wasser zu gehen.

Von Petra Reski

Die Hochwasser in Venedig sind längst zur medialen Kulisse geworden. Die Stadt leidet derweil an ihrer touristischen Übernutzung.

Schon komisch, wenn man von der größten Hochwasserkatas­trophe in Venedig seit 53 Jahren nichts anderes sieht als das schöne Spiegelbild der Goldmosaiken des Markusdoms und tapfere Touristen in Wegwerfstiefeln, die den Gezeiten die Stirn bieten. Keine Spur von der zerstörten Uferbefestigung an der Riva dei Sette Martiri, wo ein 40 Tonnen schweres Vaporetto auf das Ufer gespült wurde, nichts von den Marmorsäulen, die kreuz und quer herumliegen, als hätte ein Riese kegeln gespielt. Nichts vom Zeitungskiosk, den das Hochwasser in den Giudecca-Kanal geschwemmt hat. Nichts von den venezianischen Kindern, die nicht zur Schule gehen können, nichts vom venezianischen Alltag.

Acqua alta a Venezia nel settembre 2009.jpg

Nichts davon, dass die Menschen in den wenigen verbliebenen Werkstätten (und ja, es gibt in Venedig noch Handwerker und Unternehmer, die Arbeitsplätze geschaffen haben, die nichts mit dem Tourismus zu tun haben!) zu retten versuchen, was noch zu retten ist, Arbeitsmaterial, Lagerbestände. Nichts davon, dass in den Restaurants die Kühlzellen überflutet und Tonnen von Lebensmitteln vernichtet wurden. Alles muss mühevoll mit Süßwasser abgewaschen werden. Auf Knien rutschend versuchen die Venezianer ihre Existenz zu retten.

Dass nur der schöne Schein zählt, wissen die Venezianer seit jener Zeit, als ihre Stadt von einer geschäftstüchtigen Unternehmerclique im Faschismus zur Museumsstadt erklärt wurde. Mit dem Hafen von Marghera wurde der Großraum Venedig geschaffen: das Festland als Schlafstadt für die Arbeiter des Hafens, der Schiffswerften und der Petrochemie­anlage von Marghera. Heute leben in Venedig noch 52.000 Venezianer – der Großraum hingegen zählt knapp 260.000 Einwohner. Auch Luigi Brugnaro, Unternehmer und Bürgermeister Venedigs, wohnt auf dem Festland, wo die überwältigende Mehrheit der Stadträte lebt, die Hochwasser offenbar nur aus dem Fernsehen kennen.

In seiner Rede gegen die Venezianer, jene „glücklich in ihrem Wasser faulenden Dummköpfe“, beschied der Futurist Marinetti, dass es besser sei, Venedig zu zerstören, als zuzusehen, wie es zu einer mumifizierten Museumsstadt zum ausschließlich touristischen Gebrauch verkomme. Sein aus Florenz stammender Schriftstellerkollege Giovanni Papini schrieb: „Wir sind Hausmeister in Leichenhallen und Dienstboten exotischer Vagabunden.“

Quelle       :           TAZ       >>>>>        weiterlesen

—————————————————————-

Grafikquellen         :

Oben        —         Chilone-San Marco Flooded

——————————

2.) von Oben      —     Flood in Venice in september 2009: On the way to Saint Mark’s Square

————————-

Unten       —         1913

Abgelegt unter Europa, Feuilleton, Kultur, Umwelt | Keine Kommentare »

Newmans : Postanarchism

Erstellt von DL-Redaktion am 14. November 2019

Praktiken des Austretens und gemeinsamer autonomer Lebensgestaltung statt anarchistischer Gesellschaftsentwürfe und Programme

File:Amsterdam Grafitti Freedom Lives When the State Dies.png

Quelle         :     untergrund-blättle CH.

Von  Jonathan Eibisch

Der seit 2006 an einer Londoner Uni angestellte Professor der Politischen Theorie dürfte manchen Leser*innen ein Begriff sein.

Immerhin prägte Newman stark den Begriff des „Postanarchismus“ mit seiner Arbeit From Bakunin to Lacan. Anti-Authoritarianism and the Dislocation of Power (2001), über Max Stirner (2011), wie auch mit der äusserst inspirierenden anarchistischen politischen Theorie in The Politics of Postanarchism (2010). In Letzterem stellt er die interessante These auf, dass sich der klassische Anarchismus mit seiner Betonung von Ethik und Utopie bewusst nicht politisch organisiert und orientiert hätte, während der Postanarchismus darauf abziele, in das unauflösliche Spannungsfeld zwischen dieser Anti-Politik und dennoch notwendiger Politik hineinzugehen um neue Politiken der Autonomie zu entwickeln.

Newman hatte 2010 geschrieben, Postanarchismus sei keine spezifische Form oder Strömung des Anarchismus mit neuen Programmen oder Richtlinien. Noch nicht einmal sei er eine bestimmte politische Theorie, sondern ein Projekt um die anarchistische Politik zu erneuern und zu radikalisieren. Dies sollte vor allem durch die Dekonstruktion verschiedener problematischer Annahmen im klassischen (= modernen) Anarchismus geschehen.[1] Beispielsweise sei „Gesellschaft“ keine natürliche oder gar organische Form des Zusammenlebens, welche dem künstlichen Staat entgegen gesetzt werden könne. Zu problematisieren sind so auch weitere Annahmen der Aufklärung wie das teleologische Geschichtsbild, die (bürgerliche) Vorstellung des „autonomen“ Subjektes oder auch die Universalität von Moral und Vernunft.

Schliesslich kommt er zu dem Ergebnis: „Weil Anarchismus in einem unerwarteten neuen Licht erscheint, nämlich als Horizont von heutiger Politik, müssen wir seine klassischen Grundlagen auf Weisen überdenken, die zugleich seinem wesentlichen Ethos von Freiheit, Gleichheit, Anti-Autoritarismus und Solidarität treu bleiben. Mein Argument war, dass Anarchismus sich selbst etwas Neues zu lehren hat. Anarchismus ist beseelt durch einen lebendigen, atmenden ‚Geist‘ der Anarchie, welcher seine eigenen statischen Formen und fixierten Identitäten stört. Postanarchismus enthüllt diese freudvollen Moment von Anarchie innerhalb des Anarchismus und nutzt sie darüber hinaus, um das Politische und das Ethische in neuen Wegen zwischen den Zwillingspolen Politik und Anti-Politik zu denken“.[2]

Im aktuellen Buch mit dem schlichten Titel Postanarchism[3] widmet sich Newman nun vor allem dem „Geist der Anarchie“, welcher jegliche Festschreibungen aufbricht oder sich ihnen entzieht. Es wird betont, dass Postanarchismus eben keine politischen Programme oder bestimmte anarchistische Organisationsformen entwickelt, sondern sich vor allem damit beschäftigen würde, wo Anarchie im Hier&Jetzt vorkomme. Diese sei nicht als Ergebnis anarchistischer Kämpfe, sondern gewissermassen als Ausgangspunkt für jene zu verstehen: Weil es einen Willen zur freiwilligen Knechtschaft gibt, muss es potenziell auch immer Möglichkeiten von „Freiheit“, zur „Eigenheit“ oder „Autonomie“ geben.

Wenn mit dem Postanarchismus keine anarchistische Gesellschaft theoretisiert wird, sondern vielmehr jene Praktiken der Freiheit untersucht werden, die innerhalb des Bestehenden schon wesentliche Unterschiede machen (würden), wendet sich Newman von den bedeutenden politischen Implikationen, die The Politics of Postanarchism beinhaltete, offenbar teilweise wieder ab. Freiheit und Autonomie auch zu einer Frage des Willens zu erklären und dabei von Einzelnen auszugehen, ist eine durchaus anarchistische Sichtweise. Diese sollte jedoch nie eingenommen werden, ohne zugleich die materiellen und sozialen Bedingungen in den Blick zu nehmen, auf welchen individuelle Sehnsüchte nach Autorität, die eigene psychische Verhaftung in Herrschaft und damit ebenfalls die Chancen auf Distanzierung von Herrschaftsverhältnissen sowie eine selbstbestimmte Lebensgestaltung beruhen. Offenbar vollzieht Newman hier wieder eine Wende zurück zu seiner individualanarchistischen Herkunft.

Am Beginn des Buches steht die „postmoderne“ Annahme vom Ende der Meta-Narrative[4], also auch der Vorstellung einer „staatenlosen Gesellschaft“. Statt sich Anarchismus als sozialrevolutionärer Bewegung zu widmen, geht Newman dem Konzept einer ontologischen Anarchie nach. Dies umfasst, dass Vorstellungen und Handlungen keine „eigentlichen“, ihnen „wesentlichen“ Gründe und festgelegten Ziele haben.

Handlungen werden anarchisch, wenn sie sich nicht in vorgefertigte Raster einfügen, was zu Erfahrungen der Freiheit und ethischen Reflexionen führen kann, wenn wir gewissermassen nie aufhören Fragen stellen, anstatt immer schon die Antworten zu wissen. Dies ist zunächst nachvollziehbar. Dennoch wird die Frage aufgeworfen, warum das Fragen-Stellen dem experimentellen Entwerfen von Alternativen im Wege stehen soll. Betreibt Newman mit diesem Gedankengang nicht im Grunde genommen eine Privatisierung von Anarchismus als persönliche Denkweise und Haltung, also seine Verkürzung als philosophische Lebenseinstellung?

Zentral am Anarchismus ist für ihn „die Idee autonomen Denkens und Handelns, welches die gegenwärtigen sozialen Räume in diesem Sinne verändert, welches aber zugleich kontingent und unbestimmt ist, indem es keinen vorbestimmten Logiken und Zielen untergeordnet wird. Das heisst nicht, dass Anarchismus keine ethischen Prinzipien haben oder von bestimmten Idealen angeregt sein sollte – stattdessen sollte er nicht und kann er sich vielleicht nicht länger als bestimmtes revolutionäres Programm oder politische Organisation verstehen. Das bedeutet selbstverständlich nicht, dass alle Projekte aufgegeben werden sollten, sondern vielmehr, dass es kein ‚Projekt von Projekten‘ gibt, dass die anderen zusammenfasst“[5]. Newman geht darum mit Michel Foucault von einer ‚Non-Power‘, einer Nichtakzeptanz der Macht aus, wobei ich mir nicht sicher bin, inwiefern er damit die eigene politische Ohnmacht verklärt.

Im zweiten Kapitel wird mit Singularitäten ein (poststrukturalistisches) Verständnis von Einzelnen entfaltet, welches der neoliberalen Regierung des Lebens widerstehen können soll. Das Leben in seiner „nackten“ Form sei unregierbar und entzöge sich der Kontrolle, schreibt Newman in Anlehnung an Giorgio Agamben. Er möchte Individuen weder als Klassensubjekte, partikulare Identitäten (bürgerlicher Subjekte) oder einem (souveränen) Volk zugeordnet denken. In Hinblick auf den Gebrach sozialer Medien ist Newman dabei ziemlich kritisch, inwiefern sie echte Potenziale für die Erzeugung anderer Menschen bieten. (Dazu passt, dass er an anderer Stelle bemerkt, um den Kapitalismus zu überwinden, müssten wir uns auch von unseren kapitalistischen Wünschen lossagen und ein einfacheres Leben wählen.)

Die Klassendimension sei zwar weiterhin vorhanden, doch von einem Klassenbewusstsein zu sprechen, gehe an der Realität vorbei, in der Subjekte disparat [= widersprüchlich], fragmentiert und heterogen seien. Gleichzeitig wendet sich Newman gegen „Identitätspolitik“: „Im besten Fall wird Identitätspolitik eine gutartige Form von Liberalismus, besessen von der Repräsentation immer weiterer partikularer und marginaler Identitäten – wie in LGBTQ. Im schlimmsten Fall führt das Bestehen auf eine authentische Identität, das heisst, auf eine konstant zum Opfer gemachten Identität, zu einer Politik vergleichbar einer Form des Fundamentalismus.

In jedem Fall erreichte diese Art von Politik von Repräsentation und Anerkennung einen Punkt der Erschöpfung“[6]. Dagegen könnten radikale Kämpfe jedoch ebenfalls nicht mit Mitteln populistischer Politik geführt werden, weil mit dieser immer nach Führenden verlangt wird und sie zumindest in der Gefahr stehen, rassistisch und nationalistisch zu werden. Das Konzept von sozialen Singularitäten beschreibt dagegen Menschen, die sich – in Auseinandersetzung mit anderen – selbst begründen und gestalten und dabei Gemeinschaften gründen, in denen verschiedene koexistieren können.[7] Dieses Konzept des Philosophen Jean-Luc Nancy verbindet Newman nun mit jenem des „Einzigen“ von Max Stirner. Individualistisch von Einzelnen auszugehen soll allerdings nicht dazu führen, dass diese auf Andere keine Rücksicht nehmen oder sie mitdenken, sondern freiwillige Assoziationen nach Affekten und Anziehung statt erzwungener Gemeinschaften ermöglichen.

Darauf aufbauend entwickelt Newman ein Konzept von Aufstand („insurrection“), welcher wie die Soziale Revolution darauf abzielt, soziale Beziehungen zu transformieren, dabei aber im Unterschied zu dieser entscheidend von der Selbst-Befreiung motiviert wird und somit auf Selbstermächtigung beruht. Ziel ist nicht die Errichtung einer neuen sozialen Ordnung, sondern die Entwicklung von Autonomie, welche sozusagen erst im Moment des Aufstands entsteht bzw. sich weiterentwickelt. Der Aufstand unterscheidet sich von den meisten politischen Handlungen und ist „eine mikro-politische Transformation des Selbst in seiner Beziehung zur Macht durch die wir befähigt werden, uns selbst aus dem System der Macht und unserer Abhängigkeit von ihr, sogar unserer Sehnsucht nach ihr, herauswinden“.[8]

Mit der Veränderung des Selbst liegt sein Fokus auf der Veränderung der „unmittelbaren Beziehungen zu Anderen und auf der Entwicklung von autonomen Lebensweisen, die versuchen die Falle der Macht zu vermeiden. Der Aufstand ist der relationale Raum der Freiheit, der geöffnet wird wenn wir unser Leben ausserhalb jenen institutionellen Rahmens und vorgeschriebener Ziele zurückfordern und bestärken“[9]. Was die Einzelnen dabei aus der gewonnenen Freiheit machen, ist ihnen selbst zu überlassen. Das bedeutet umgekehrt nicht, dass im Anarchismus keine ethischen Massstäbe entstehen können. Dafür zentral ist die präfigurative Politik, das heisst, dass gegenwärtige Aufstände konkrete neue Arten von Solidarität und in-Gemeinschaft-sein hervorbringen sollen.

Die (philosophische) Besprechung von Aufständigkeit führt Newman unweigerlich zur Frage der Gewalt. Hierbei bezieht er sich einerseits auf den Mythos des Generalstreiks des umstrittenen George Sorel sowie Walter Benjamins „Kritik der Gewalt“. Dazu stellt er dar, warum in anarchistischem Denken von einem „sozialen Krieg“ ausgegangen wird, den die herrschenden Klassen gegen die Unterworfenen führen – auch wenn es darin Phasen einer Befriedung gibt, die allerdings entscheidend durch Gewalt durchgesetzt und aufrechterhalten wird. Gezeigt wird, dass Sorels militaristisch anmutende Beschreibungen von Gewalt vor allem auf Ermächtigung abzielen und in diesem Sinne viel weniger gewaltsam sind, als das bestehende System einerseits, aber auch politische Revolutionen andererseits.

So ist die „Idee von Autonomie für den proletarischen Generalstreik zentral: Sie hat nichts damit zu tun, mit dem System über bessere Bedingungen zu verhandeln, vielmehr stellt sie eine vollständige Loslösung der Arbeiter*innen vom Staat und Kapitalismus durch die Kultivierung alternativer sozialer Praktiken, Subjektivitäten und ethischen Beziehungen, dar“[10]. Benjamin denkt wiederum vor, wie nach ethischen Richtlinien statt nach Gesetzen gehandelt werden kann, die selbst durch Gewalt eingesetzt und aufrechterhalten werden. Postanarchismus mit Nicht-Gewalt gleichzusetzen wäre zu einfach. Die offensive Thematisierung von Gewalt führe jedoch zu ihrer Transformation und Möglichkeiten zur gemeinsamen Setzung ethischer Richtlinien statt moralischer Befehle und Gesetze.

Wie aber können Menschen mit ihrer freiwilligen Knechtschaft brechen? Zunächst, indem sie sich von der Herrschaft distanzieren und vor allem selbst mit ihrer Sehnsucht nach Beherrschung/Herrschen auseinandersetzen, die sich in vielen Formen von Identifikation, Passivität, konformen Verhaltensweisen, Verhaltens- und Kommunikationsmustern widerspiegelt. Als erste Person scheint Étienne de La Boétie das Phänomen der freiwilligen Knechtschaft behandelt zu haben (1548). Die Frage, warum Menschen gehorchen und sich selbst unterwerfen ist dabei so einfach, wie tatsächlich bis heute ungeklärt.

Fest steht, dass sie nicht allein passiv, vor allem aus Angst vor Bestrafung, oder aufgrund eines „falschen Bewusstseins“ geschieht, sondern Menschen ihre Beherrschung immer wieder aktiv wählen oder gar einfordern. Newman arbeitet heraus, dass La Boétie drei Faktoren dazu ausmacht. Erstens, die Gewöhnung an die Knechtschaft und das „Vergessen“ der Freiheit. Zweitens, die Verführungen und Verwirrungen mit denen Herrschaft arbeitet, um uns mit Spektakel und Ritualen irrezuführen. Drittens konstruiert Macht selber hierarchische Beziehungen und Netzwerke der Abhängigkeit von ihr, sodass unsere Unterordnung und unser Gehorsam durch jene abgesichert werden, welche in der Hierarchie unmittelbar über uns stehen.[11]

Der Knackpunkt bei La Boétie ist, dass er davon ausgeht, dass alle Macht von den Menschen selbst kommt, welche sie dem Tyrann (oder anderen, auch symbolischen Herrschern) übertragen. Wenn Herrscher aber aus sich selbst heraus keine wirkliche Macht haben, bedeutet dies, dass sie ihnen prinzipiell verweigert werden kann. Selbstermächtigung führt dabei automatisch zur Schwächung der Herrschaft, wenn sich mit ihr nicht einfach in Opposition gestellt, sondern aus dem Machtspiel tatsächlich ausgetreten wird. Im Unterschied zu den meisten (konservativen) Vorstellungen, dass es Herrschaft bräuchte, die eine Ordnung der Freiheit ermögliche, kann von La Boétie daher abgeleitet werden, dass „Freiheit“ umgekehrt durch keine Herrschaftsordnung erreicht werden kann. Praktiken und Beziehungen der Freiheit sind dabei aber nicht einfach gegeben, sondern fortwährend zu üben und weiterzuentwickeln.

Auf Grundlage der vorherigen Überlegungen zu Anarchie als vorhandenen Praktiken und Beziehungen, zu Singularitäten, Aufstand und freiwilligen Ungehorsam thematisiert Newman schliesslich wie es möglich ist, ausserhalb des Bestehenden zu denken. Erneut begreift er dabei Postanarchismus nicht als bestimmtes revolutionäres Projekt, sondern als bestimmte Empfindsamkeit, Haltung oder Lebensweise aufgrund vorhandener Freiheiten. Unter Autonomie wird allgemein Selbstregierung verstanden. Diese will Newman allerdings deutlich von liberalen Vorstellung von ihr unterschieden wissen, da beispielsweise Immanuel Kant Gehorsam als Ausdruck vernünftigen Willens begreift und den Staat als Ergebnis einer universellen Moral und Vernunft ansieht.

Vor allem beruht sie auf der Idee von einander abgeschnittener, konkurrierender „bürgerlicher“ Individuen. Doch das Selbst „hat kein Wesen, sondern ist eine Abfolge von Werden, ein weiterführendes Projekt der Selbstgestaltung ohne klares Ende oder Ziel („telos“). Aus dieser Perspektive sollte Autonomie nicht als Status gesehen werden, den jemand erreicht, sondern vielmehr als Reihe agonistischer [= „kämpferischer“] Praktiken, hervorgebracht im Kontext von Zwängen und Begrenzungen, sowohl äusseren, als auch inneren“[12]. Ungehorsam bedeutet demnach heute nicht nur bestimmte Gesetze zu übertreten sondern verlangt andere Lebensformen und Selbstwahrnehmungen.

File:ILÜ der Bundeswehr am 24.09.2012 -- Panzergr.jpg

Wichtig ist Newman zudem Autonomie und Demokratie voneinander zu unterscheiden. Wenn sich Menschen egalitär und beispielsweise basisdemokratisch organisieren, sei dies nicht Voraussetzung für autonome Lebensformen, sondern umgekehrt Ausdruck dieser. Demokratie sei somit eine notwendige aber nicht ausreichende Bedingung für Autonomie und nicht nur aufgrund von Mehrheitsprinzipien zu kritisieren, sondern auch wegen Zwängen zur Unterordnung unter entfremdete, als allgemein behauptete, Wertvorstellungen und Ideen. „Demokratische Souveränität und Autonomie sind daher zwei sehr unterschiedliche Prinzipien: das erste ist kollektivistisch und absorbiert das Individuum in einen gespenstigen Volkskörper, der dazu tendiert eine Figur staatlicher Souveränität zu sein; das zweite ist singulär und verkörpert die Möglichkeit ethischer und politischer Differenz die sich bisweilen gegen den Willen von Leuten richten mag“.[13]

Autonomie im hier verstandenen Sinne ist also eine ethische Anfechtung von Herrschaftsverhältnissen und wird durch (widersprüchliche) Versuche der Selbstorganisation verwirklicht. Deswegen besteht für radikale Politik „heute die zentrale Herausforderung nicht darin, bessere Prozeduren und Kanäle für demokratische Beratung zu entwickeln; aus Demokratie sollte kein Fetisch gemacht werden. Stattdessen muss das Gemeinsame mit und durch die Einzelnen gedacht werden, müssen Formen der Assoziation und Gemeinschaft gedacht werden, die singuläre Projekte der Einzigkeit und ethischen Selbst-Transformation nicht verdecken, sondern diese im Gegenteil intensivieren durch ihre Unterschiedlichkeit. […] Statt Versuchen ein Volk zu konstruieren und die Staatsmacht zu übernehmen – ein Projekt dass nur durch Vertreter*innen erreicht werden kann, die darin enden ‚das Volk‘ von seiner eigenen Macht zu entfremden – bekräftigt radikale Politik heute eine souveräne Indifferenz [= Gleichgültigkeit] gegenüber Macht“.[14]

Nach der Lektüre von Postanarchism bleibt der Eindruck, ein kompliziertes, aber spannendes Buch gelesen zu haben. Die Bekräftigung unserer Möglichkeiten anders zu handeln und anders zu werden, sind enorm wichtig unter Bedingungen, in denen Menschen permanent Ohnmacht erfahren, sich hilflos fühlen und autoritäre Sehnsüchte nach Beherrschung und Herrschaft sich nicht einfach durch einen antiautoritären Stil aus der Welt schaffen lassen. Dennoch scheint es mir wie eingangs geschrieben sehr wichtig, die sozialen Bedingungen unter denen Praktiken der Freiheit geübt werden können zu benennen. Dies tat Newman allerdings auch 15 Jahre zuvor nicht, wo er schon die meisten der hier behandelten Fragen anfängt zu diskutieren.[15] Hier bleibt eine Leerstelle auch wenn die Überlegungen insgesamt sehr inspirierend sind. Nach dieser gründlichen Selbstkritik sollten Menschen meiner Ansicht jedoch anschliessend wieder anarchistische Programme entwickeln und vorschlagen.

———————————————

Saul Newman: Postanarchism. Polity 2015. 180 Seiten, ca. 22.00 SFr. ISBN: 978-0745688749 Fussnoten:

[1] Newman, Saul, The Politics of Postanarchism, Edinburgh 2010, S. 4f.

[2] Newman, Saul, The Politics of Postanarchism, Edinburgh 2010, S. 182. / Alle Zitate aus eigener Übersetzung.

[3] Newman, Saul, Postanarchism, Cambridge 2016.

[4] Meta-Narrativ bedeutet „grosse Erzählung“, also beispielsweise die Vorstellung, dass sich die ganze Gesellschaft (zwangsläufig oder durch Kämpfe) zum Sozialismus hin entwickeln wird. Auch die kapitalistische Gesellschaft beruht auf so einer Erzählung, die allerdings lange behauptet hat, „ideologiefrei“ (und alternativenlos) zu sein. Seit der globalen Finanz- und Wirtschaftskrise ab 2011 wird Kapitalismus zunehmend wieder als Ideologie verstanden. Allerdings scheint die (umfassende und „realistische“) Alternative zu ihm zu fehlen. Auch wenn Anarchie vor allem eine praktische Angelegenheit ist, ist es wichtig, dass aus dem Anarchismus heraus neue Erzählungen entwickelt werden, wie und wohin die heutige Gesellschaft grundlegend geändert werden kann.

[5] Ebd., S. 13.

[6] Ebd., S. 31.

[7] Siehe zu dieser Thematik auch: Kuhn, Gabriel, Jenseits von Staat und Individuum. Individualität und autonome Politik, Münster 2007.

[8] Ebd., S. 54.

[9] Ebd., S. 56.

[10] Ebd., S. 79.

[11] Ebd., S. 101f.

[12] Ebd., S. 124.

[13] Ebd., S. 101f.

[14] Ebd., S. 136f..

[15] Saul Newman, From Bakunin to Lacan. Anti-Authoritarism and the dislocation of power, Plymouth 2007 [2001].

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————–

Grafikquellen         :

Oben          —       Graffiti on the train line leading to Centraal Station in Amsterdam. Photo by Gary Mark Smith. ( Freiheit lebt, wenn der Staat stirbt.)

Author

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————

2.) von Oben        —           Systemkritische Protestfahne „BananenRepublik Deutschland“

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on by the administrator or reviewer File Upload

Abgelegt unter Mensch, Positionen, Regierung, Umwelt | Keine Kommentare »

Internaltionale Textilien :

Erstellt von DL-Redaktion am 12. November 2019

Textilindustrie: Ausbeutung bleibt in Mode

Quelle      :         INFOsperber CH.

Von Red

Nur zwei von 45 Modeunternehmen zahlen den Textilarbeitern Löhne, die zum Leben reichen. Das zeigt eine aktuelle Firmen-Befragung.

Unmenschliche Arbeitsbedingungen und Hungerlöhne, die kaum zum Leben reichen: Seit Jahren stehen Modekonzerne deswegen in der Kritik. Und seit Jahren bemüht die Branche dieselben Ausreden, gelobt Besserung und verweist auf freiwillige Massnahmen einzelner Unternehmen oder Brancheninitiativen, die für faire Löhne in den Zulieferfabriken sorgen sollen. Nur: In der Praxis sind diese Absichtserklärungen nichts wert. Ausbeutung bleibt in der Textilindustrie der Normalfall. Zu diesem Schluss kommen Public Eye und die Clean Clothes Campaign (CCC) in ihrem neuen Firmencheck 2019: «Existenzlöhne in der globalen Modebranche».

Die Organisation hat 45 internationale Modeunternehmen unter die Lupe genommen. Das Resultat ist ernüchternd: Kein einziges Unternehmen stellt sicher, dass alle Arbeiter in der Lieferkette einen Lohn erhalten, der zum Leben reicht. Nur zwei der befragten Unternehmen (Nile und Gucci) zahlen wenigstens einem Teil der Beschäftigten in der Produktion einen existenzsichernden Lohn (siehe Kasten).

Anteil der Arbeiterinnen in der Lieferkette*, die einen existenzsichernden Lohn erhalten:0 Prozent: Adidas, Albiro, Aldi, Amazon, C&A, Calida Group, Chicorée, Coop, Decathlon, Esprit, Fruit of the Loom, Gap, G-Star RAW, H&M, Holy Fashion Group, Hugo Boss, Inditex, Intersport, KiK, Levi’s, Lidl, Mammut, Manor, Maus Frères, Migros, Nike, Odlo, Otto Group, Peek & Cloppenburg, PKZ, Primark, Puma, PVH, Remei AG, Sherpa Outdoor, Tally Weijl, Tchibo, Triumph, Under Armour, Uniqlo, Workfashion, Zalando, Zebra Fashion AG

Mindestens 25 Prozent: Gucci (für einige italienische Produktionen)

Mindestens 50 Prozent: Nile

* Mindestens auf Ebene der Konfektionierung

Laut Definition der Clean Clothes Campaign muss der Existenzlohn die Grundbedürfnisse einer Familie mit zwei Kindern abdecken. Und es sollte noch etwas Geld übrigbleiben für unvorhergesehene Ausgaben. Doch die meisten Beschäftigten in der globalen Modeindustrie erhalten gerade mal den lokal geltenden Mindestlohn. Der ist jedoch in den meisten Produktionsländern so niedrig, dass er kaum zum Leben reicht.

Freiwilligkeit reicht nicht

Neun Unternehmen, darunter C&A, H&M, Inditex, Mammut, Nile und Tchibo haben sich – zumindest auf dem Papier – verpflichtet, Existenzlöhne zu zahlen. Allerdings konnte «keine Firma eine messbare, transparente und glaubwürdige Strategie mit einem Aktionsplan vorweisen, um einen existenzsichernden Lohn zu erreichen», stellt der Bericht fest.

File:Tovarna Banglades.jpg

Einige Unternehmen (C&A, Esprit, H&M, Inditex, Tchibo, Primark, PVH, Zalando) beteiligen sich am freiwilligen Programm ACT, das die Löhne in der Textilindustrie durch nationale Branchen-Tarifverträge erhöhen will. Allerdings blieben die Verhandlungen zwischen Gewerkschaften und Lieferanten bisher ergebnislos.

Coop, Migros, Manor, Calida Group, PKZ, Aldi, Lidl, Chicorée, Tally Weijl und zahlreiche andere Modeanbieter haben sich der freiwilligen Unternehmensinitiative amfori BSCI angeschlossen. Bei amfori BSCI wird der Existenzlohn als «erstrebenswertes Ziel» angesehen und nicht als unmittelbar umzusetzende Verpflichtung.

Die ernüchternde Schlussfolgerung des Firmenchecks 2019: Trotz vieler freiwilliger Einzel- und Brancheninitiativen hat sich in den letzten Jahren die Lohnsituation in den Kleiderfabriken der Billigproduktionsländer kaum verbessert. Dabei seien die Firmen oft eher Teil des Problems als der Lösung, stellen die Verfasser fest – «indem sie im Standortwettbewerb Fabriken und Produktionsländer gegeneinander ausspielen, sich nicht klar und öffentlich für höhere Löhne einsetzen und keine Garantien für faire Einkaufspreise abgeben». «Die Modekonzerne müssen endlich verbindliche Massnahmen hin zu Existenzlöhnen ergreifen», fordern Public Eye und Clean Clothes Campaign. «Ein Aktionsplan mit konkreten Zielsetzungen, rechtsverbindlichen Vereinbarungen und einem ambitionierten Zeitplan ist absolut überfällig.»

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

—————————————————————-

Grafikquellen      :

Oben       —       Das eingestürzte Gebäude

—————————

Unten        —          Textilní továrna v bangladéšské Dháce

Author NaZemi

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Arbeitspolitik, International, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Elektroautos : Aus Aachen

Erstellt von DL-Redaktion am 12. November 2019

Versucht die fossile Autoindustrie dies zu verhindern?

File:StreetScooter C16.jpg

Quelle       :     Scharf  —  Links

Von Walter Schumacher

Vor über 100 Jahren wurden in Aachen schon mal Autos hergestellt [1].
Seit 2014 gibt es erneut eine Autoproduktion: mit dem „Streetscooter“ und dem e.Go“ werden zwei besonders sinnvolle Elektro-Auto-Typen [2] entwickelt, serienreif gemacht und hergestellt, die wirklich beispielhaft sind für „vernünftige“ E-Autos! [3]

Während einerseits alle politischen und wirtschaftlichen Indikatoren in Richtung eines großen Erfolgs für das Produkt stehen, kommen aber weder die Produktion noch die Auslieferung dieser Fahrzeuge richtig in Gang!

Manipuliert die „fossile“ Autoindustrie die Herstellung vernünftiger Elektro-Autos?

Als kraz beobachten wir diesen erstaunlichen Widerspruch schon seit langem und stellen uns die Frage: Wird die Produktion vernünftiger E-Autos in Aachen gewollt behindert? Und warum könnte das geschehen?

Vorweg das Besondere an Streetscooter und e.Go

  • Der erste war der „Streetscooter“ (10/2015). Er ist ein Elektro-Lieferwagen und es gibt ihn in zwei Größenvarianten: „klein“ wie ein VW-Transporter und „groß“ wie ein Mercedes-Sprinter. Es ist ein zweckmäßig konstruiertes, einfaches Fahrzeug. Die Einzelkomponenten sind weitestgehend Standardprodukte.
    Er passt perfekt in das Anforderungsprofil „Versorgungs- und Arbeitsfahrzeuge im Nahbereich“ (<150km) mit vielen Zwischenhalten, Rückkehr zu einem festen Standort und einem Fahrzeugpool bei flexibler Nutzung von Firmen. Ein perfektes Fahrzeug für ALLE städtischen und regionalen Lieferdienste.
    Die Streetscooter gingen sehr schnell an die Kunden. Seither laufen etwa 10.000 Fahrzeuge in einem harten Alltagsbetrieb. Es sind keine bemerkenswerten Produktionsfehler bekannt geworden.
  • Das zweite Aachener Fahrzeug ist der „e.Go“ (seit 2016), ein kleiner Stadtwagen. Vom Raumangebot her ist er zwischen Smart und Fiat 500/VW Lupo angesiedelt. Technisch ist er komplexer als der Streetscooter, basiert aber auf den Erfahrungen bei dessen Entwicklung. Auch hier werden sehr einfache Komponenten verwendet. Es gibt keine technisch-sachlichen Gründe für Lieferprobleme der Komponenten (außer: man will nicht liefern). Ebenso wenig sind Probleme bei der Zulassung des Wagens bekannt.
    Das Anforderungsprofil ist gezielt für den innerstädtischen Ein-/Zwei-Personenverkehr konzipiert; entweder als Firmenpool-Wagen oder aber als privater Zweitwagen. Mit einem Preis von <20.000€ ist der e.Go deutlich preiswerter als die heutigen anderen E-Autos!

Beide Wagen sind auf ein Käuferpublikum mit folgenden Eigenschaften ausgerichtet: Zweckmäßige Nutzung eines Fahrzeugs, ökologische Orientierung, kein Bedarf an psychologischem Imageaufbau/Protzen (ich-bin-männlich, ich-bin-sportlich, ich-bin-reich).
Diese positive Bewertung bezieht sich ausdrücklich auf das genannte Nutzersegment. [3] Es sind keine klassischen Allzweckautos – da müsste sich noch deutlich was an der Batterietechnik tun. Aber für die genannten Nutzungssegmente gibt es zur Zeit nichts besseres als diese beiden Wagentypen!

==> Hierzu ein positiver Bericht in Auto-Motor-Sport

Die bisherige (kurze) Geschichte von Streetscooter und e.Go

  • Der „Streetscooter“ startete 2014 fulminant und machte ansehnliche Produktionszahlen. Die Firma (Produktionsanlagen) wurde 2014 von der Post AG aufgekauft und sogar noch in Düren durch ein zweites Werk erweitert – und dann würde es plötzlich ganz ruhig um den Wagen.
    Anfangs war er ein Verkaufsrenner. Die Post hat über 10.000 Fahrzeuge im Einsatz, man sieht das Fahrzeug aber auch bei anderen Lieferdiensten. Trotz dieser Erfolge wird der Streetscooter mittlerweile als Sorgenkind präsentiert, Gerüchte besagen, dass die Post das Werk wieder verkaufen will.
  • Den „e.Go“ gibt es seit 3/2017. Seit 5/2017 kann man den Wagen prinzipiell! kaufen. Und mittlerweile arbeiten 500 Leute in dem e.Go-Werk – aber der Wagen wird einfach nicht ausgeliefert!
    Seit mindestens 11/2018 gibt es auf der Hohen Straße in Köln einen großen ‚e.GO Pop-Up Store‘, in dem systematisch Werbung für den Kauf des e.Go macht. Die Verantwortlichen werden das Geld dafür doch nur in die Hand genommen haben, weil sie selber den baldigen Verkauf des Wagens erwartet hatten.
    Stattdessen werden halbjährlich Ausreden für die Nicht-Auslieferung veröffentlicht und die (willigen) Kunden immer wieder vertröstet. Ursprünglich sollten 3000 Fahrzeuge bis Ende 2019 produziert werden. Die Auslieferung ist aber erneut ins Jahr 2020 verschoben worden.
    Den e.Go gibt es „theoretisch“, aber aus irgendwelchen dubiosen Gründen ist er einfach nirgends zu kaufen! Auch der OB Philips wartet nach eigener Aussage immer noch auf „seinen“ e.Go!

Warum also Probleme – bei beiden E-Fahrzeugen?

Diese mysteriöse Geschichte über „Produktionsprobleme“ wird halbjährlich in den lokalen Zeitungen mit wortreichen Ausreden und erstaunlichen Meldungen begründet. Die letzte Überschrift dazu lautet am 19.10.2019 in den AN „e.Go räumt Produktionsprobleme ein.

  • Zu Problemen beim „Streetscooter“ ist (öffentlich) nichts bekannt!
  • Beim e.Go werden öffentlich folgenden Gründe genannt:
    • Der Lieferant ‚Ford‘ liefert nicht. (Was, welche Teile und warum? Ist unklar)
    • Der Batterielieferant ‚BMZ‘ ziert sich mit Lieferungen.
    • Und echt witzig: in den AN vom 19.10.19 wird eine „IP67-Regel für technische Geräte“ zitiert, die folgende skurrile Auflage enthält: „technische Geräte müssen auch nach einem mind. 30 minütigem Tauchbad im bis zu einem Meter tiefen Wasser voll funktionsfähig sein“. Und weil Lieferkomponenten diese Regel nicht erfüllen, darf der e.Go nicht gebaut werden?? Hmm!?

Es gibt ein ganz anderes, aber echtes Problem beim e.Go

Dort entstehen monatliche Unkosten von 2-3 Mio Euro! Seit Monaten sind dort ca. 500 Leute beschäftigt, was bei e.GO mindestens 2-3 Mio Euro Kosten, ohne jedwede Einnahmen erzeugt. Es müsste also ein Kostenproblem existieren – das aber öffentlich NICHT problematisiert wird.

Wieso führt das eigentlich nicht zum Bankrott? Wer bezahlt das?
Sorgt VW dafür, dass das Werk nicht pleite geht? Sorgt VW für Ruhe an den Arbeitsplätzen (wo ja faktisch nicht produziert wird) und „erkauft“ sich (wörtlich) so die Zeit, um seine wesentlich teureren Modell an den Markt bringen zu können? Die Erklärung könnte in der „Strategischen Partnerschaft“ von VW und e.Go liegen (siehe weiter unten).

Unsere Vermutung:
Es gibt einen Boykott der Auto-Industrie gegen ein vernünftiges E-Auto!

Je öfter sich die Ausreden für die Nicht-Lieferung des e.Go wiederholen, desto mehr fragen wir uns, ob wir gerade Zeugen werden, wie die (fossile) deutsche Autoindustrie mit trickreichen Mitteln verhindert, dass endlich mal vernünftige Elektro-Autos (statt der gigantischen E-SUVs) auf den Markt kommen?

Wir haben deshalb mal zusammengestellt, was wirklich hinter dieser eigenartigen und für Aachen (als perspektivischem Produktionsstandort) etwas bitteren Geschichte stecken könnte.

Indizien für eine „gewollte Produktionsbehinderung der sinnvollen E-Autos“

Unser Denkansatz lautet: Die Produkte Streetscooter und e.Go sind (vom Timing und der Funktionsweise) viel zu gut, sodass sie den ganz Großen in der Automobilbranche als Konkurrent echten ökonomischen Ärger machen und deshalb auf dem Markt stark „eingehegt“ oder besser noch „verhindert“ werden müssen. Möglicherweise hatte die fossile Autoindustrie beim Streetscooter noch erwartet, dass die RWTH-Newcomer es nicht schaffen würden. Aber nachdem der Streetscooter dann doch ein Erfolg wurde, wollten sie beim e.Go „besser aufpassen“. Die folgenden Argumente gelten für beide Fahrzeuge.

  • „Zeit schinden, um noch ein/zwei Jahre fossile Autos verkaufen zu können“ (= ExtraProfit-sichern). Jeder Monat spätere Auslieferung guter E-Autos schafft „Zeitraum“ für den Verkauf weiterer (gewinnbringender) Fossil-Autos.
  • „Zeit schinden, um als erstes Protz-E-Autos verkaufen zu können“ (=ExtraProfit-sichern). Solche sinnvollen E-Autos kommen für die fossile Autoindustrie „zu früh“, weil:
    • der Markt für dicke E-SUVs & schnelle E-PKW frei bleiben soll. Leute mit viel Geld wollen sich ein „grünes Image“ kaufen und zahlen dafür auch gerne viel Geld ….
    • erst nach Abdeckung dieses Marktanteils, „lohnt“ sich auch die Belieferung des preiswerteren Marktsegments.
      Sobald einmal der e.Go für 16.000 – 19.000 € auf der Straße zu sehen sein wird, brechen mit Sicherheit die Verkaufszahlen all der wunderschönen E-Golfs E-Opels, E-BMW, E-Benz ein, die zwar (sinnloserweise) in 3 Sek von Null auf 100 km/h „können“, aber preislich mindestens ein/zwei Klassen teurer sind.
  • „Diskreditieren“
    Diese Protz-E-Autos werden die Diskussion um die E-Mobilität bestimmen, weil viele ernsthafte Umweltschützer leider ausschließlich den Irrsinn der Protz-E-Autos sehen werden. Die Relevanz von sinnvollen E-Autos wird dann (wie beabsichtigt?) in den Hintergrund gedrängt.
  • „E-Auto als Spielzeug“?
    siehe zusätzlich auch den Artikel „Produziert e.Go Mobile bald ein VW-Funcar?

Eine vergiftete „strategische Partnerschaft“ mit VW?

Es gibt eine vertraglich/kommerzielle Verbindung zwischen VW und e.Go, die ebenfalls für die von uns unterstellte, bewusste Behinderungs-Strategie spricht: Wir wissen, VW will e.Go als Basis für die eigene, zukünftige E-Mobilitätssparte haben. (In den AN vom 5. März 2019 heißt es dazu: „… Der Weltkonzern öffnet seinen Elektrifizierungsbaukasten (MEB), mit dem es ab 2020 die neue Generation von Elektroautos bauen will, … e.GO ist weltweit der erste Partner in der Elektrosparte … Das Aachener Unternehmer profitiert doppelt von der Kooperation: Zum einen kann der Baukasten in die gerade anlaufende Produktion des eigenen e.GO life integriert werden. Und beide Unternehmen entwickeln in den kommenden Monaten gemeinsam ein Elektro-Auto, das die VW-Flotte ergänzen soll….“ (https://www.aachener-nachrichten.de/nrw-region/kooperation-von-ego-und-vw-neue-elektroautos-in-aachen-produziert_aid-37182963)

Das würde einerseits erklären, wer und warum die Übernahme der aktuell entstehenden Kosten übernimmt. Unfreundlich formuliert ist das dann ein „Leerlauf-Geld“ oder „Bestechungsgeld“ von VW, damit im Aachener e.Go-Werk Ruhe herrscht und man „freiwillig“ nicht liefert, um so den Markt für die in 2020 kommenden (erhofften) VW-Modelle „frei“ zu halten.

Beides macht Sinn für VW: Einerseits so den gefährlichen Newcomer klein halten; gleichzeitig sich dessen Know-how für die eigenen (eigentlich zu spät) kommenden Goliath-Aufgaben an zu eignen!

Es KÖNNTE aber auch ganz anders sein…

Es gibt doch echte Probleme bei der Produktion – eine simplere Erklärung?
Dann wären die Produktions- und Auslieferungsverzögerungen Ergebnis echter Probleme und zeigen nur, dass eine RWTH (bzw. das kommerzielle Spin-Off) nicht in der Lage ist, ein sinnvolles verkäufliches Produkt zu entwickeln, technisch zu planen und zu produzieren. Wir von der kraz glauben DAS nicht.

Zum Schluss eine Bitte

Wir haben versucht, eine wichtige Wirtschaftsentwicklung in Aachen zu beschreiben. Uns fehlen eine Reihe von Fakten, wir haben nur „mögliche“ Erklärungen geliefert. Unsere LeserInnen mögen selber entscheiden, was da eigentlich los ist.

Als kraz-Redaktion würden wir uns aber freuen, wenn wir Insider-Informationen bekämen, die unsere genannten Thesen entweder stützen oder aber widerlegen. Uns geht nicht um das „Recht-Haben“, wir wollen „verstehen“.

Anmerkungen

[1] Zur Geschichte der Aachener Auto-Produktion
Zu Beginn des vorigen Jahrhunderts (1903) gab es eine Automobilproduktion in Aachen durch die Firmen Fafnir und Cudell. Aber schon 1926 war alles wieder vorbei. Deshalb war es schon eine Sensation, als Streetscooter und e.Go als Spin-Offs der RWTH neu auftauchten.

[2] Das Missverständnis im Namens „Elektro-Auto“
Ein Elektro-Auto heißt so, weil der Antrieb „elektrisch“ ist. Der Strom für den Antrieb kann prinzipiell auf unterschiedliche Art ins Fahrzeug gelangen (Straßenbahnen und O-Busse bekommen ihn per Oberleitung). Bei Autos ist der heutige Standard eine (Lithium)-Batterie. Sie könnten aber genauso gut durch Brennstoffzellen (Wasserstoff) mit Strom versorgt werden! Eine (veraltete) Zwischenlösung war ein kleiner fossiler Motor im Fahrzeug, der dessen Batterie und damit die Elektromotoren mit Strom versorgt.

[3] Unser hohes Lob für den Streetscooter und den E.Go könnten so wirken, als ob wir E-Autos für DIE Lösung der städtischen oder gesellschaftlichen Problematik des Autoverkehrs halten.
Nein, wir wissen sehr wohl, dass Elektrofahrzeuge auch den gleichen Platz verbrauchen, den Fuß- und Radverkehr gefährden und verdrängen, die Städte mit Lärm verpesten usw. usf.. Elektroautos sind nur in einigen Bereichen ein echter Fortschritt gegenüber den fossilen Autos. In anderen sind sie genauso schlecht und für das „schlechte Gewissen bei der Autonutzung“ sind E-Autos sogar eher verführerisch, um sich so ein reines Gewissen zu verschaffen!
Wir wissen, dass die wirkliche Lösung ein anderes Verkehrskonzept (= anderer Modalsplit) mit viel mehr Öffentlichem Verkehr (ÖV) sein muss und sein wird. Hierzu gab und gibt es in Aachen Überlegungen („Renaissance der Tram“), über die wir in einem längeren Artikel berichten werden.

Datei:Streetscooter 3.JPG

ABER: Wir wissen auch, dass die Umformung unserer Lebenswelt in Auto-gerechte-Städte – und leider auch des „Denkens“ der Menschen im Sinne einer ‚Windschutzscheibenperspektive‘ – „erfolgreich“ gesteuert durch die Profitlogik der Autoindustrie gelungen ist und dass mit dem aktuellen Höhepunkt der Perversion durch SUVs und der aktuellen Automode mit den hochgeschürzten, aggressiven Frontpartien der Autos eine spezielle Form der „Männlichkeit“ bedient wird.

Deshalb wird es – egal wie schnell ein deutlich besserer ÖV entwickelt wird – noch lange individuell fahrende Autos geben, die bestimmte Bereiche in den Städten und Regionen mit Autos statt mit ÖV bedienen. Unklar ist, wie lange es noch dauert, bis die selbstgesteuerten durch autonom fahrende Fahrzeuge ersetzt werden. Und spätestens DANN wird ein hoher Bedarf an elektrischen – statt fossilen Antrieben bestehen.

Deshalb wünschen wir uns jetzt schon die beschleunigte Entwicklung der Elektroautos – und gerne auch Aachen als die Stadt, in der die Vorreiterfahrzeuge entwickelt und produziert werden. Heute polemisieren noch nur noch genau diejenigen gegen E-Fahrzeuge, die bisher immer die fossile Industrie und ihre Protz-Autos erhalten wollten. Wenn sie dabei heute das Argument „mehr ÖV“ verwenden, ist das nur verlogen. Wir sagen das aus Kenntnis der Verkehrspolitik der letzten 35 Jahre, die sich an zwei wichtigen Lobbyorganisation manifestiert hat: Dem ADAC (als reine Autolobby) und dem VCD (=Verkehrsclub Deutschland), der sich seit seiner Gründung 1986 eindeutig für ein sinnvolles Miteinander ALLER Verkehrsteilnehmer: Fußgänger, Radfahrer, ÖV-Nutzer und Autofahrer einsetzt.

Quelle: https://www.kraz-ac.de/elektroautos-made-in-aachen-5974

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen          :

Oben           —         Prototyp StreetScooter Leichtelelektromobil     C 16

Author Franz Haag

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

——————————-

Unten      —          Streetscooter – Ein batteriebetriebenes Lieferfahrzeug für die Deutsche Post, gebaut in Aachen von der Talbot Services GmbH

Urheber RudolfSimon

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Medien, Nordrhein-Westfalen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle  streifzuege.org

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.

Keep-it-in-the-ground.jpg

Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.

—————————–

2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.

—————————-

3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.

——————————–

Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

Abstieg eines Superstars

Erstellt von DL-Redaktion am 9. November 2019

30 Jahre Sieg des Kapitalismus

'Today capitalism has outlived its usefulness' MLK.jpg

Eine Kolumne von

Hochmut kam nach dem Mauerfall: 30 Jahre nach dem vermeintlichen Triumph wird offenbar, in welch dramatischer Glaubwürdigkeitskrise der Kapitalismus mittlerweile steckt.

Als im Sommer vor 30 Jahren der Kommunismus zu kollabieren begann, deklarierte der US-Politologe Francis Fukuyama, nun sei die Geschichte zu Ende. Die Menschheit hatte sozusagen den Idealzustand erreicht – Demokratie und Kapitalismus.

Aufgabe erledigt. Erde glücklich.

Heute wirkt der Befund wie eine bizarre intellektuelle Irrung. Drei Jahrzehnte nach dem Ableben des Kommunismus erscheint die Erde etwas glücklos:

  • Es drohen Klimakrisen;
  • das Auseinanderdriften von Reich und Arm hat vielerorts nur schwer tragbare Ausmaße erreicht;
  • bizarre Präsidenten einstmals marktwirtschaftlich vordenkender Nationen drohen mit Handelskriegen;
  • und mehr als die Hälfte der Erdbevölkerung wird von autokratisch oder populistisch Regierenden geführt, wie Nobelpreisträger Joseph Stiglitz jüngst ätzte.

Was ist da schiefgelaufen? Die Antwort könnte in jener Siegessicherheit liegen, die den Kapitalismus in den Jahrzehnten nach Überwindung des Kommunismus zu dem einen oder anderen Exzess trieb. Im Hochmut nach dem Mauerfall, sozusagen. Von wegen Ende der Geschichte.

Bittere Ironie

Die Ironie selbiger: Jetzt stecken Demokratie und Marktwirtschaft so tief in der Krise, wie es ohne den Übermut, der im Herbst 1989 seinen Lauf nahm, womöglich nie geschehen wäre.

Mit dem Fall der Mauer wurde dereinst ein Trend beschleunigt, der Anfang der Achtzigerjahre mit dem Antritt von Ronald Reagan in den USA und Margaret Thatcher in Großbritannien begonnen hatte. Demnach ist es wirtschaftlich per se immer gut, wenn der Staat sich zurückzieht; wenn jeder erst einmal an sich denkt, statt über Gesellschaft zu sinnieren; wenn jeder für sich vorsorgt, statt auf Hilfe vom Staat zu zählen; wenn alles dem strengen Wettbewerb ausgesetzt ist; wenn Reiche von Steuern entlastet werden; und wenn Banken wie andere Finanzjongleure so frei wie möglich mit Geld spekulieren können.

All das hatte als neues Dogma bis zum Mauerfall schon Risse bekommen – ob durch den Aktiencrash 1987 oder das Schuldenmachen von Reagan. Als der Kommunismus weg war, wirkte nur die normative Kraft des Faktischen viel stärker – und der sehr menschliche Gedankengang: Wer gewinnt, hat Recht.

Gewonnen ja – aber grenzenlos gut?

Sprich: Weil der Kommunismus ganz offenbar gescheitert war, was ja stimmt, galt der Kapitalismus als gut. Und umso schwerer war zu argumentieren, dass es deshalb trotzdem nicht gleich richtig ist, wenn der Kapitalismus sich nun ordentlich austobt.

Was das heißt, haben Ostdeutsche zu spüren bekommen, als ihnen blühende Landschaften durch Umschalten auf glorreiches Marktwirtschaften versprochen wurden. Und dann die Treuhand dem Gedanken freien Lauf ließ, wonach alles, was nicht auf Anhieb der Konkurrenz standhält, einfach nicht zu halten ist. Auch wenn das zu Massenarbeitslosigkeit führte.

In den Jahren danach machten Regierungen weltweit immer irrere Reformen zugunsten von Finanzwelt, Schattenbanken und Derivatejunkies; wurden unter dem Motto des glorreichen Wettbewerbs über Nacht Märkte für Billigkonkurrenz aus China geöffnet. Und selbst eine rot-grüne Regierung setzte durch, dass Reiche weniger Steuern zahlen und Schlechtergestellte sanktioniert werden.

Widerspruch? Zwecklos

Wer in diesen Zeiten Zweifel äußerte, ob denn gleich alles privatisiert werden müsse, dem wurde beschieden, dass ja wohl keiner zum Sozialismus zurückwolle. Totschlagargument. Wer will denn schon wieder den Honecker? Klar.

Bochum - Alleestraße144 14 ies.jpg

Was derlei Selbstgewissheit anrichten kann, ist heute zu beobachten. Wenn Reich und Arm in so vielen Ländern so dramatisch auseinandergehen, hat das natürlich mit Finanzmärkten zu tun, wo nur wenige zu den großen Gewinnern zählen – oder damit, dass Reichensteuern gesenkt wurden. Wenn in den USA ganze Regionen wirtschaftlich abstürzten, weil sie chinesischer Billigkonkurrenz so wenig standhalten konnten wie einst das eine oder andere Werk im Osten Deutschlands der Westkonkurrenz, hat auch das mit einer naiven Vorstellung von selbstregulierenden Märkten und menschlicher Anpassungsschnelle zu tun.

Quelle       :       Spiegel-online          >>>>>         weiterlesen

——————————————————————–

Grafikquellen      :

Oben         —          Banner at the 2012 Republican National Convention depicts Martin Luther King, Jr., and the quotation: „Today Capitalism has outlived its usefulness.“

————————————

Unten        —         Alleestraße 144 in Bochum

Abgelegt unter International, Kultur, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Aktivisten und Rebellen

Erstellt von DL-Redaktion am 7. November 2019

Über Demonstrationen und Aktionen

File:Extinction Rebellion Wellington Protest Flag 3.jpg

Quelle       :       untergrund-blättle CH.

Von   Eckhard Mieder

Neulich fiel es mir während einer sonntäglichen Autofahrt ins Bergische Land auf.

Ich schaltete das Radio ein, um den Verkehrsstand auf den Autobahnen zu erfahren, und geriet in die davor gesetzten Nachrichten, in die Verbal-Häppchen, die heutzutage als Radio-Nachrichten für das hungrige Welt-Ohr ausgegeben werden. Die Kurz-Rede ging u. a. von den Aktivisten, die in Hongkong demonstrierten.

Vor der Autofahrt hatte ich nach dem Frühstück in der Zeitung von Klima-Aktivisten gelesen; es gab eine Affinität und Diversität zwischen ihnen und den Aufrührern der Extinction Rebellion. Nicht lange davor erfuhr ich, dass der thüringische CDU-Chef Mike Mohring „CDU-Rebellen“ kontert, während in Syrien irgendwelche Rebellen gegen Assad (oder für ihn?) schossen. Auch gab es Aktivisten in Nordsyrien, und Aktivist*innen besetzen – ein Akt der Revolte oder Rebellion? – ein seit langer Zeit leer stehendes Haus in Berlin. Ausserdem retten Aktivisten auf dem Mittelmeer Menschen aus der Seenot bzw. agieren Aktivisten und Rebellen im Ukraine-Konflikt. Etc. pp.

Plötzlich hatte ich das Gefühl, dass es auf dieser Welt mehr Aktivisten und Rebellen als Bienen gibt. Es wimmelt von ihnen, um mich herum. Und ich stellte fest: Wenn ich alles Mögliche bin, eines bin ich nicht, ich bin kein Aktivist. Und der Rebell in mir meldet sich nur noch selten und bellt ein bisschen; ich sollte ihn eher einen Nörgler oder Motzer nennen, nicht einen Rebellen. Denn vor Rebellen habe ich Respekt. Obwohl … Oder …

Ich fuhr so dahin auf der A 5. Ich wollte zur Tropfsteinhöhle nach Wiehl, um mit Frau, Tochter und zwei Enkelkindern in die Erde hinabzusteigen. Ein aktiver Ausflug in die Natur, friedfertig und mit dem sanften Grusel des gesicherten Dunklen. Aber mich liessen die Aktivisten und Rebellen nicht in Ruhe. Sie zogen mir durch den Kopf wie die eine oder andere Demonstration durch eine Stadt.

Sollte ich nicht besser „Aktivisten“ und „Rebellen“ denken? Wenn sie so massenhaft daherkommen und in den Medien massenhaft aufmarschieren und für sehr verschiedene Haltungen, Tätigkeiten, Kämpfe etc. herhalten – dann können sich unter so hochwölbenden und unter sich allerlei Diversitäten versammelnden Begriffen alle einfinden, die aus dem Tritt bürgerlich-gemächlichen Ganges geraten? Wenn es sich um quasi wertfreie Begriffe handelt -, dann ist der gewesene Rebell Joschka Fischer der Papi des heutigen demonstrierenden Jungnazis. Dann ist die Aktivistin Greta Thunberg die Tochter von Erika Steinbach. Dann ist Edward Snowden als Aktivist ein Enkelsohn des „Aktivisten der faschistischen Arbeit“ Adolf Eichmann. Allerdings werden aktive Rechte und Ultrarechte nicht „Aktivisten“ und „Rebellen“ genannt. Logisch ist das nicht.

Oder die Journalisten und Politiker wissen nicht genau, wer sich hinter den „Rebellen“ und „Aktivisten“ verbirgt? Muss ja auch schnell gehen, die Zeit, jeden Akteur genau zu erkennen und zu benennen -, die hat’s eben nicht. Folglich passt das Etikett auf alles, was auf dem Prokrustes-Hackklotz zu handlichen Verbal-Würfeln gehauen wird. „Aktivist“/“Rebell“ – sitzt, passt, wackelt und hat Luft. Und ich darf mich korrigieren. Wieso bin ich kein Aktivist? Ich bin einer, weil ich ein zielbewusst und energisch handelnder Mensch bin. Sagen wir verhalten: sein kann. Als solcher bin ich übrigens einmal in meinem Leben als „Aktivist der sozialistischen Arbeit“ ausgezeichnet worden.

Ich erinnere mich nicht mehr genau; ich gehörte einem Kollektiv an, das als solches geehrt wurde. Ich glaube, es gab 50 Mark Prämie, für jeden. Ich erinnere mich auch nicht daran, etwas besonders Anderes gemacht zu haben als zu arbeiten. Das konnte reichen für eine Medaille; die sozialistische Arbeit war schliesslich keine Disziplin des Leistungssports.

Und darf ich mich nicht auch Rebell nennen, weil ich vor wenigen Jahren noch in Demos mitgelaufen bin? Die Protestierer wurden allerdings in Zeitungen und Polizeiberichten gern als Chaoten oder als Extremisten bezeichnet. Da hatte die Werte-Freiheit eines Über-Begriffs ihre Grenzen und die Zuordnung – sass, passte und wackelte nicht und hatte Luft. Und wie oft habe ich in meinem Leben schon die Fäuste geballt in der Hosentasche … Man kann ja auch Rebell sein, wenn man nicht in Lumpen oder mit Lumpen herumläuft. Wenn man die bürgerlichen Umgangsformen beherrscht, eine Krawatte binden kann und Manon Lescaut nicht für eine belgische Biersorte hält.

„Aktivist“ klingt irgendwie nach was Gutem. „Rebell“ klingt irgendwie nach was „Schlechtem“? Aber sind die Rebellen, die gegen Assad kämpfen – ja, was sind das für welche? Oder die in der Ukraine? Die guten? Weil „wir“ es behaupten? War Robin Hood ein guter Rebell, wirklich? Sind die CDU-Rebellen gut oder schlecht, und sind sie einfach nur ungezogen und – nun, rebellisch. Oder hilft „gut“ und „schlecht“ sowieso nicht, weil Einigkeit herrscht: „Rebellen“ und „Aktivisten“ sind nun mal halt so Begriffe, und wer unter dem einen, wer unter dem anderen erfasst wird -, hängt davon ab, wo man den oder jenen sehen möchte. Es könnte helfen, nach ihren Zielen zu fragen; kennen wir die genau? Ich weiss sie nicht mal genau von den benachbarten Gelbwesten, deren Aktionen mir in Frankfurt am Main näher sind als die Aktionen der Hausbesetzer im fernen Berlin. Ziemlich schwammig das Ganze, meiner Ansicht nach.

Mir sind, folge ich den Berichten, zu viele Aktivisten und Rebellen unterwegs. Sie bedrängen mich und stellen mich vor die Frage, ob ich nicht endlich auch in die Puschen komme und aktivistisch und rebellisch werden will. Wir brauchen Aktivist*innen und Rebell*innen; wobei eben das ist nicht sicher, weil ja jeder und alles darunter fällt. Also: Es gibt genug zu tun; mit der schlaffen Ergänzung „ … lassen wir es liegen“, kommst du nicht durch, wenn du dich beiseite hältst.

Wiehler Tropfsteinhoehle.jpg

Als ich mit den Enkelkindern in die Tropfsteinhöhle von Wiehl hinabstieg – das Gangsystem ist 868 Meter lang -, fühlte ich mich immerhin als Aktivist des Grossvatertums. Ich sah verblüfft, dass im künstlichen Licht der Lampen und in der hohen Luftfeuchtigkeit leuchtend grün Farn, Flechten und Moos wuchsen; das Grünzeug liess sich täuschen: Es hielt das elektrische Licht für die Sonne.

Da unten hörte ich von der Höhlen-Erklärerin zum ersten Mal im Leben vom Stalagnaten. Der entsteht, wenn ein Stalaktit und ein Stalagmit zusammenwachsen. Von oben nach unten, von unten nach oben, bis sie sich treffen. Von der Natur lernen heisst Neues lernen. Es mag ein bisschen an den Haaren herbeigedichtet sein, ich erfand für mich den Begriff „Aktibell“. So einer, glaube ich, bin ich.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

———————————————————————–

Grafikquellen      :

Oben         —           A flag from the Extinction Rebellion Protest in Wellington

Author Heapsrich     /      Source   :    Own work

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

———————-

Unten      —       Wiehler Tropfsteinhöhle

Abgelegt unter Energiepolitik, Kultur, Mensch, Umwelt | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 5. November 2019

Lebensstile von Politikern

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Robert Misik

Normal musst du sein! Dürfen linke Politiker Porsche fahren oder Brioni-Anzüge tragen? Wann immer solche Lebensstilfragen aufpoppen, geraten Argumente durcheinander.

Eine Freundin von mir vertritt die Ansicht, die Mentalitätsunterschiede zwischen Deutschen und Österreichern träten besonders plakativ in zwei Liedern zutage: in dem Song „Ruaf mi net an“ des verstorbenen Wiener Liedermachers Georg Danzer und in „Zu spät“ von den Ärzten.

Beide haben dasselbe Thema, nämlich verschmähte Liebe. Hauptfigur ist jeweils ein junger Mann, der von seiner Freundin verlassen wurde, weil sie sich einen klügeren, reicheren, prestigeträchtigeren Partner gesucht hat. Doch während in der deutschen Version die Ich-Figur in gigantomanische Fantasien verfällt, versinkt die österreichische Figur in weinerlichem Selbstmitleid.

Bei den Ärzten heißt es: „Doch eines Tages werd’ ich mich rächen / Ich werd’ die Herzen aller Mädchen brechen / Dann bin ich ein Star, der in der Zeitung steht / Und dann tut es dir leid, doch dann ist es zu spät.“

Bei Danzer dagegen tut der trauernde Twentysomething gar nichts, nimmt Tabletten, kann nicht mehr schlafen und verwünscht den neuen Liebhaber, der die Ex in Restaurants einlädt und ein teures Auto fährt. „I waß du hasd jetzt an Freund mid an Porsche / Geh sag ihm er soll do in Oasch geh.“ Allein dafür, dass er „Porsche“ auf „Oasch geh“ („in den Arsch gehen“) reimte, gebührt Danzer der Literaturnobelpreis. Der Porsche steht hier für Protzerei, für das Neureiche, auch ein bisschen für das Ludenhafte. Porsche repräsentiert auch ein wenig das Unse­riöse, Krösushafte.

Wir führen ja bei uns in Österreich meist ähnliche Debatten wie ihr in Deutschland, nur noch ein bisschen dümmer. Deswegen hatte die österreichische Sozialdemokratie zuletzt ihre „Porsche“-Debatte. Die SPÖ ist ja bei den vergangenen Parlamentswahlen auf 21 Prozent abgestürzt, Tags darauf trat der Bundesgeschäftsführer zurück und holte seine Habseligkeiten mit seinem schicken Oldtimer-Porsche aus der Parteizentrale. Als sich dann noch herausstellte, dass auch der Tiroler Landesvorsitzende mit einem modernen Porsche-Modell durch die Gegend kurvt, waren die „Luxus-Sozis“ in den Schlagzeilen und buchstäblich „im Oasch“.

Entkontextualisierte Debatte

Wann immer solche politischen Lebensstilfragen aufpoppen, geraten die Argumente durcheinander. Die einen meinen, linke Politiker müssten auch durch ihren Lebensstil ausdrücken, dass sie auf der Seite der einfachen Leute stehen, und dafür sind Villen, Luxuskarossen und teure Uhren, Brioni-Anzüge und Zigarren Gift. Die anderen meinen, dass diese Leute sich das Zeug ja erstens von ihrem verdienten Geld gekauft haben, sie daher auch niemandem Rechenschaft schuldig seien, dass es zweitens darum gehe, ob sie gute Politik machen, nicht ob sie in Sack und Asche herumliefen, und dass die Linken, drittens, doch für Wohlstand und Luxus für alle eintreten, nicht für Armut für jeden.

Quelle      :          TAZ        >>>>>         weiterlesen

—————————————————————-

Grafikquellen      :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Feuilleton, P. DIE LINKE, Überregional, Umwelt | Keine Kommentare »

Koks für den Satan

Erstellt von DL-Redaktion am 3. November 2019

Die Hizbollah und der Kokainhandel

File:Erythroxylum coca 003.JPG

Von  Tal Leder

Der weltweite Drogenhandel ist für die libanesische Hizbollah eine wichtige Einnahmequelle. In Lateinamerika hat die schiitische Miliz Verbündete gefunden.

Die libanesische Terrororganisation Hizbollah ist tief in den internationalen Drogenhandel verstrickt und betreibt Geldwäsche in großem Stil. Ein komplexes System macht die Bekämpfung des sogenannten Drogen-Jihad schwierig. Im Zuge der Operation »Northern Shield« zerstörte die israelische Armee (IDF) zwischen Dezember 2018 und Mai 2019 sechs unterirdische Tunnel der Hizbollah. Die Tunnel reichten bis auf israelisches Territorium und sollten bei einem Kriegsausbruch Elitekämpfer und Waffen nach Israel bringen. Sie sollten der Organisation aber auch bei ihren Drogengeschäften nützen. Zwar wird die Miliz vom Iran militärisch, logistisch und finanziell unterstützt, doch ein Teil ihrer Einnahmen stammt aus dem Drogenhandel.

Die Hizbollah ist seit den achtziger Jahren in den Drogenhandel verwickelt, einer Zeit, als der Iran begann, sein ­geheimdienstliches Netz in Lateinamerika aufzubauen. Generell floriert im Nahen Osten der »Drogenterrorismus«, also die Finanzierung von Milizen durch Drogengeschäfte. Mittlerweile ist die Hizbollah selbst zu einem mächtigen Drogenkartell geworden. Nach Angaben der Vereinten Nationen ist der ­Libanon der drittgrößte Produzent von Cannabis-Harz (sechs Prozent der weltweiten Produktion), nach Marokko und Afghanistan. Roter Libanese, die gängigste Sorte Haschisch, wird im Irak, in Jordanien und in Dubai konsumiert. Beduinenstämme, die auf beiden Seiten der israelisch-ägyptischen Grenze leben, bringen Marihuana und Haschisch auch nach Israel. Manche dieser Ladungen werden auf Kamelen ohne menschliche Begleitung nach Israel geschickt und nach dem Überqueren der Grenze abgeholt.

Neben dem Verkauf von Cannabis ist insbesondere der Schmuggel und Verkauf von Kokain eine Geldquelle der Miliz. Nach Einschätzung der US-Behörden setzt sie dabei jeden Monat 200 Millionen US-Dollar um.

Die Aktivitäten der Hizbollah erstrecken sich nicht nur nach Europa, insbesondere nach Deutschland, Belgien und auf den Balkan, sondern auch nach Südamerika, dort besonders in die Dreiländerregion von Argentinien, Brasilien und Paraguay, wo es schon seit langem eine libanesische Diaspora gibt. Im 19. Jahrhundert wanderten dort die ersten Libanesen ein, viele weitere kamen in den achtziger Jahren während des libanesischen Bürgerkriegs; heutzutage leben über 50 000 Libanesinnen und Libanesen in dem Gebiet.

Auch in Lateinamerika ist die Hizbollah tätig, neben Venezuela auch in Mexiko. Durch die Allianz mit Drogenkartellen wie den mexikanischen ­Zetas kann die Terrormiliz enorme Gewinne aus dem illegalen Drogenhandel er­zielen und für die Bewaffnung, Ausrüstung und Ausbildung ihrer Mitglieder verwenden. Sie dient dort häufig als Kurierdienst für die Verteilung der von den Kartellen vertriebenen Drogen ­sowie für die Geldwäsche.

Ein internes Memo der Polizei von Tucson, Arizona, enthüllte bereits im Jahr 2010, dass die Hizbollah Verbindungen zu mexikanischen Drogenkartellen aufgebaut hatte, um ihnen zu helfen, Geld zu waschen und zugleich den Waffen- und Drogenhandel zu fördern. Die Polizei warnte davor, dass die Folgen der Zusammenarbeit zwischen der Hizbollah und den mexikanischen Drogenkartellen katastrophal sein könnten, da die Terrororganisation über fortschrittliche Waffen und Fachwissen verfüge, insbesondere über Kennt­nisse im Umgang mit improvisierten Sprengkörpern.

Der sogenannte Drogenterrorismus  gefährde mittlerweile die nationale ­Sicherheit vieler Nationen, sagt Rachel Ehrenfeld, Gründerin und Direktorin des in New York ansässigen American Center for Democracy sowie von dessen Economic Warfare Institute. »Der Zusammenhang zwischen transnationalen kriminellen Organisationen und terroristischen Gruppen endet nicht bei illegalem Drogenhandel. Ihre Partnerschaften sind komplex und verbinden Kriminalität mit Wirtschaft und Politik«, so Ehrenfeld. Ein Teil des Geldes werde verwendet, um politische Systeme zu destabilisieren. Der sogenannte Kokain-Jihad gehe auf eine iranische Fatwa zurück: »Wir stellen ­diese Drogen für den Satan Amerika und die Juden her. Wenn wir sie nicht mit Waffen töten können, dann mit Drogen.«

Quelle          :          Jungle-World          >>>>>         weiterlesen

———————————————————————-

Grafikquellen        :

Oben         —          Erythroxylum coca, Erythroxylaceae, Cocastrauch, Blüte. Das Alkaloid Kokain wird in der Homöopathie als Arzneimittel verwendet: Cocainum purum (Cocain-p.)

This file is licensed under the Creative CommonsAttribution-Share Alike 3.0 Unported license.

Author H. Zell       /       Source     –   Own work

——————-
Unten         —        Des combattants des Forces révolutionnaires internationales de guérilla, à Tabqa, le 12 juin 2017.

Abgelegt unter Asien, Kriminelles, Medien, Umwelt | Keine Kommentare »

10 Gebote via Klimasünden

Erstellt von DL-Redaktion am 1. November 2019

Was tun gegen die Erderwärmung

File:Cloudeffects.svg

Von Daphne Weber

Extinction Rebellion hat Recht: die Erderwärmung ist besorgniserregend, Endzeitstimmung ist angesagt. Aber wer ist der Adressat des Jüngsten Gerichts?

In wallende rote Gewänder gekleidet schreiten schweigende Gestalten durch die Straßen. Einige von ihnen tragen rote Fahnen, auf ihnen eine stilisierte Sanduhr. Hamburg: Über die neue Promenade ergießt sich rotes Kunstblut, inmitten der Lake ein weißer Sarg, ebenfalls mit einer Sanduhr versehen. Nein, wir sind nicht versehentlich in der Karwoche in Sevilla gelandet, bei der Hunderte in violetten Büßergewändern durch die Stadt prozessieren und um die Vergebung ihrer Sünden bitten. Es handelt sich um Protestformen der Gruppe Extinction Rebellion (XR), die unter anderem Anfang Oktober einige Straßenblockaden in Berlin organisiert hat, um auf das globale Artensterben aufmerksam zu machen.

Nichtsdestotrotz ist der Vergleich mit Büßerprozessionen nicht ganz weit hergeholt. XR bemüht die martialische Bildwelt gern, zum Beispiel, wenn Galgen aufgestellt werden, unter denen Demonstranten auf schmelzenden Eisblöcken stehen. So weit, so mittelalterlich. Mit dem Unterschied, dass das Ganze in High-Quality-Videoclips voller hoch emotionalisierter Affektbilder auf Instagram zu sehen ist. Der Social-Media-Auftritt? Maximal professionell. Die Bildsprache? Maximal messianisch-religiös. Die Inhalte? Ihr werdet alle sterben.

Es kann sein, dass vor Ort alles sehr nett ist, es kann sein, dass die Initiative noch jung ist und sich erst finden muss. Aber es darf gefragt werden, wohin sie steuert.

Bei XR kann jeder mitmachen, der sich einem Konsens von 10 Geboten verpflichtet, unter anderem dem Gebot der „Gewaltfreiheit“. Welchen Gewaltbegriff XR hat, bleibt dabei schleierhaft. Parolen wie „The day of reckoning will come“ oder „Stand with the earth“ erinnern an die biblische – sehr gewaltvolle – Apokalypse des Johannes. Wer nicht für mich ist, ist gegen mich, und der Tag des Jüngsten Gerichts wird kommen. Die Sanduhr läuft ab, und zwar zwingend. Damit inszenieren sich die Aktivisten als Propheten eines nahenden Endes der Welt. Die Natur ist Gott, und ihr muss man sich beugen.

Mutter-Erde-Metaphern

Die Rebellion gegen das Artensterben mag ehrenhaft sein. Sie gleitet allerdings mitunter ins Esoterische ab. Bei den Blockaden in Berlin gibt es die Möglichkeit, für die Erde zu meditieren. Alte Mutter-Erde-Metaphern treten an die Stelle eines kritischen Feminismus, der uns vor allem eines gelehrt hat: Was Natur ist, ist menschliche Kons­truk­tion. Welche Natur will XR schützen? Rebellion gegen das Artensterben um ihrer selbst willen? Oder Rebellion gegen das Artensterben, weil die Lebensgrundlage des Menschen vernichtet wird?

Dass der Mensch die Natur in Ansätzen beherrschen gelernt hat, ist ein Fortschritt, hinter den eine progressive Bewegung nicht zurückfallen sollte. Und ohne technischen Fortschritt ist die gerechte, klimafreundliche und ausbeutungsfreie Gesellschaft auch nicht zu denken. Wer das infrage stellt, sehnt einen Steinzeitkommunismus herbei, in dem wir uns wieder selbstversorgend vom Schweiß des Ackers ernähren und eine Lebenserwartung von knapp vierzig Jahren haben, Säuglingssterblichkeit inklusive. In manchen Teilen der Umweltbewegung wirkt es, als seien der technische Fortschritt und der Mensch an sich das Problem, da sie das Artensterben verursachen würden. Hier muss letztlich der emanzipierte Mensch unsichtbar werden, er muss verschwinden, so wie die sündigen Büßer unter ihren Gewändern.

Ja, die Erderwärmung ist besorgniserregend, Endzeitstimmung scheint angebracht. Aber wer ist der Adressat des Jüngsten Gerichts? Die Bilder, die die Anti-Kohlekraft-Bewegung Ende Gelände produziert, scheinen ebenfalls der Apokalypse zu entstammen: Aktivisten in weißen Anzügen schlittern durch sandige Wüsten, über ihnen bäumen sich gigantische Kohlebagger auf, umringt von Robotercops. Das ist die Realität 2019, auf die Ende Gelände den medialen Fokus richtet: Eine Marslandschaft, geopfert dem Konzernprofit. Ende Gelände legt den Finger in die Wunde und adressiert einen sorgfältig abgeschirmten konkreten Akteur der Klimakrise: RWE. Der Kampf um Klimaschutz ist kein individueller Ablasshandel. So erscheint er aber oft bei Gruppen wie XR.

Climate change protests, Melbourne.jpg

Der einzelne Mensch an sich ist nicht der Hauptverursacher der Klimakrise. Anders gefragt: Wo soll eine Hartz-IV-Mama den Gürtel noch enger schnallen? Wie soll der Pendler in die Stadt, um Lohn zu erarbeiten, wenn der ÖPNV so miserabel ist? Die Verzichtslogik bei Umweltgruppen wie XR kommt im Büßergewand daher, und das passt auch zur Inszenierung der Proteste.

„Sagt die Wahrheit“

Die Aktivisten weisen zwar darauf hin, dass der Kollaps von Ökosystemen auch das Aussterben des Menschen zur Folge haben wird. Die Klimakrise wird aber nicht gelöst werden, wenn man so tut, als seien alle Menschen in gleicher Weise „Klimasünder“ und müssten einfach nur Abbitte leisten. Die Klimakrise wird nicht überwunden werden, wenn Wirtschaft und Verteilung des Reichtums unangetastet bleiben. Das gehört zur Wahrheit, und „Sagt die Wahrheit“ ist schließlich eine der drei Kernforderungen von XR.

Quelle          :       TAZ           >>>>>          weiterlesen

————————————————————————-

Grafikquellen         :

Oben         —       Hohe Wolken sind oft dünn und nicht sehr reflektierend. Sie lassen einen Großteil der Sonnenwärme durch, und da sie in großen Höhen liegen, wo die Lufttemperatur sehr niedrig ist, strahlen diese Wolken nicht viel Wärme ab. Die Tendenz hoher Wolken ist, die Erde zu erwärmen. Niedrige Wolken sind oft dicht und reflektieren viel Sonnenlicht zurück in den Weltraum. Sie liegen dabei auch niedriger in der Atmosphäre, wo Temperaturen wärmer sind, und strahlen deshalb mehr Wärme ab. Die Tendenz niedriger Wolken ist, die Erde zu kühlen.

Author Christoph S.    /     Source    —    original image, freely redrawn with Inkscape by User:Gissi

I, the copyright holder of this work, release this work into the public domain. This applies worldwide.
In some countries this may not be legally possible; if so:

—————————-

Unten           —         Thousands of Cyclists in Melbourne for 350 Climate Protest

Abgelegt unter Bildung, International, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Die Klimakrise:

Erstellt von DL-Redaktion am 30. Oktober 2019

Ein halbes Jahrhundert Zögern und Leugnen

Heizkraftwerk Nord/Süd von Ostsüdost

Quelle       :  INFOsperber CH.

Von   Tobias Tscherrig

Industrie und Politik sind seit Jahrzehnten vor der Klimakrise gewarnt. Sie reagierten mit Ignoranz und Verleugnung.

Seit mehr als 50 Jahren werden die Mineralölindustrie und die Politik vor der Verbrennung fossiler Brennstoffe und den entsprechenden negativen Auswirkungen auf das Klima gewarnt. Statt sich zu ändern, expandiert die Industrie fleissig weiter: Heute sind zwanzig Unternehmen für ein Drittel der weltweiten CO2-Emissionen verantwortlich.

Der «Guardian» veröffentlichte eine beeindruckende Zeitleiste, die zeigt, wer wann von dem Einfluss des CO2 auf das Klima wusste – und wie die unliebsamen Tatsachen systematisch verleugnet wurden.

  • 1959: Der Physiker Edward Teller erklärt dem American Petroleum Institute (API), dass ein Anstieg des CO2 um zehn Prozent ausreicht, um die Eiskappe zu schmelzen und New York unter Wasser zu setzen. Er sagt: «Ich denke, dass diese chemische Kontamination ernster ist, als die meisten Leute glauben.»
  • 1965: Der wissenschaftliche Beirat von Präsident Lyndon Johnson stellt fest, dass «Schadstoffe den Kohlendioxidgehalt der Luft weltweit verändert haben». Mit Auswirkungen, die «aus Sicht des Menschen schädlich sein könnten». Zusammenfassend dargestellt, wurde die Industrie gewarnt: «Die Zeit läuft ab.»
  • 1970: Shell und BP beginnen mit der Finanzierung wissenschaftlicher Forschung in Grossbritannien, um die Klimaauswirkungen von Treibhausgasen zu untersuchen.
  • 1977: Wissenschaftlerinnen und Wissenschaftler von Exxon teilen dem Management mit, dass ein «überwältigender» Konsens darüber besteht, dass fossile Brennstoffe für den Anstieg des atmosphärischen Kohlendioxids verantwortlich sind.
  • 1981: Ein internes Exxon-Memo warnt: «Es ist durchaus möglich», dass die CO2-Emissionen aus dem 50-Jahres-Plan des Unternehmens zumindest für einen Teil der Weltbevölkerung «später katastrophale Auswirkungen haben werden».
  • 1988: Der NASA-Wissenschaftler James Hansen bezeugt vor dem US-Senat, dass der «Treibhauseffekt erkannt wurde und unser Klima jetzt verändert». In der US-Präsidentschaftskampagne sagt George Bush senior: «Diejenigen, die denken, dass wir machtlos sind, etwas gegen den Treibhauseffekt zu tun, vergessen den Effekt des Weissen Hauses. (…) Als Präsident beabsichtige ich, etwas dagegen zu unternehmen.»
  • 1988: Ein vertraulicher Bericht, der für den Umweltschutzausschuss von Shell erstellt wurde, geht davon aus, dass CO2 die Temperaturen in den nächsten 40 Jahren um 1 bis 2 Grad Celsius erhöhen könnte, wobei die Veränderungen «die grössten in der Geschichte» sein könnten. Er fordert ein rasches Handeln der Energiewirtschaft. «Bis die globale Erwärmung erkennbar wird, könnte es zu spät sein, wirksame Gegenmassnahmen zu ergreifen, um die Auswirkungen zu reduzieren oder sogar die Situation zu stabilisieren.»
  • 1989: US-Industriegruppen gründen die Global Climate Coalition (GCC), eine Lobbying-Gruppe, die wissenschaftliche Erkenntnisse über die globale Erwärmung bestreitet und Massnahmen zur Emissionsminderung verzögert. Exxon, Shell und BP schliessen sich zwischen den Jahren 1993 und 1994 an.
  • 1990: Exxon bezahlt die zwei Forscher Fred Seitz und Fred Singer, die den Mainstream-Konsens in der Klimaforschung in Frage stellen. Beide wurden zuvor von der Tabakindustrie bezahlt und stellten die Gefahren des Rauchens in Frage. Singer, der bestritten hat, auf der Gehaltsliste der Tabak- oder Energieindustrie zu stehen, sagte, dass seine finanziellen Beziehungen seine Forschung nicht beeinflussen würden.
  • 1991: Shells Informationsfilm «Climate of Concern» anerkennt, dass es eine «Möglichkeit» gibt, dass sich das Klima schneller als jemals zuvor seit dem Ende der Eiszeit verändern kann. Vielleicht so schnell, dass sich das Leben nicht ohne Dislokation anpassen kann.
  • 1992: Am Gipfel von Rio Earth unterzeichnen die teilnehmenden Länder das weltweit erste internationale Abkommen zur Stabilisierung der Treibhausgase und zur Verhinderung einer gefährlichen, vom Menschen verursachten Störung des Klimasystems. Damit wird das Rahmenübereinkommen der Vereinten Nationen über Klimaänderungen festgelegt. Bush senior sagt: «Die USA wollen beim Schutz der globalen Umwelt weltweit führend sein.»
  • 1997: Zwei Monate vor der Klimakonferenz von Kyoto schaltet Mobil (später fusioniert mit Exxon) in der New York Times eine Anzeige mit dem Titel «Reset the Alarm». Die Aussage: «Seien wir ehrlich: Die Wissenschaft des Klimawandels ist zu unsicher, um einen Aktionsplan zu verlangen, der die Wirtschaft in Aufruhr versetzen könnte».
  • 1998: Die USA weigern sich, das Kyoto-Protokoll zu ratifizieren, nachdem die Ölgesellschaften und der GCC heftigen Widerstand geleistet haben.
  • 2009: Der US-Senator Jim Inhofe, dessen Geldgeber die Öl- und Gasindustrie sind, leitet den «Climategate»-Fehlinformationsangriff auf Wissenschaftler am Eröffnungstag der entscheidenden UN-Klimakonferenz in Kopenhagen.
  • 2013: Eine Studie von Richard Heede, die in der Zeitschrift Climatic Change veröffentlicht wurde, zeigt, dass 90 Unternehmen für die Produktion von zwei Dritteln des CO2 verantwortlich sind, der seit Beginn des Industriezeitalters in die Atmosphäre gelangt ist.
  • 2016: Nach Kritik der Öffentlichkeit entfernt die API auf ihrer Website den Satz, wonach der menschliche Beitrag zum Klimawandel «ungewiss» sei.
  • 2017: Exxon, Chevron und BP spenden jeweils mindestens 500’000 US-Dollar, damit die Amtseinführung des jetzigen US-Präsidenten Donald Trump möglich wird.
  • 2019: Opec-Generalsekretär Mohammed Barkindo sagt, dass Klimaaktivisten die grösste Bedrohung für die Industrie sind. Weiter behauptet er, dass sie die Öffentlichkeit mit unwissenschaftlichen Warnungen vor der globalen Erwärmung irreführen.

Welche Konzerne besonders in der Verantwortung stehen

Die folgenden 20 Konzerne haben weltweit 35 Prozent zu allen energiebedingten Kohlendioxid- und Methanemissionen beigetragen. Das entspricht seit dem Jahr 1965 480 Milliarden Tonnen Kohlendioxid.

Angaben in Milliarden Tonnen Kohlendioxid, 1965 – 2017:

Die grössten CO2-Schleudern
Saudi Aramvo 59,26
Chevron 43,35
Gazprom 43,23
ExxonMobil 41,90
National Iranian Oil Co 35,66
BP 34.02
Royal Dutch Shell 31,95
Coal India 23,12
Pemex 22,65
Petróleos de Venezuela 15,75
PetroChina 15,63
Peabody Energy 15,39
ConocoPhillips 15,23
Abu Dhabi National Oil Co 13,84
Kuwait Petroleum Corp 13,48
Iraq National Oil Co 12,60
Total SA 12,35
Sonatrach 12,30
BHP Billiton 9,80
Petrobras 8,68

 

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

Wie Energiekonzerne den Klimawandel vertuschen – Die geheimen Machenschaften der Ölindustrie

YouTube

Am 29.04.2018 veröffentlicht

WDR Die Story 18.04.2018

—————————————————————-

Grafikquelle        :           Heizkraftwerk Nord/Süd von Ostsüdost

Abgelegt unter International, Medien, Regierung, Umwelt | Keine Kommentare »

Späte Nach – Geburt

Erstellt von DL-Redaktion am 29. Oktober 2019

Wasser hier, Stroh-Rum da

Kristina Schröder 2013-01-16.jpg

Von Jürn Kruse

Kristina Schröder, Bundesministerin a. D., hat sich in ihrer letzten Welt-Kolumne den Fridays for Future und dem Thema Verzicht gewidmet: „Fundamentaler Fehler von #FridaysForFuture ist Glaube, wir könnten ökologische Probleme durch #Verzicht lösen. Der Mensch wird aber nicht bereit sein, auf individuelle Mobilität oder aufs Fliegen zu verzichten. Nur technologische Lösungen funktionieren“, pries sie ihren Text bei Twitter an. Zur Sicherheit: Sic! Klar, Fridays for Future doof zu finden, ist ein Distinktionsmerkmal, um im Kolumnist*innen-Abklingbecken mitschwimmen zu dürfen. Aber mir gehen diese Narrative, die Schröder und andere permanent verbreiten, zunehmend auf den Keks:

1.) Tut doch alle nicht so, als sei Verzicht zugunsten der Umwelt durch Fridays for Future in die Welt gekommen. Müll zu vermeiden, Wasser zu sparen, lieber Rad zu fahren – das stand in meiner Kindheit schon in jedem Yps-Heft und in jeder Micky Maus. Nur fanden die Erwachsenen zwar Öko-Kinder irgendwie niedlich, haben ihnen dann aber doch einen Lebensstil vorgelebt, der den Kleinen diesen Umweltscheiß schnell wieder austrieb. Also erst Wasser gepredigt, dann Stroh-Rum gesoffen.

Greta Thunberg 4.jpg

2.) Und heute wird dann den Kindern vorgeworfen, dass sie ja genauso seien wie die Erwachsenen. Natürlich darf bei Schröder an dieser Stelle der Hinweis auf die „bizarre Tour von Greta über den Atlantik zum UN-Klimagipfel“ nicht fehlen, inklusive der Rückreise der Skipper. Im Flugzeug! Das erinnert mich an die Lehrerin, die irgendwelche plastikvermeidenden Sechstklässler fragte, ob sie auch aufs Smartphone verzichten würden. Da waren die baff, erzählte die Lehrerin stolz. Glückwunsch, du hast Elfjährige aufs Kreuz gelegt. Dabei waren es nicht die Kinder, die diese iPhone-Easyjet-Welt erfunden haben. Wir haben sie dort hineingeboren – und jetzt, da sie dieses Leben infrage stellen, halten Erwachsene den Jugendlichen vor, dass sie auch nicht viel besser seien. Wieder: Wasser hier, Stroh-Rum da.

Quelle           :            TAZ             >>>>>           weiterlesen

———————————————————————

Grafikquellen            :

Oben         —        Kristina Schröder, Bundesministerin für Familie, Senioren, Frauen und Jugend, aufgenommen am 16.01.2013.

————————

Unten            —           In August 2018, outside the Swedish parliament building, Greta Thunberg started a school strike for the climate. Her sign reads, “Skolstrejk för klimatet,” meaning, “school strike for climate”.

Abgelegt unter Hessen, International, P.CDU / CSU, Umwelt | Keine Kommentare »

Soja, „Gold“ der Pampa.

Erstellt von DL-Redaktion am 27. Oktober 2019

Ein Riss geht durch Argentinien

Von José Natanson

Das wirtschaftliche Scheitern von Präsident Macri ist spektakulär. Deshalb hat bei den Wahlen am 27. Oktober das peronistische Lager der linken Mitte mit Ex-Präsidentin Kirchner als Vize die besten Aussichten, wieder die Regierung zu übernehmen. Deren erste und dringlichste Aufgabe wäre die Neuverhandlung der Staatsschulden.

Am Morgen des 18. Mai, um 9 Uhr 20, lief das Telefon von Alberto Fernández heiß. Innerhalb von zehn Minuten zeigte sein Smartphone mehr als hundert ungelesene Whatsapp-Nachrichten an, ein Anruf folgte auf den nächsten. Es waren Verzichtserklärungen ­seiner peronistischen Mitbewerber für die Spitzenkandidatur, und Gewerkschaftsführer, Geschäftsleute, Intellektuelle und Gouverneure, die bis dahin über ihre Präferenzen geschwiegen hatten, versprachen ihn zu unterstützen. Alle stellten sich hinter ihn, als folgten sie einer spontanen Choreografie.

Die große Nachricht einige Minuten zuvor, die das politische Szenario radikal veränderte und die Präsidentschaftswahlen entscheidend prägen sollte, kam allerdings nicht von Alberto Fernández selbst, sondern von Cristina Kirchner.

Die Ex-Präsidentin (2007–2015) und Anführerin der wichtigsten peronistischen Gruppierung war bis zu diesem Zeitpunkt die prominenteste Kandidatin; doch dann beschloss sie, sich hinter Fernández als mögliche Vizepräsidentin in die zweite Reihe zu stellen.

Bis dahin war der Wahlkampf auf eine Neuauflage des früheren Duells zwischen der Linksperonistin Kirchner und dem neoliberalen Präsidenten Mauricio Macri zugesteuert. In den Umfragen führte Cristina Kirchner mit einem Drittel der Wählerstimmen. Doch es gab ein Problem: So groß die Unterstützung für sie als Person war, so stark war gleichzeitig die Ablehnung gegen sie als Politikerin.

Diese Hassliebe – die Argentinier sagen „la grieta“ (der Riss) – geht zurück auf das Jahr 2008. Damals traf die Präsidentin, die ihrem Mann Nestor Kirchner im Amt nachgefolgt war, eine in der Folge höchst umstrittene Entscheidung in Sachen Agrarpolitik: Cristina Kirchner wollte die Exportsteuern auf Sojabohnen und Getreide erhöhen.

Agrobusiness gegen Linksperonisten

Wie die anderen lateinamerikanische Länder exportiert Argentinien vor allem Rohstoffe. Dabei ist das Land nicht – wie Venezuela, Peru oder Chile – reich an Erdöl oder Mineralien, sondern der Wohlstand beruht auf Soja, dem „grünen Gold“ der Pampa.

Argentinien ist weltweit der zweitgrößte Sojaexporteur. Mitten im Superboom der Rohstoffe, als eine Tonne Soja auf dem Weltmarkt über 600 Dollar kostete (heute sind es 300 Dollar), befand Cristina Kirchner, es sei an der Zeit, mehr von der „Superrendite“ des mächtigen Agrarsektors einzubehalten, um den Staat zu stärken, die Sozialpolitik voranzutreiben und die einheimische Industrie zu fördern.

Allerdings unterschätzte sie, welche Reaktionen das in den betroffenen Regionen hervorrufen würde. Cristina Kirchners Regierung hatte eine Vorstellung vom ländlichen Raum, die längst überholt war. Sie glaubte, es mit quasifeudalen Strukturen zu tun zu haben, mit Großgrundbesitzern und Tagelöhnern. In Wirklichkeit aber war der Agrarsektor längst in der Globalisierung angekommen. Dort war nicht nur viel ausländisches Kapital im Spiel, es war auch eine breite ländliche Mittelschicht entstanden, die enge Beziehungen zur Finanzwelt, zur Industrie und zu den Medien pflegte.

„Der landwirtschaftliche Sektor ist keineswegs mehr traditionalistisch und rückständig“, erklärt die auf rurale Themen spezialisierte Soziologin Carla Gras.1 Der ländliche Raum (el campo) habe eine große Modernisierung und technologische Neuerungen erfahren. „Heute stehen diese Regionen für Wettbewerbsfähigkeit und Dynamik. Sie mussten zwangsläufig über kurz oder lang auch politisches Gewicht bekommen.“1

File:Glycine soja 5.JPG

Auf die geplante Steuererhöhung von Cristina Kirchner reagierten die Agrarunternehmer mit Straßensperren und Lieferstopps von Lebensmitteln. Drei Monate dauerte der Protest an, und am Ende setzten sich die Agrarinteressen im Kongress durch. Cristina Kirchner erholte sich zwar von dieser Niederlage und wurde 2011 wiedergewählt, doch der politische Riss war da. Die Polarisierung verstärkte sich sogar noch, denn der Konflikt, der in dem Steuerstreit hochkochte, liegt tiefer. Er ist Ausdruck eines langen historischen

Konflikts zwischen zwei politischen Lagern: Da ist auf der einen Seite der Kirchnerismus, der in den verarmten Ballungszentren und den vernachlässigten Provinzen des Nordens und Patagoniens verwurzelt ist. Er spricht die Arbeiter und Armen an, hat aber auch Anhänger in der progressiven Mittelschicht und der jüngeren Generation, die sich in Rückbesinnung auf die erste Phase des Peronismus (1945–1955) für eine heterodoxe Wirtschaftspolitik einsetzt, mit einem starken Binnenmarkt, hohen Löhnen und einem starken Staat.

Dem gegenüber steht der Macrismus als eine Weiterführung des klassischen antiperonistischen Liberalismus ins 21. Jahrhundert. Seine Hochburgen sind die Pampa und die wohlhabenden Viertel der Großstädte. Er steht für eine deregulierte und offene Wirtschaft, Steuersenkungen, mehr Marktmacht und weniger Einfluss des Staats.

Kirchnerismus und Macrismus haben jeweils etwa ein Drittel der Wählerschaft hinter sich. Der Rest ist unentschieden und nicht auf eines der Lager festgelegt. An diesen Wechselwählern hängt das politische Schicksal Argentiniens. Was als „Riss“ bezeichnet wird, sei in Wahrheit aber eine politische Strategie, die darauf abziele, das nicht festgelegte Drittel, die „mächtige Minderheit“, zu gewinnen, meint Martín Rodríguez, Autor einer umfassenden Analyse zu diesem Thema.2

„Diese Strategie verfolgte Cristina Kirchner nach ihrem politischen Scheitern bei der Landbevölkerung und später auch Macri. Wer das unentschiedene Drittel hinter sich bringt, dominiert den Wahlkampf und gewinnt die Wahlen.“ Eines aber gelinge mit dieser Strategie gewiss nicht, sagt Rodríguez: „Einschneidende und dauerhafte Veränderungen herbeizuführen.“

Diese Überlegungen stehen auch hinter Cristina Kirchners Entscheidung, Alberto Fernández zu ihrem Kandidaten zu küren: Obwohl sie das stabile Drittel an Kirchner-Anhängern nach wie vor hinter sich vereint, steht sie auch für den Riss, der die Peronisten entzweit und eine breitere Koali­tion unmöglich macht. Viele peronistische Gouverneure, Bürgermeister und Anführer von Organisationen lehnen eine weitere Amtsperiode Cristina Kirchners ab, denn gerade unter den konservativeren der peronistischen Wähler stößt sie auf Ablehnung.

Deshalb hat sie mit Alberto Fernández einen gemäßigten Frontmann gewählt, der versöhnliche Töne anschlägt. Fernández war Kabinettschef unter Néstor Kirchner und später unter Cristina Kirchner, mit der er nicht immer auf einer Linie war. So übte er harsche Kritik an der Kirchner’schen Landwirtschaftspolitik.

Mit fast 50 Prozent der Stimmen gegenüber 32 Prozent für Mauricio Macri hat sich das Duo aus Verstand (Alberto Fernández) und Gefühl (Cristina Kirchner) bei den Vorwahlen – wo die Kandidaten eine Mindestanzahl an Stimmen erhalten müssen, um zur Wahl antreten zu dürfen – am 12. August durchgesetzt und steuert auf einen erdrutschartigen Sieg bei den Präsidentschafts- und Parlamentswahlen am 27. Oktober zu.

Das Scheitern der Regierung ­Macri ist vor allem auf ihre wirtschaftspolitischen Fehleinschätzungen zurückzuführen. Der Macrismus ging davon aus, dass er nach Jahren des „kirchnerischen Populismus“ mit einem relativ simplen Programm erfolgreich sein würde: die Wirtschaft deregulieren, für einen freien Kapitalfluss sorgen und den staatlichen Einfluss minimieren, dazu einige „marktfreundliche“ Signale in Richtung Finanzmärkte senden und sich den westlichen Großmächten annähern. Dann würde ganz automatisch ein „Investitionsregen“ (so war die gebräuchliche meteorologische Metapher) auf das Land niedergehen und einen Exportboom auslösen. Der Kreislauf von Wachstum, Beschäftigung und Wohlstand würde wieder in Gang kommen.

Doch es funktionierte nicht. Ausländische Investitionen blieben aus, und die Exporte verharrten auf dem gleichen Niveau wie unter Kirchner. Einen Rekord allerdings kann Macris liberale Regierung verzeichnen: Die Inflation ist nun die zweithöchste in der Region – nach der in Venezuela.

Fichier:Juliana Awada, Mirtha Legrand, and Mauricio Macri, June 2013.jpg

Macris Fehler bestand vor allem darin, dass er die globale Situation nicht richtig erfasste: Anders als zu früheren Zeiten, als neoliberale Experimente – wie im Chile der 1970er Jahre oder im Argentinien der 1990er Jahre – durchaus Erfolg hatten, geht das Wachstum der Weltwirtschaft derzeit zurück, der Handel schwächelt, und der Handelskrieg zwischen China und den Vereinigten Staaten befördert einen neuen Protektionismus. Die Nachfrage an den Rohstoffmärkten sinkt.

Ohne ausländische Investitionen und ohne den erwarteten Exportboom konnte die Regierung Macri ihr Programm nur aufrechterhalten, indem sie immer mehr Schulden aufnahm, bis die Finanzmärkte im Mai 2018 dem einen Riegel vorschoben. In der Folge wandte Macri sich an die einzige ihm noch verbliebene Finanzierungsquelle: den Internationalen Währungsfonds (IWF). Mit Unterstützung von Donald Trump, zu dem der argentinische Präsident seit den Zeiten, als beide in der internationalen Immobilienbranche tätig waren, eine persönliche Beziehung unterhält, erwirkte er ein 57 Milliarden Dollar schweres Stand-by-Programm, das umfangreichste in der Geschichte des IWF.3

Quelle       :      Le Monde diplomatique          >>>>>          weiterlesen

———————————————————————-

Grafikquellen     :

Oben         —        Argentière Glacier

 

Checked copyright icon.svg Cette image, qui provient de Flickr, a été importée sur Commons à l’aide du Flickr upload bot le par Bleff. À cette date, elle était publiée sous la licence suivante.
paternité Ce fichier est disponible selon les termes de la licence Creative Commons Attribution 2.0 Générique.

 

Abgelegt unter Amerika, Ernährungspolitik, Kultur, Umwelt | Keine Kommentare »

Zur Geschichte des Landes

Erstellt von DL-Redaktion am 26. Oktober 2019

Honduras: Was ist eigentlich eine Banenrepublik?

Quelle        :    untergrund-blättle CH.

Von    Amelie Lanier

Honduras hätte eigentlich alles, um seine Bewohner zu versorgen: Berge und fruchtbare Ebenen, und Küsten an zwei Weltmeeren, die Fischfang und Handel ermöglichen.

Und vor der Ankunft der Spanier funktionierte das auch so, wie die Schriften des Chronisten der Conquista, Bartolomé de Las Casas, bezeugen. Denen zufolge lebten in Mittelamerika damals ähnlich viele Leute wie in den 50-er Jahren des 20. Jahrhunderts, und lebten mehr oder weniger friedlich vor sich hin.

Dennoch ist Honduras heute eines der ärmsten Länder Lateinamerikas. Die reichlich gebende Natur wird offenbar vor allem für den Anbau der sattsam bekannten Bananen in Anspruch genommen, neben einigen anderen Cash Crops. Für die Grundnahrungsmittel bleibt deshalb zu wenig Anbaufläche übrig.

Die Geschichte Honduras’ vor der Banane

Im Unterschied zu anderen Staaten Mittelamerikas wurden in Honduras in der Kolonialzeit Gold und Silber abgebaut. Zu diesem Zweck wurden auch schwarze Sklaven importiert, da die einheimische Bevölkerung den Strapazen des Bergbau nicht gewachsen war und sich durch den Arbeitszwang rapide verringerte.

Im Laufe der folgenden Jahrhunderte erschöpften sich diese Vorkommen und bis ins 19. Jahrhundert war die Gegend ökonomisch bedeutungslos für das Spanische Kolonialreich geworden. Die Unabhängigkeitskriege in Mittelamerika spielten sich daher im Schlepptau der wirklich grossen Auseinandersetzungen mit den spanischen Heeren im heutigen Mexiko und Südamerika ab, und waren vor allem Schlachten und Kriege der verschiedenen lokalen Feudalherren und Militärs gegeneinander.

Nach verschiedenen Versuchen, einen mittelamerikanischen Gesamtstaat zu schaffen, der vor allem von Grossgrundbesitzern aus dem Territorium des heutigen Guatemala hintertrieben wurde, konstituierte sich Honduras als selbständiger Staat. Es folgten Jahrzehnte des Kampfes der städtisch-bürgerlichen Schichten gegen Grossgrundbesitz und Kirche. Der „Pfaffenkrieg“ führte zur Ermordung des antiklerikalen Präsidenten Santos Guardiola im Jahr 1862.

Erst unter diesem Präsidenten kam jedoch die heutige territoriale Einheit von Honduras zustande, als mit Hilfe der USA die Karibikküste und die Inseln der Bahia von britischen Okkupanten und Abenteurern gesäubert und der honduranischen Oberhoheit unterstellt wurden. Noch bis weit ins 20. Jahrhundert versuchten die englischsprechenden Bewohner dieser Gegenden, sich dem Schutz der britischen Krone zu unterstellen, erhoben Spezialsteuern auf honduranische Produkte usw. Die Bahía-Inseln waren insofern bedeutend für die Entwicklung von Honduras, als sich hier die ersten Bananenplantagen entwickelten und der Bananenhandel mit den USA begann, über eine Firma aus New Orleans.

Bananen, Eisenbahn und Schulden

Die Ausweitung der Bananenproduktion ist eng verbunden mit dem Eisenbahnbau in Honduras. Im 19. Jahrhundert gab es mehrmals Anläufe verschiedener Regierungen zur Erschliessung des nationalen Territoriums mittels einer Eisenbahnverbindung von Nord nach Süd, von der Karibikküste zum Golf von Fonseca.

Mittels Aufnahme von Krediten bei französischen und britischen Bankhäusern, über dunkle Mittelsmänner, die teilweise in ebenso dunklen Kanälen versickerten, wurden von 19867 bis 1870 einige Eisenbahnkilometer gebaut und Lokomotiven angeschafft, eine notwendige Brücke kam nicht zustande und die ganze Unternehmung krachte bald.

Zurück blieb ein Haufen Schulden unklarer Herkunft, deren Handhabung den Ruf von Honduras auf dem internationalen Kreditmarkt beschädigte, sodass seine Regierungen von da ab nicht kreditwürdig waren. China plant in neuerer Zeit abermals eine interozeanische Eisenbahnlinie in Honduras, als Alternative zum Panamakanal, aber sehr weit ist dieses Projekt derzeit noch nicht gediehen.

Der Bananenanbau- und Export entwickelte sich zunächst klein-klein – viele kleine und mittlere Landbesitzer kultivierten die Bananen und brachten sie irgendwie mit Last- und Zugtieren und über Flüsse an die Häfen der Atlantikküste, wo sie auf Schiffe geladen wurden, die Richtung USA, genau: nach New Orleans fuhren.

Die Zentralisierung kam zunächst über den Handel. Ausgehend vom Eisenbahnbau und der Not, die Eisenbahn auszulasten, entstand 1899 die United Fruit Company und der Vorläufer der Standard Fruit Company, beide in New Orleans. Um den Transport voranzubringen und so die Lieferwege schneller und sicherer zu machen, setzten sie auf die Eisenbahn. Die beiden Handelsgesellschaften finanzierten den Eisenbahnbau entlang der Karibikküste. Da Honduras nichts zahlen konnte, erhielten die Obstexport-Firmen grosse Territorien zum Gebrauch unentgeltlich überlassen, auch wenn es dort bereits Bananenpflanzer gab. Die konnten gehen. Ebenso erhielten die US-Firmen Steuer- und Abgabenfreiheit.

Quellbild anzeigen

Für entsprechende Zahlungen verzichteten also verschiedene honduranische Präsidenten ab 1900 praktisch auf Teile ihres Territoriums. Dafür stellten gewisse Zahlungen der Obstfirmen eine Konstante für die Alimentierung diverser Regierungen dar, die Kooperation florierte.

Damals entstand, zumächst nur für Honduras, der Begriff der Bananenrepublik: Damit werden Staaten bezeichnet, deren Regierungen Land und Leute an Privatunternehmen verkaufen und daraus ihre Einkünfte beziehen. Die Souveränität dieser Staaten gleicht also der eines Art Hausmeisters, oder Forstverwalters, der die ausländischen Unternehmen in sein Haus oder auf sein Jagdgebiet lässt und dafür entlohnt wird.

Auch der Gewaltapparat solcher Staaten ist auf die Sicherung dieses Geschäftsmodells abgestellt. Den Bananenarbeitern gelang es im Verlaufe eines 1954 durchgeführten Streiks nur deshalb, den Obstfirmen einige Zugeständnisse abzuringen, weil das honduranische Militär damals damit beschäftigt war, beim Sturz des Präsidenten des Nachbarlandes mitzuhelfen.

Diese Harmonie zwischen ausländischen Gesellschaften, Militär und Regierung ist sehr brüchig, weil es immer sehr viele Aspiranten auf den doch relativ lukrativen Hausmeisterposten gibt, und auch hin und wieder Militärs und Politiker auftreten, denen dieses Modell nicht zusagt. Die USA mussten daher in Honduras öfter eingreifen, mit Kriegsschiffen, Bodentruppen und Diplomatie, um die US-Interessen zu schützen und für eine funktionierende Staatsgewalt vor Ort zu sorgen.

Das Militär

Zum oben beschriebenen Modell der Bananenrepublik gehört ein gut funktionierendes Militär. Die Eliten von Honduras achteten darauf, dass da nichts anbrannte. Zunächst benötigte Honduras sein Militär für die Unabhängigkeits- Separations- und Einmischungskriege gegenüber seinen Nachbarstaaten.

Dann wurde das Militär zu einem Element der Kontinuität der Staatsgewalt und einem Instrument der Sicherung des sozialen Friedens. Um diese Funktion auch erfüllen zu können, wurde erstens das Militär an staatlichen Versorgungsunternehmen beteiligt, um eine gesicherte Einnahmequelle unabhängig von der zeitweise leeren Staatskasse zu haben.

Ausserdem war der Wehrdienst jahrzehntelang verpflichtend. Das sah so aus, dass die Rekrutierungs-Kommissionen in die Schulen gingen und dort die Halbwüchsigen mitnahmen. Viele der Rekruten waren also minderjährig, Kindersoldaten, und besonders abhängig und formbar durch die Offiziere.

Dass es für wirkliche Kriegshandlungen gegenüber einem gleichermassen bewaffneten Gegner wenig taugt, erwies der Krieg der 100 Stunden gegen das weitaus kleinere El Salvador. Nur mit grosser Mühe und der Vermittlung anderer lateinamerikanischer Staaten gelang es Honduras, die salvadorianische Invasion zu stoppen und die Truppen zum Verlassen honduranischen Territoriums zu veranlassen.

Möglicherweise durch diese ernüchternde Erfahrung wurde das honduranische Militär in der Folge zum engsten Verbündeten der USA in Mittelamerika. Schon beim Sturz von Arbenz in Guatemala hatte sich Honduras als Hinterland für US-Operationen angedient. In den 80-er Jahren, nach dem Sieg der Sandinisten in Nicaragua, wurde Honduras zu einer Basis für die Contra-Ausbildung und deren Ausrüstung und Einsatz zur Terrorisierung der grenznahen Bevölkerung Nicaraguas.

Heute hat Honduras ein Berufsheer, mehrere US-Stützpunkte und das gesamte Territorium von Honduras ist für das US-Militär mehr oder weniger der Ersatz für die Panamakanalzone, die es um 2000 endgültig räumen musste. Das war auch der Hauptgrund für den Putsch gegen Zelaya 2009 – die USA wollten diese grosse Militärbasis nicht verlieren.

Das zivile Leben

Das Bananengeschäft hat seinen Zenit in Honduras schon lange überschritten. Der Hurrikan Mitch reduzierte 1998 die Bananenplantagen gewaltig, und bis sich die Pflanzungen etwas erholt hatten, war die Bananenindustrie weitergezogen und hatte sich andere Anbaugebiete erschlossen.

Hier kam auch die einseitige agrarische Entwicklung ins Spiel: Honduras hatte seine ganze Infrastruktur rund um den Bananentransport aufgebaut. Die Nordwestküste, die Häfen von Puerto Cortés und Ceiba, das Hinterland um San Pedro Sula und noch einige Gegenden waren durch Strassen und Eisenbahnen miteinander verbunden, um die Bananen abtransportieren zu können. Verwendbares Land für Anbau hätte es zwar woanders auch gegeben, aber die Transportmöglichkeiten fehlten.

Obwohl Honduras über grosse unerschlossene Gebiete verfügt, sind die weder für die Agrarwirtschaft noch für die Subsistenzbauern zugänglich und liegen weiter brach. Sie lassen sich nicht militärisch kontrollieren, ihre Nutzung ist daher auch von der Obrigkeit her nicht vorgesehen und wird nicht gefördert.

Honduras hat daher eine relativ grosse Bevölkerung von Landlosen, die in den Armenvierteln der beiden grossen Städte San Pedro Sula und der Hauptstadt Tegucigalpa vor sich hingammeln und von Gelegenheitsarbeiten und Kriminalität leben, und auf der anderen Seite grosse leere Gebiete, die aus den oben beschriebenen Gründen nicht zueinander kommen (können).

Das letzte Mal, als Teile dieser Urwälder & Sümpfe irgendwie benützt wurden, war für die Bekämpfung der sandinistischen Revolution.

Die Contras

Den Kern der Contras, also nicaraguanischen Konterrevolutionäre, bildeten die nach Honduras geflüchteten Mitglieder der Nationalgarde, der mehr oder weniger persönlichen Schlägertruppe der Familie Somoza, die von den USA auch seinerzeit gut ausgerüstet worden waren, um die Herrschaft in der Bananenrepublik Nicaragua aufrechtzuerhalten.

Als Garanten des Systems Somoza waren sie Mitglied der Elite und gut bezahlt, der Sieg des Sandinismus stellte daher einen beträchtlichen Statusverlust dar. Sie waren zu allem bereit, um wieder in ihre vorherige beherrschende Stellung zurückkehren zu können. Zu diesen Mitgliedern der Nationalgarde gehörten auch diejenigen Leute, die das Privat-KZ der Somozas neben dem Präsidentenpalast betrieben hatten und dort Oppositionelle gefoltert und zu Tode gebracht hatten. Es waren, mit einem Wort, ziemlich schwere Burschen.

Nachdem Ronald Reagan Präsident geworden war, nahmen er und die CIA-Spitze sofort Kontakt mit deren Anführern auf und sagten ihnen alle nötige Unterstützung zu, um die Sandinisten wieder zu vertreiben. Dies bezog sich auf militärisches Gerät, Geld, Propaganda und auch militärischen Beistand: So besetzten wiederholt US-Kriegsschiffe nicaraguanische Hafeneinfahrten, um das Land am Import dringend benötigter Güter – Lebensmittel, Medizin und Waffen – oder Export zwecks Devisenbeschaffung zu hindern. Ausserdem wurden Werbekampagnen gestartet, um die Sandinisten zu einer Gefahr für die USA zu stilisieren, und die Contras zu Helden, die die USA vor ihnen beschützten.

Das Geld war ebenfalls wichtig, weil so konnten die Contras nicaraguanische Flüchtlinge oder auch honduranische Elendsgestalten rekrutieren, die zwar keine Ahnung davon hatten, was die Sandinisten vorhatten, und warum sie sie bekämpfen sollten, aber für die eine Versorgung und Sold eine willkommene Einkommensquelle darstellten. Die Contra-Armee wuchs dadurch beträchtlich an.

File:Small Convenience Store in Tegucigalpa, Honduras.jpg

Die honduranischen Präsidenten Policarpo Paz García und Roberto Suazo Córdova stellten gerne honduranisches Gebiet und Militärinstallationen für diese „Mission“ zur Verfügung, da für die Staatskasse und auch einige private Kassen dabei einiges abfiel, und im Vorübergehen auch etwaige einheimische Subversion erledigt wurde. Da der US-Kongress die Unterstützung dieser Mörder- und Foltertruppe, die in Nicaragua eine Politik der verbrannten Erde betrieben, einstellte, boten der CIA und die US-Regierung einiges an Einfallsreichtum auf, um diese Henker weiter zu finanzieren, was später als Iran-Contras-Skandal die Öffentlichkeit und die Gerichte beschäftigte.

Die Enthüllungen um die illegale Finanzierung und der Wahlsieg der antisandinistischen Partei UNO und die Amtseinführung der Präsidentin Violeta Chamorro führten zur schrittweisen Einstellung der Unterstützung, der Entwaffnung und der Integration in die Streitkräfte Nicaraguas. Diese „Versöhnung“ wurde auch mit viel Pomp und Glorie öffentlich-wirksam gefeiert, mit einer „Friedenshauptstadt“ und Waffenabgaben im Blitzlichtgewitter. Für die Öffentlichkeit war also alles in Butter.

Es ist allerdings naiv, anzunehmen, dass Leute, die nachweislich ganze Dörfer niedergebrannt und ihre Einwohner allen Alters und Geschlechts in Stücke gehaut hatten, sich ohne weitere Reibungen in das Militär und die Gesellschaft einreihen würden, die sie bisher mit dergleichen Methoden bekämpft hatten.

Die meisten „Contras“ konnten bzw. wollten daher nicht nach Nicaragua zurückkehren. Das Risiko war gross, dass jemand mit ihnen ähnlich verfahren würde, wie sie seinerzeit mit ihren Gegnern. Sie gaben auch ihre Waffen nicht ab, oder sie besorgten sich schnell neue. Sie blieben in Honduras und bildeten Banden, dienten sich als Drogentransporteure an und hoben dort das Kriminalitätsniveau an. Später schlossen sie sich mit Kriminellen aus El Salvador zusammen, und langsam versank ganz Honduras, zumindest die dichter besiedelten und erschlossenen Teile davon, in dieser Bandenkriminalität.

Ende Juli beschimpfte Trump den schwarzen demokratischen Bürgermeister der Stadt Baltimore mit den Worten, seine Stadt sei schlimmer als Honduras.

Dazu veröffentlichte der Standard am 31.7. folgende Zahlen:

„Nach Angaben der US-Bundespolizei FBI lag die Mordrate in Baltimore im Jahr 2017 bei 55,8 pro 100.000 Einwohner und damit hinter jener von St. Louis im Bundesstaat Missouri. Baltimore hat rund 600.000 Einwohner.

Im Neunmillionenland Honduras wurden 2018 insgesamt 41,2 Morde pro 100.000 Einwohner verzeichnet. Das honduranische San Pedro Sula ist einem Bericht der Interamerikanischen Entwicklungsbank (IDB) vom November zufolge eine der gewalttätigsten Städte der Welt. Die Mordrate lag dort demnach bei über 80 pro 100.000 Einwohner.“

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

———————————————————————-

Grafikquellen        :

Oben           —            Santa Lucia Honduraslugares

 ———————————–

2.) von Oben         _südküste_5-07. Photograph: Peggy

Author Hedwig Storch

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported, 2.5 Generic, 2.0 Generic and 1.0 Generic license.

———————

Unten      —         SAMSUNG CSC Small Convenience Store in Tegucigalpa, Honduras

Source https://www.flickr.com/photos/nanpalmero/13440740455/
Author Nan Palmero

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Abgelegt unter Amerika, Mensch, Regierung, Umwelt | Keine Kommentare »

Armut und Reichtum

Erstellt von DL-Redaktion am 23. Oktober 2019

Zieht doch nach Duisburg!

Sofienstraße - Karl-Morian-Straße, Duisburg-Neumühl, etwa 1976.jpg

von Utta Seidenspinner

Mit einem Mietendeckel will der rot-rot-grüne Berliner Senat die Hauptstädter entlasten: So sollen Vermieter nicht mehr als 30 Prozent des Haushaltseinkommens verlangen dürfen. Das aber geht am Problem vorbei, argumentiert die Journalistin Utta Seidenspinner. Wer Mieter schützen will, muss grundsätzlichere Lösungen finden.

„Ja, das möchste: / Eine Villa im Grünen mit großer Terrasse, / vorn die Ostsee, hinten die Friedrichstraße; / mit schöner Aussicht, ländlich-mondän, / vom Badezimmer ist die Zugspitze zu sehn – / aber abends zum Kino hast dus nicht weit. / Das Ganze schlicht, voller Bescheidenheit.“ So beschrieb Kurt Tucholsky 1927 das Berliner Ideal.

Frappierend aktuell, möchte man sagen. Alles wollen und auf nichts verzichten, so lautet derzeit die Devise der Berliner Politik: Mehr Wohnungen in der Hauptstadt der viertgrößten Wirtschaftsmacht der Welt fordern, aber bitte zum Preis von Görlitz. Erst in den 2000er Jahren die kommunalen Wohnungen verhökern, so das Stadtsäckel füllen und dann den Investoren die Schuld an der verfehlten Wohnungspolitik in die Schuhe schieben.

Warum so erbost? Weil hier mit der linken Bausenatorin Karin Lompscher eine Berliner Ballungsraum-Politikerin mit hilfloser Polemik auf jene Leute losgeht, die in den vergangenen Jahren überhaupt Wohnungen gebaut und saniert haben und es weiterhin tun sollen. Investoren aber können auch ausweichen. Und wer baut dann? Das notorisch klamme Berlin wohl kaum.

Der Job eines Investors hingegen ist es grundsätzlich, Geld zu verdienen. Wo er dieses Geld anlegt, ist seine Wahl. In Aktien, Rentenpapieren oder Immobilien. In Asien, USA oder Europa. Sein Kompass sind Kriterien wie Risiko, Aufwand, Zeithorizont und Rendite. Berlin hat soeben bei mindestens zwei der Kriterien – Risiko und Rendite – Alarm ausgelöst. Bei Mietern und damit bei den Wählern mag das gut ankommen. Mittel- und langfristig ist es aber kontraproduktiv, Investoren zu verschrecken.

Bewährt hat es sich in einer sozialen Marktwirtschaft vielmehr, Anreize zu schaffen, um Wünschenswertes zu fördern und Unerwünschtes zu verringern. Es geht darum, durchdachte, behutsame Prozesse anzustoßen, die über den Ballungsraum-Tellerrand hinausweisen müssen. Denn in vielen Teilen Deutschlands besteht das Problem in Leerstand und mangelnder öffentlicher Versorgung. Dort wäre man glücklich über jeden Investor.

Ganz ohne politische Eingriffe funktioniert es hierzulande allerdings ebenso wenig: In Zeiten des Neoliberalismus Anfang dieses Jahrhunderts wurde entschieden, es sei das Beste, wenn sich der Staat aus allem heraushält. Aber das geht nicht, wenn er sich vorher rund einhundert Jahre lang in alles eingemischt und gezielt ein Volk von Mietern gefördert hat. Die Politik hat bei uns mehr als anderswo die Verantwortung, sich um das Wohnen zu kümmern, es galt in Deutschland nämlich schon seit der Weimarer Republik als gesellschaftliche Aufgabe. Und da Menschen nicht in ein Vakuum hineingeboren werden, ist es zu Recht ihre Erwartungshaltung, dass man sie vor dem freien Spiel der Kräfte schützt.

Was also wären sinnvolle Maßnahmen, um die Auswüchse in den Ballungsräumen zu puffern?

»In fast der Hälfte der Sozialwohnungen leben Menschen, die sich eigentlich mehr Miete leisten könnten.«

Der Bau von Sozialwohnungen gehört nicht unbedingt dazu. Mit ihnen hat man nicht nur gute Erfahrungen gemacht. So ziehen Menschen zwar arm ein, bleiben es aber vielleicht nicht. Dann kommt es zu einer sogenannten Fehlbelegung, deren Quote derzeit bei 42 Prozent liegt. In fast der Hälfte dieser Wohnungen leben also Menschen, die sich eigentlich mehr Miete leisten könnten – auf Kosten der Allgemeinheit, die diese Wohnungen finanziert hat.

Industrienahe Experten plädieren daher gerne für ein höheres Wohngeld, um damit gezielt Menschen zu fördern: Subjektförderung (Mensch) statt Objektförderung (Immobilie). Das Frühjahrsgutachten der Immobilienwirtschaft warnt sogar ausdrücklich vor großen Sozialwohnungsprogrammen: „Für besonders gefährlich halten wir Mengenvorgaben der Politik, wie z. B. in Berlin. Die kommunalen Wohnungsbaugesellschaften sind hier darauf verpflichtet worden, ihren Wohnungsbestand durch Neubau und insbesondere Bestandskäufe um gut 100 000 Wohnungen zu erhöhen. Nicht nur, dass dies angesichts der überhöhten Preise hochspekulative Investitionen sind, die sich als Fehlinvestition mit öffentlichen Geldern herausstellen können. Noch ärgerlicher ist es, dass eine solche Politik die Preisspirale weiterdreht und es den Rückgang der Preise für Wohnungen und Wohnungsbauprojekte verzögert, wenn das Land Berlin zum ‚Buyer of last Resort‘ wird.“ Harald Simons vom Forschungsinstitut Empirica gibt überdies zu bedenken, dass 50 bis 60 Prozent aller städtischen Haushalte einen Anspruch auf geförderte Wohnungen hätten: „Und von denen gewinnen dann 5000 ein Los und alle anderen gehen leer aus. Das ist auch ungerecht.“ Auch er empfiehlt, den Markt sich selbst zu überlassen und Einkommensschwache direkt mit Geld zu unterstützen.

Einen anderen Vorschlag macht der Deutsche Städtetag. Er plädiert für eine Abkehr von der bisherigen Praxis, öffentliche Flächen meistbietend zu verkaufen. Denn wenn Höchstpreise für die Grundstücke bezahlt werden, bleibt Bauträgern gar nichts anderes übrig, als Luxuswohnungen zu errichten, damit sich die Investition lohnt. Und laut Bundesinstitut für Bau-, Stadt- und Raumforschung sind diese Grundstückskosten derzeit das größte Problem: Bei einem neuen Haus verschlingen sie inzwischen bis zu 70 Prozent des Budgets, in den großen Städten – aufgrund der dichteren Bebauung – immerhin noch durchschnittlich 30 bis 50 Prozent.

Die Preise für Bauland sind in den vergangenen Jahren so enorm gestiegen, dass die Spekulation damit größeren Gewinn verspricht, als tatsächlich zu bauen. Das Land wird gehortet und liegt brach. Dieses „Landbanking“ wird finanziell sogar gefördert, denn der Staat besteuert unbebautes Land niedriger als bebautes. Die Forderungen nach einer Umkehr dieser Logik werden lauter, ausnahmsweise sogar von Industrie und Politik gleichermaßen.[1]

Hans-Jochen Vogel, ehemals SPD-Oberbürgermeister von München, hat „Sorge, dass wir die Dinge weitertreiben lassen und damit die soziale Kluft in unserem Lande noch weiter verbreitern“. Er rechnet vor, dass die Grundstückspreise in München seit 1950 um stolze 69 000 Prozent gestiegen sind. Damals kostete Bauland (erschlossen und baulich nutzbar) 6 Mark, rund 3 Euro, pro Quadratmeter heute sind es 2100 Euro. Das liegt vor allem an der gestiegenen Attraktivität der Stadt, der Lage, den Jobs, der funktionierenden Infrastruktur, der Versorgung mit Schulen und Universitäten. Nichts von alledem haben Grundstücksbesitzer erarbeitet, es ist ihnen in den Schoß gefallen.[2]

Auch bundesweit sind von 1962 bis 2015 die Baulandpreise um 1600 Prozent gestiegen, der normale Preisindex hingegen nur um 302 Prozent – eine Entwicklung, die bereits Anfang der 1970er Jahre abzusehen war. Der Münchner Stadtrat unter Oberbürgermeister Vogel forderte bereits im März 1972 vom Bund die Einführung einer Bodengewinnsteuer und die Abschöpfung der Planungsgewinne. Wenn Wertminderungen durch Planungsentscheidungen entschädigt werden müssten, dürften auch Wertsteigerungen nicht beim Eigentümer verbleiben. Selbst der damalige CSU-Chef Franz Josef Strauß sagte: „Die Grundstückspreise steigen in einem Maße, dass es nicht zu verantworten ist, diese Gewinne unversteuert in die Taschen weniger fließen zu lassen.“ Passiert ist dennoch nichts.

Duisburg, Zinkhüttensiedlung, 2012-11 CN-02.jpg

„Im Gegensatz zu damals gibt es heute aber noch nicht einmal eine öffentliche Diskussion darüber“, kritisiert Vogel in einem Gastbeitrag für die „Süddeutsche Zeitung“. Das Problem müsse ganz rasch zurück auf die politische Tagesordnung: „Grund und Boden ist keine beliebige Ware, sondern eine Grundvoraussetzung menschlicher Existenz. Er ist unvermehrbar und unverzichtbar, […] jeder braucht ihn in jedem Augenblick seines Lebens wie das Wasser oder die Luft.“[3]

Schon das Bundesverfassungsgericht beschloss vor über 50 Jahren, am 12. Januar 1967: „Die Tatsache, dass der Grund und Boden unvermehrbar und unentbehrlich ist, verbietet es, seine Nutzung dem unübersehbaren Spiel der Kräfte und dem Belieben des Einzelnen vollständig zu überlassen: eine gerechte Rechts- und Gesellschaftsordnung zwingt vielmehr dazu, die Interessen der Allgemeinheit in weit stärkerem Maße zur Geltung zu bringen als bei anderen Vermögensgütern.“ Und dann kommt ein aus heutiger Sicht revolutionär anmutender Satz: „Es liegt hierin die Absage an eine Eigentumsordnung, in der das Individualinteresse den unbedingten Vorrang vor den Interessen der Gemeinschaft hat.“[4] Und ausgerechnet in der Bayerischen Verfassung heißt es in Artikel 161, Absatz 2: „Steigerungen des Bodenwertes, die ohne besonderen Arbeits- oder Kapitalaufwand des Eigentümers entstehen, sind für die Allgemeinheit nutzbar zu machen.“ Das aber wurde bislang versäumt.

»Die Infrastruktur im ländlichen Raum wurde vernachlässigt oder radikal weggespart.«

Quelle        :          Blätter        >>>>>           weiterlesen

———————————————————————-

Grafikquellen      :

Oben       —          Ecke Sofienstraße / Karl-Morian-Straße in Duisburg-Neumühl. (Im Hintergrund sind Häuser auf der Lüneburger Straße zu sehen. Die auf dem Foto zu sehende Grünfläche war zu diesem Zeitpunkt noch unbebaut. Das Foto ist vor 1977 entstanden, vermutlich 1976.)

————————————

Unten         —        Duisburg (North Rhine-Westphalia, Germany) – borough Hamborn, district Obermarxloh – residential complex at square Zinkhüttenplatz

Abgelegt unter Nordrhein-Westfalen, P.CDU / CSU, Sozialpolitik, Umwelt | Keine Kommentare »

Chile: Aufstand der Prekären

Erstellt von DL-Redaktion am 21. Oktober 2019

Ein Land im Ausnahmezustand

Santiago de chile collage.png

Quelle       :         untergrund-blättle   CH.

Von Ricardo Tristano

In dem lateinamerikanischen Staat, welcher lange Zeit als «Musterschüler Südamerikas» galt, haben sich die Proteste gegen eine Ticketpreiserhöhung der Metro um gerade mal 5 Rappen zu einem landesweiten Aufstand ausgeweitet.

Als vor einer Woche in Santiago de Chile eine Handvoll Schüler aus Protest gegen die Erhöhung der U-Bahn-Preise von 800 auf 830 Pesos (was umgerechnet rund fünf Rappen entspricht) zu kollektivem Schwarzfahren aufriefen, hätte sich niemand vorstellen können, dass diese an und für sich harmlose Form des zivilen Ungehorsams innerhalb weniger Tagen zu einem landesweiten Aufruhr mit massiven Plünderungen und einer nationalen Ausgangssperre führen würde.

Strukturelle Armut am Rande der Stadt

Doch die Probleme des Landes sind seit Längerem bekannt und die Wut der Menschen in den stetig wachsenden Armenvierteln am Rande der Stadt der Metropolenregion kommt keineswegs überraschend. Während die Oberschicht und der Mittelstand in den letzten Jahren von einem veritablen Wirtschaftsaufschwung profitieren konnte, befindet sich ein beträchtlicher Teil der Bevölkerung in einer prekären Lebenssituation. Mit einem Lohn von wenigen hundert Franken pro Monat und mit Lebensmittelpreisen auf europäischem Level wissen viele Familien schon Mitte des Monats nicht mehr, wie die Ausgaben der nächsten zwei Wochen zu decken sind. Somit ist auch logisch, dass sich die Mehrheit der Leute bei Banken und kleineren Finanzinstituten mit Mikro-und Kleinkrediten zu horribeln Konditionen eindecken und danach oft jahrelang verschuldet sind.

Verschiedene Studien gehen davon aus, dass im Grossraum Santiago zwischen 33 % bis 41 % der urbanen Bevölkerung in den sogenannten Poblaciones leben. Dennoch sollte man sich hier keine Slums im klassischen Stil vorstellen, vielmehr handelt es sich um südamerikanische Barrios mit einigermassen funktionierender, jedoch komplett privatisierter Infrastruktur. Obwohl viele Pobladores unter der achtjährigen Amtszeit der linksgerichteten Michelle Bachelet den Weg in den unteren Mittelstand geschafft haben, ist die strukturelle Armut für einen Grossteil der Bevölkerung an der Peripherie der Grossstadt immer noch knallharte Realität. Um die Gründe für diese tief verwurzelte Prekarität zu verstehen, lohnt sich ein kurzer Blick in die jüngere Geschichte des Landes.

Die neoliberale Diktatur

Als 1979 der demokratisch gewählte Sozialist Salvador Allende vom chilenischen Militär unter Führung von Augusto Pinochet unter tatkräftiger Mithilfe der USA ermordet wurde, begann nach dem Putsch eine bis dahin nie da gewesene Privatisierungswelle das Land zu erschüttern. Neben einer restriktiven Geldpolitik und der Abschaffung von Sozialausgaben galt Diktator Pinochet’s besonderes Augenmerk der wirtschaftsliberalen Reform. Er besetzte wichtige Ministerien mit Ökonomen rund um den Zirkel der «Chicago Boys», bei welchen es sich um eine Gruppe chilenischer Wirtschaftswissenschaftler handelte, welche in den USA studiert haben und von den Ideen der neoliberalen Vordenker Friedrich August Hayek und Milton Friedman mehr als nur angetan waren.

Unter dem Protektorat der USA wurden in der Folge die Staatsunternehmen privatisiert und dem internationalen Kapital Tür und Tor geöffnet. Der US-Ökonom Milton Friedman war angesichts der so noch nie gesehenen Zusammenarbeit eines diktatorischen Regimes mit dem freien, liberalen Wirtschaftsmarkt komplett begeistert und nannte es später »Das Wunder von Chile».

Diese Umstrukturierungsmassnahmen hatten unter anderem zur Folge, dass die Disparität in der Gesellschaft rapide zunahm, der informelle Sektor des Landes sprunghaft anstieg und grosse Teil der Bevölkerung immer tiefer in die Armutsfalle rutschten. Durch die einseitig beschleunigte Kapitalakkumulation und die Privatisierung des Bildungssektors bildete sich ein starres Klassensystem, welches bis heute tief in der chilenischen Gesellschaft verankert ist. Viele Gesetze der Pinochet-Diktatur sind bis heute in Kraft und sind mit ein Grund, warum in den letzten Jahren die Schüler und Studenten immer wieder und unermüdlich auf die Strasse gingen, um gegen ein System zu protestieren, in dem die Oberschicht ihren Kinder an Privatschulen zu horrenden Preisen eine Top-Ausbildung beschaffen, wogegen die Menschen aus den ärmeren Vierteln kaum eine Chance auf einen offenen Studienplatz erhalten.

Aufgestaute Wut

Nachdem die gut organisierten und über Jahre andauernden Studentenproteste in diesem Jahr etwas abgeflaut waren, hat sich derzeitig der nächste Funken entzündet. Nach Berechnungen der Fundacion Sol muss eine Person, die für den Mindestlohn arbeitet, 21 % seines Gehaltes für die U-Bahn ausgeben. Die Eskalation der erneuten Proteste gegen die Erhöhung der Ticketpreise ist somit keine wirkliche Überraschung – und es geht definitiv nicht nur um die Metropreise. „Ich protestiere wegen der ganzen Ungerechtigkeit, wegen der Gewalt und weil unsere Stimme nie gehört wird“ erklärte eine Demonstrantin gegenüber dem chilenischen Online-Magazin politika.cl. Mit dem völlig unverhältnismässigen Einsatz von Schusswaffen von Seiten der chilenischen Militärpolizei sorgten die Sicherheitskräfte schon zu Beginn der Proteste für eine Eskalation der Gewalt. Mehrere zunächst friedlich protestierende Jugendliche wurden mit Schussverletzungen in Krankenhäuser eingeliefert.

Die Reaktion der Strasse kam postwendend. Zuerst waren es vereinzelte U-Bahn-Stationen, die angegriffen und in Brand gesteckt wurden. Danach breitete sich der Aufstand rasend schnell aus. Wie schon oft zuvor strömten die Leute aus den Randbezirken zu tausenden in die Innenstadt, um ihrem Unmut über ein System, dass die Mittellosen kategorisch ausgrenzt, Luft zu verschaffen. Bemerkenswert ist, dass die Ausschreitungen nicht wie sonst üblich, nur an wenigen Hotspots, sondern asynchron und an unzähligen Orten stattfanden. Dabei wurden zahlreiche Supermärkte, ein grösseres Bürogebäude und massenhaft kleinere Ladenlokale geplündert und in Brand gesteckt. Barrikaden wurden gebaut, Busse gingen in Flammen auf und zahlreiche Polizeiautos wurden zerstört.

Die Reaktion des Staates

Schon Stunden später hat sich die Protestwelle auf andere grössere Städte (Iquique, Antofagasta, La Serena) des Landes ausgeweitet. Die Regierung verhängte in der Hauptstadt umgehend eine Ausgangssperre, welche von 22.00 Uhr – 7.00 Uhr gilt und das erste Mal, seit der Pinochet-Diktatur Ende der 1990 Jahre, wieder in Kraft tritt. Der eigens ernannte verantwortliche General Javier Iturriaga del Campo erklärte in den Medien, dass der Ausnahmezustand ausgerufen wurde, um «die öffentliche Ordnung und die Ruhe der Einwohner Santiagos sicherzustellen und sowohl privates als auch öffentliches Eigentum zu schützen». Auf den diversen Plätzen der Metropole tauchten schlagartig gepanzerte Fahrzeuge mit schwerbewaffneten Einheiten des chilenischen Militärs auf.

Trotz der massiven Einschüchterung von Seiten der Regierung ist der Rückhalt der Protestierenden in der Bevölkerung enorm: An vielen Strassenecken gab es Cacerolazos, eine traditionsreiche, lautstarke Protestform aus der Zeit der Militärdiktatur, bei der mit Kochlöffeln auf Pfannen und Topfdeckel gehämmert wird. In der Hafenstadt Valparaiso, in der ebenfalls Plünderungen stattfanden, beschwerte sich der linke Bürgermeister Jorge Sharp (Frente Amplio) öffentlich gegen die Verhängung der Ausgangssperre und den Einsatz des Militärs in seiner Stadt.

Santiago en invierno.jpg

Ob sich die Proteste mit Waffengewalt und kleinen Zugeständnissen auf die Schnelle eindämmen lassen, muss stark bezweifelt werden. Der Protest der Marginalisierten hat eine lange Tradition und verfügt über eine enorme Kontinuität. Bereits unter der Militärdiktatur von Pinochet waren neben den Studenten die Pobladores trotz massiver Repression die treibende Kraft im Widerstand gegen das totalitäre Regime.

Offensichtlich ist aber, dass von der aktuellen Regierung um den neoliberalen Dollarmilliardär Sebastián Piñera mit Sicherheit keine tiefgreifende Verbesserung der Lebensumstände erwartet werden kann, auch wenn er nun über die Fernsehkanäle verlauten liess, dass er die Stimme seiner Landsleute mit Demut vernommen habe und zu Gesprächen bereit sei. Verschiedene Organisationen, Gewerkschaften und studentische Verbände haben bereits für heute Montag zum Generalstreik aufgerufen.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————————-

Grafikquellen           :

Oben         —        Imágenes de la ciudad de Santiago de Chile. Trabajo derivado de: La Moneda Catedral Santiago Chile Torre Telefónica en Providencia m. bellas artes Inmaculadacerro Santiago chile 2013 Biblioteca Nacional Chile.jpg TorreEntel.JPG Cerro Santa Lucía-003

——————————–

Unten       —       Santiago de Chile in winter

Abgelegt unter Amerika, Mensch, Sozialpolitik, Umwelt | Keine Kommentare »

Ich mache mir Gedanken

Erstellt von DL-Redaktion am 20. Oktober 2019

über die MTG, die E-Mobilität und ihr baldiges Ende …

Von Stefan Weinert  – Ravensburg

In Zukunft werden – ab wann und bis wann auch immer –  in der Ravensburger Marienplatztiefgarage (MTG) Flüssiggasfahrzeuge, Erdgasfahrzeuge, Wasserstofffahrzeuge mit der Brennstoffzellentechnologie, Diesel-SUV, Benziner und – least but [may be] last  – nebeneiandner auf vier unterirdischen Stockwerken parken – und das ungeordnet nebeneinander. Bekanntlich können sich E-Autos selbst entzünden. Bei Dieselfahrzeugen entsteht die Selbstzündung des Motors dadurch, dass Luft bis zu 700 Grad Celsius komprimiert wird und sich dann selbst entzündet.

Bei einem E-Mobil ist die Gefahrenzelle hinsichtlich der möglichen Selbstentzündung, die Batterie, welche aus aus Lithium-Ionen-Zellen besteht. Die Zellen beinhalten eine Anode (Pluspol) und eine Kathode (Minuspol). Diese befinden sich in einem Elektrolyt, welcher ein organisches Lösungsmittel mit Leitsalz beinhaltet. Er sorgt dafür, dass die Lithium-Ionen in beide Richtungen wandern können. Zwischen Kathode und Anode befindet sich noch der Separator, dieser erlaubt es nur den Lithium-Ionen langsam und dosiert zu wandern. Wenn der Separater beschädigt ist – etwa durch Hitze, oder einen Aufprall – kommt es zu einem Kurzschluss. Zu viele Lithium-Ionen wandern unkontrolliert durch die Zelle, dadurch wird viel Energie freigesetzt. Die Batterie fängt Feuer. Selbst ein paar Tage nach einem Unfall können sich E-Autos erneut entzünden. Deshalb werden die Unfallwagen oft auf einem sicheren Gelände gelagert, wo sie einige Tage lang beobachtet werden.Teilweise experimentiert die Feuerwehr mit Wasserbädern. Hier wird das E-Auto in einen mit Wasser gefüllten Container gehoben. Damit werden die Batterien gekühlt und die Sauerstoffzufuhr ist unterbunden. Um eine (1) in Brand geratenen Lithium-Ionen-Zellen-Batterie vorübergehend zu löschen, werden 12.000 Liter verspritztes Wasser gebraucht, wobei diese Methode nicht die sicherste ist.

Da Elektroautos im Jahr 2019 noch immer als relativ neu gelten, gibt es kaum aussagekräftigen Statistiken über die tatsächliche Brandgefahr im Straßenverkehr. Die Prüforganisation Dekra hat mehrere E-Autos getestet und ausgewertet. Fazit: Autos mit Batterie sind genauso sicher wie Modelle mit einem Verbrennungsmotor. Moderne Elektroautos erhalten genauso häufig wie ihre Konkurrenten eine Wertung von fünf Sternen – die Bestnote. Der ADAC geht sogar noch weiter. Bislang ist bei dem Euro-NCAP-Crashtest kein Elektroauto negativ aufgefallen. Im Vergleich zu Verbrennermotoren sei ihre Sicherheit sogar häufig besser, so der Allgemeine Deutsche Automobil-Club. [Quelle u.a.: https://emobly.com/de/sonstiges/e-autosspiel-mit-dem-feuer/]

Das heißt aber nicht, dass auch ein E-Mobil grundsätzlich hundertprozentig brandsicher ist. Der springende Punkt ist die „Löschbarkeit“ gegenüber einem Benziner und einem Diesel. Wenn der Akku eines E-Mobils bei einem Unfall oder überhaupt Feuer fängt, dann setzt dieser enorme  Energie frei. Die Flammen zu löschen, ist dann sehr schwierig. Eigentlich kann man es gar nicht nicht löschen, sondern das Feuer muss kontrolliert abbrennen oder ausbrennen. Und zwar zwei bis drei Tage lang. Erst dann ist sicher, dass in keiner der Akkuzellen noch ein Brand schwelt. Am besten ist es (wie schon erwähnt), das Fahrzeug in ein Wasserbad zu tauchen.

Im Vergleich zu Benzinern oder Dieselautos gehen von E-Autos andere Gefahren aus. Aus den brennenden Akkus ströme heiße, giftige und ätzende Gase aus. Das ist vor allem in geschlossenen Räumen ein Problem. Wenn ein Pkw (egal welchen Energieantriebs) in der Tiefgarage brennt, dann ist das grundsätzlich ein sehr kräfteintensiver und gefährlicher Einsatz. Wenn Elektrofahrzeuge dabei sind, die mit ihren Akkus doch einen erheblichen Beitrag zu einem Brand leisten können, dann stellt das die Feuerwehr vor große Herausforderungen. In Parkhäusern und Tiefgaragen kommt es dann auf zwei Dinge an: Die so genannte Entrauchung muss gut funktionieren – und das brennende E-Auto muss sich so schnell wie möglich aus dem Gebäude herausholen lassen. Darauf muss man künftig beim Bau von Parkhäusern und Tiefgaragen achten. [Leicht gekürzte Quelle: Tobias Lübben, hessenschau.de]  

Bisher kaum bedacht wurde, dass es inzwischen auch PKW gibt, deren Energie das Flüssiggas ist. Gas wird dann flüssig, wenn es extrem abgekühlt wird (minus 161 bis 164 Grad Celsius). Tritt das Flüssiggas aus seinem Behältnis (Tank) aus,  verdampft es zunächst und ist je nach Gemisch ca. 1,5- bis 2,1-fach schwerer als Luft. Daher „fließt“ es („wabert„) – für den Feuerwehrmann/frau und/oder andere beteiligte unsichtbar – am Boden gleich einer Flüssigkeit  und es kommt bei einem Brand zu einem unberechenbaren Brandteppich. Das Gas kann sich aber auch wieder verflüssigen und kühlt dabei seine Umgebung so stark ab, dass im geschlossenen Wageninneren Erfrierungsgefahr besteht.

Wenn es um alternative Antriebstechnologien in der Automobilbranche geht, wird in den Medien, der Wirtschaft, der Politik und den Umweltverbänden vornehmlich über das Thema Elektromobilität berichtet und diskutiert. Dabei ist jedoch die Brennstoffzellentechnologie nicht weniger aussichtsreich. Das sehen auch immer mehr Experten so.Gemeinsam mit der Batterietechnologie wird die Polymerelektrolyt-Brennstoffzelle (PEMFC) den Durchbruch in der Elektromobilität markieren. Die PEM-Brennstoffzellentechnologie ist überall dort vorteilhaft einzusetzen, wo reiner Wasserstoff als Brennstoff verfügbar ist und wo geringer Verbrauch und Emissionsfreiheit gefordert sind (z.b. Innenstädte). Ein entscheidender Vorteil von Brennstoffzellen als Antriebstechnologie: Herkömmliche Tankstellen können als Wasserstoff-Tankstellen recht leicht umgerüstet werden. Dadurch entfallen die extrem hohen Kosten zum Aufbau einer Infrastruktur zum Laden der Akkus von Elektrofahrzeugen im Freien, in Garagen, Parkhäusern.  Wasserstoff kann die Antwort auf die Probleme sein, die zahlreiche deutsche Städte mit zu hohen Stickoxid-Werten haben. Zudem haben Fahrzeuge, die mit Wasserstoff betrieben werden, im Gegensatz zu batteriebetriebenen Fahrzeugen keine Reichweitenprobleme. Hier sind Reichweiten von 600 km und mehr möglich. . Mit der Erzeugung von Wasserstoff aus Wind- und Solarstrom kann erneuerbare Energie in den Gassektor transferiert werden.

Auch große Konzerne setzen bereits auf Wasserstoff, wie ABB, BMW und Voestalpine zeigen. Denn batteriebetriebene Fahrzeuge bringen nicht das gewünschte Maß an Nachhaltigkeit. Ihre Ökobilanz geht in den „roten“ Bereich. Auch wenn im Moment viel Geld in die Infrastruktur für strombetriebene Fahrzeuge gesteckt wird, forscht die Autoindustrie intensiv an Wasserstoff-Lösungen. Noch hat Wasserstoff das Problem, dass er hoch explosiv ist. Mittelfristig rechnet man jedoch damit, dass Sicherheitsbedenken im Zusammenhang mit Wasserstoff aus dem Weg geräumt werden.

Die Brennstoffzelle wandelt in vorgestellten Prototypen den in einem Speichertank gasförmig mit geführten Wasserstoff in Strom sowie Wasserdampf um und treibt einen Elektromotor mit 180 kW/245 PS an. Die Hochvoltbatterie des Fahrzeugs dient lediglich als Zwischenspeicher und kann mit einer Nettokapazität von etwa 1 kWh deutlich kleiner ausfallen als bei rein batteriebetriebenen Fahrzeugen. Ziel ist es, den kombinierten Antrieb aus Wasserstoff-Brennstoffzelle und Elektrifizierung nach dem reinen batterieelektrischen Antrieb als zweite lokal emissionsfreie Form der Mobilität zu etablieren. Einen Ausblick auf ein kundenreifes Fahrzeug mit Wasserstoffantrieb plant BMW 2020. Serienreife ist dann ab 2025 geplant.

Der Schweizer Energietechnik-Spezialist ABB überraschte 2018 mit einer Ankündigung, die das zukünftige Geschäft ankurbeln soll: ABB will zusammen mit dem Wasserstoff-Pionier Ballard Power Systems Brennstoffzellen für den Einsatz auf Schiffen entwickeln. Damit wollen die beiden Unternehmen die Elektrifizierung des maritimen Sektors weiter vorantreiben. Denn nicht nur die Benziner und Dieselautos auf unseren Straßen sind ein Problem für die Umwelt, sondern auch die großen Schiffe auf den weltweiten Flüssen und Ozeanen. ABB und Ballard Power Systems wollen Brennstoffzellen entwickeln, mit denen große Schiffe versorgt werden können. Das gesamte Modul auf Basis der Brennstoffzelle soll nicht größer als ein herkömmlicher Verbrennungsmotor für Schiffe sein, gleichzeitig aber bis zu 4.000 PS leisten. Für Brennstoffzellen finden sich auf Schiffen verschiedenen Anwendungsfelder. Sie können Schiffe nicht nur antreiben, sondern auch Energie für den Hotelbetrieb auf großen Passagierschiffen zur Verfügung stellen, während sich das Schiff im Hafen befindet.

Wasserstoff ist auf der Erde in nahezu unbegrenzten Mengen vorhanden, allerdings fast ausschließlich in chemischen Verbindungen (Wasser, Säuren, Kohlenwasserstoffe und anderen organischen Verbindungen). Wasserstoff ist ein farb– und geruchloses Gas und mit einem spezifischen Gewicht von 0,0899 g/l gegenüber Luft ein Leichtgewicht. Faustformel: 1 kg Wasserstoff enthält soviel Energie wie 2,8 kg Benzin. Wasserstoff ist keine Energiequelle sondern ein Energieträger, mit dessen Hilfe man Energie speichern und transportieren kann. Wasserstoff ist somit eine Sekundärenergie, da zur Herstellung zunächst bei allen Herstellungsarten Primärenergie aufgewendet werden muss. Eine umweltfreundliche Energieerzeugung mittels Wasserstoff findet erst dann statt, wenn der Wasserstoff mit regenerativen Energiequellen erzeugt wird.

Die am weitesten entwickelten Verfahren zur Erzeugung von Wasserstoff sind das Reformierungsverfahren und die Wasser-Elektrolyse.Der größte Teil der heutigen Wasserstoffproduktion entsteht als Nebenprodukt in Prozessen der chemischen Industrie und wird dort auch meist wieder verbraucht. Im industriellen Maßstab wird Wasserstoff zur Zeit hauptsächlich durch Reformierung von Erdgas erzeugt. Aber auch leichte Kohlenwasserstoffe aus anderen Quellen sind nutzbar, wie z.B. Benzin, Kohle, Methanol oder Biomasse. In den unterschiedlichen Reformierungsverfahren wird den aus Kohlen-Wasserstoffen-Ketten bestehenden fossilen Energieträgern in mehreren Schritten der Wasserstoff entzogen. Als Nebenprodukte entstehen u.a. Kohlenmonoxid, Stickoxide und Schwefeldioxid.

Ein weiterer schon gebräuchlicher Herstellungsprozess ist die Elektrolyse. Bei der Elektrolyse wird Wasser (H²O) mit einer Flüssigkeit versetzt, die den Ionentransport ermöglicht. Unter Einsatz von Strom wird Wasser in die Bestandteile Wasserstoff (H²) und Sauerstoff (O²) zerlegt. Dabei wird die elektrische in chemische Energie umgewandelt und im Wasserstoff gespeichert. In einer Brennstoffzelle kann das umgekehrte Prinzip genutzt werden, um die zuvor chemisch im Wasserstoff gespeicherte Energie wieder in elektrische zurückzugewinnen.

Brennstoffzellen wandeln die chemische Energie eines Stoffes (z.B. Wasserstoff, Methanol) ohne Zwischenschritt (d.h. ohne Dampferzeugung und Nutzung einer Turbine wie bei der herkömmlichen Erzeugung von Strom) direkt in elektrische Energie (Strom) um. Brennstoffzellen erzeugen daher elektrischen Strom prinzipiell mit einer höheren Effizienz als konventionelle Systeme. Brennstoffzellen können in Fahrzeugen eingesetzt werden (Strom- bzw. Elektrofahrzeuge), in Heizungen (kombinierte Strom- und Wärmeerzeugung) oder im Bereich der portablen Anwendungen (Laptops) zur Stromerzeugung.

Eine Brennstoffzelle besteht aus einer Anode, einer Kathode und einer dazwischen liegenden Trennschicht, dem Elektrolyten. An der Anode wird der Wasserstoff oxidiert (Elektronenüberschuß), an der Kathode (Elektronenmangel) werden die Protonen mit dem Sauerstoff zu Wasser umgesetzt. Werden die beiden Elektroden nun mit einem elektrischen Leiter verbunden, fließt Strom. Der gesamte Vorgang muss kontinuierlich ablaufen, d.h. es müssen ständig der Brennstoff Wasserstoff und Sauerstoff den jeweiligen Elektroden zugeführt werden.

Wasserstoff lässt sich als Energieträger relativ leicht transportieren. Wasserstoff kann wie Erdgas zusammengepresst unter hohem Druck oder in flüssiger Form gespeichert werden. Druckspeicher gibt es in unterschiedlichen Ausführungen, von zehn Liter fassenden Gasflaschen bis hin zu Großspeichern mit 100.000 Kubikmetern. Für Brennstoffzellenautos sind Tankdrücke von 700 bar in der Erprobung. Außerdem gibt es noch andere Speicherungsmöglichkeiten, die sich noch in der Entwicklung befinden. Man unterscheidet grundsätzlich drei unterschiedliche Speicherungsmöglichkeiten von Wasserstoff: gasförmig in Druckbehältern, flüssig in vakuumisolierten Behältern und als Einlagerung in Metallen auf molekularer Ebene. [Quelle: Internationales Wirtschaftsforum Regenerative Energien 2005]

Nun haben die Stadt Ravenburg und ihre Tochter TWS beschlossen, sukzessive in den kommenden Jahren bis zu 80 (acht-zig) E-Tankstellen (ET) in der MTG zu verbauen. Das ist angesichts der kommenden Energieverlagerung zum Wasserstoff/Brennstoffzellen, die wohl in Ravensburg noch nicht einmal gedanklich angekommen ist, ein Unding – selbst dann, wenn die Elektrizität für die gesamt MTG aus erneuerbaren Energien – wie es die TWS planen – generiert würde. Ja, auch der Wasserstoff benötigt Elektrizität, um zur Mobilität bei zu tragen, jedoch in wesentlich geringerem Volumen (siehe oben), weswegen er die Zukunft ist. Nehmen wir an, die MTG wäre tat-sächlich im Jahre 2025 mit den versprochene 80 ETs bestückt, dann ist davon auszugehen, dass sie schätzungsweise nur zu 30 Prozent genutzt werden, da Wasserstoff effizienter und auch brandungefährlicher ist — und sich diese Erkenntnis (zumindest beim Autofahrer) durchgesetzt hat.

Finanzexperten, Broker und Börsenkenner raten schon heute, Wasserstoffaktien zu kaufen, weil diese im Kurs enorm steigen werden. So schreibt erfolgsanleger.de: „Die Welt schreit immer lauter nach einer Alternative zu den schmutzigen fossilen Brennstoffen wie Diesel und Co. Doch während viele Unternehmen ein Vermögen in die Entwicklung ineffizienter Elektroautos stecken, steht eine neue, saubere und effiziente Technologie jetzt vor dem Durchbruch. Der Wasserstoff-Antrieb ist das Rückgrat der neuen Mobilitäts-Revolution. Und zwei Aktien werden durch diese Revolution durch die Decke gehen!“ Es scheint nicht nur ein Werbetrick zu sein.

—————————————————————

Grafikquellen           :

Oben            —       Freies Parken für ladende Elektrofahrzeuge (Schild am Berliner Ernst-Reuter-Platz)

 —————————-

Unten       —      Ladestation in Barcelona 2011

Abgelegt unter Baden-Württemberg, Energiepolitik, International, Umwelt | 2 Kommentare »

Experte für Abfallwirtschaft

Erstellt von DL-Redaktion am 16. Oktober 2019

Das Handwerk kämpft um Auszubildende.

Wuppertal - Friedrich-Engels-Allee - Karneval 147 ies.jpg

Von Barbara Dribbusch

Das Handwerk kämpft mit einer Imagekampagne um Auszubildende. Die Unterordnung der „Handarbeit“ unter die „Kopfarbeit“ soll aufgehoben werden. Auch mit neuen Berufsbezeichnungen.

Jimmy Pelka ist ein toller Typ. Er pendelt zwischen Bad Mergentheim und den Arabischen Emiraten hin und her, rüstet Luxusautos von Scheichs und Autofans auf und fährt selbst Porsche. Auf Instagram sieht man den gelernten Kfz-Mechaniker und Firmenchef durch die Gegend düsen, irgendwo in der Wüste, neben ihm ein arabischer Auftraggeber.

Ein aufregendes Leben führt auch Johanna Röh, Tischlerin. Sie hat nach ihrer Lehre die Welt bereist, in den USA, in Südamerika, in Asien gearbeitet. Man sieht sie in Kluft neben einem japanischen Meister, einem Sensei, sitzen. Jetzt führt sie einen ökologisch orientierten Tischlereibetrieb in Deutschland und wirbt in den sozialen Medien für das Handwerk.

HandwerkerInnen sind cool – das ist die Botschaft einer Imagekampagne des Handwerks, die schon länger läuft, aber jedes Jahr immer wieder ein bisschen aufgemöbelt wird. Pelka und Röh sind die neuesten BotschafterInnen in den sozialen Medien. Davor sah man Plakate mit einer Friseurin und dem Spruch: „Ich schneide keine Haare. Ich rette dein nächstes Date“. Oder einen Heizungstechniker mit: „Die Welt war noch nie so unfertig. Heiz ihr ein“.

„Ich halte die Imagekampagne für richtig“, sagt Joachim Gerd Ulrich, Berufswahlforscher beim Bundesinstitut für Berufsbildung (BiBB), „denn die Kampagne richtet sich nicht nur an junge Leute, sondern auch an die Allgemeinheit. Das ist klug, denn die Berufswahl findet stets auf einem ‚sozialen Resonanzboden‘ statt, wird also auch davon beeinflusst, wie Dritte über Berufe denken.“

Der soziale Resonanzboden ist hart geworden für das Handwerk, es gilt vielen als die mindere Variante zu einer intellektuellen, einer technischen, einer kaufmännischen Ausbildung. „Das Problem ist das Abitur, die meisten Schüler wollen heute Abitur machen. Und dann heißt es: ‚Ich mache doch nicht Abitur, um Handwerker zu werden‘“, berichtet Daniela Wilke, Berufsberaterin bei der Bundesagentur für Arbeit in Berlin: „Außerdem herrschen immer noch die alten Vorurteile über das Handwerk.“ Ackerei ohne Ende, kaputte Knie, Staub und Schmutz, wenig Geld und private Auftraggeber, die immer was zu mosern haben und sich toll fühlen, wenn sie dem Handwerker einen Fünf-Euro-Schein als Trinkgeld in die Hand drücken.

Das Imageproblem hat Folgen: Die Zahl der unbesetzten Lehrstellen im Handwerk hat sich innerhalb von zehn Jahren bis zum Jahre 2018 vervierfacht, so das Bundesinstitut für Berufsbildung (BiBB). Ende August 2019 seien im Handwerk noch 30.000 Ausbildungsplätze offen gewesen, heißt es beim Zentralverband des Deutschen Handwerks. Auch bedingt durch die Demografie hat sich der Lehrstellenmarkt gewandelt, „weg von einem Markt für die Betriebe hin zu einem Markt für die Bewerber und Bewerberinnen“, sagt Susanne Eikemeier, Sprecherin bei der Bundesagentur für Arbeit.

Was junge Leute wollen, was sie sich von einem Beruf erwarten, ist daher mehr und mehr in den Fokus der Forschung gerückt. Die Familie nehme großen Einfluss, betont Ulrich. „Eltern wollen in der Regel, dass ihr Kind einen höherwertigen oder zumindest gleichwertigen Bildungsabschluss erlangt, als sie ihn selbst haben“, sagt er. Viele Eltern, die studiert haben, wollen nicht in ihrem akademischen Bekanntenkreis erklären müssen, dass ihr Nachwuchs „nur“ Handwerker lernt, während die Kinder der anderen im Ausland studieren. „Dieses Anerkennungsbedürfnis der Eltern in Hinblick auf Bildung und Beruf der Kinder ist nicht zu unterschätzen“, so Ulrich.

Laut einer Befragung bei Neunt- und Zehntklässlern an zumeist allgemeinbildenden Schulen kam für fast die Hälfte der jungen Befragten eine spätere Arbeit im Handwerk nicht in Frage. Am stärksten ausgeprägt war die Neigung zum Handwerk, wenn zumindest ein Elternteil selbst eine Handwerkslehre durchlaufen hatte oder wenn es im Verwandtenkreis weitere HandwerkerInnen gab. Dabei spielt der Verdienst eine große Rolle. Die gewerkschaftsnahe Hans-Böckler-Stiftung kam in einer Untersuchung zu dem Schluss, das ArbeitnehmerInnen im Handwerk im Schnitt 20 Prozent weniger verdienen als Beschäftigte in der Gesamtwirtschaft, in der AkademikerInnen die Verdienste nach oben ziehen. Auch die Tatsache, dass HandwerkerInnen meist in kleinen Betrieben arbeiten, in denen mancherorts nicht mal Tariflöhne gezahlt werden, drückt das Gehalt.

Bildergebnis für Wikimedia Commons Bilder Bundeswehr in Schulen Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

Als Sölner für den Staat – zwischen Mördern und – Innen

Wer mehr verdienen will, muss nach dem Gesellenbrief den Meisterbrief erwerben und sich selbstständig machen. Der Zentralverband des Deutschen Handwerks weist in einer Erklärung darauf hin, dass Handwerker mit Meisterbrief im Berufsleben „etwa gleich viel oder sogar mehr als Bachelorabsolventen“ verdienen können. Doch der Weg zum Meister erfordert Durchhaltevermögen. Und die Imagefrage bleibt: Nicht nur die Herkunftsfamilie, auch Gleichaltrige, potenzielle PartnerInnen entscheiden über das soziale Ansehen eines Berufes und damit auch darüber, ob junge Leute eine Ausbildung im Handwerk beginnen. „Viele Frauen haben heute höhere Schul- und Studienabschlüsse, sie wollen in der Regel Partner, die einen ebenso hohen Abschluss haben. Wer ein Handwerk erlernt, fürchtet dann möglicherweise um die Chancen auf dem Partnerschaftsmarkt“, sagt Ulrich. Er berichtet von jungen Frauen in der Universitätsstadt Heidelberg, die selbst Einzelhandelskauffrau lernten, ihre berufliche Ausbildung lieber verschwiegen und sich als Studentinnen ausgaben, um für die Jungs von der Uni interessanter zu wirken.

Quelle          :       TAZ           >>>>>          weiterlesen

——————————————————————-

Grafikquellen        :

Oben        —        Vor, während und nach dem Wuppertaler Karnevalszug auf der Friedrich-Engels-Allee am 10.02.13 in Wuppertal. Straßenreiniger der ESW mit einer Tennant Green Machines 636HS.

————————————-

Unten        —          Autor   Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

Abgelegt unter Bildung, Deutschland, Kriegspolitik, Umwelt | Keine Kommentare »

Greta Thunberg Interview

Erstellt von DL-Redaktion am 16. Oktober 2019

Die Frau, die aus dem Himmel kam

Eine kleine Weile noch – der Hintergrund im weißen Shirt, hebt gleich ab.

Interview:

Anfeindungen, Triumphe, seltsame Begegnungen: Wie die Klimaaktivistin Greta Thunberg das Jahr erlebte, vertraute sie Alexandra Urisman Otto an, Reporterin der schwedischen Zeitung „Dagens Nyheter“.

Greta Thunberg gibt nur selten Interviews. Alexandra Urisman Otto ist nah an die Ikone der Klimabewegung herangekommen: Gemeinsam mit dem Fotografen Roger Turesson hat die Reporterin der schwedischen Zeitung „Dagens Nyheter“ Thunberg in den vergangenen Monaten immer wieder getroffen.

Als Greta Thunberg ihren neuen Namen bekommen soll, erhebt sie sich von dem Plastikstuhl und stellt sich auf den Boden der Sporthalle. Chief Arvol Looking Horse steht auf dem Podium hinter ihr. Spricht ihren Namen aus und gibt den Musikern ein Zeichen. Die Feier wird von traditionellen Liedern und Trommeln begleitet.

Über 500 Kinder haben sich in der Standing Rock Community School in South Dakota versammelt, um das Gespräch zwischen Greta Thunberg und der gleichaltrigen Aktivistin Tokata Iron Eyes über die Klimakrise zu verfolgen. Die meisten hier sind Ureinwohner – Sioux, die den Stämmen der Lakota, Dakota und Nakota angehören. Der Ort wurde 2016 durch Proteste gegen die geplante Erdölfernleitung Dakota Access Pipeline bekannt. Aus Angst vor einem verheerenden Leck haben damals Tausende Menschen fast das ganze Jahr lang protestiert. Sie haben verloren, die Leitung wurde gebaut.

„Dieser Ort liegt im Zentrum des Geschehens. Die Menschen hier sind am stärksten betroffen. Sie sind aber auch diejenigen, die den Kampf gegen die Klima- und Umweltkrise anführen. Sie haben noch immer eine Verbindung zur Natur, die viele von uns verloren haben. Sie wissen, wie wir diese Krise überwinden können“, sagt Greta Thunberg nach der Zeremonie. „Außerdem war es ärgerlich, dass die Medien lieber darüber geschrieben haben, dass Kim Kardashian mich verehrt, anstatt über die Sorgen der Menschen hier zu berichten. Nun ja, die Medien treffen manchmal merkwürdige Entscheidungen.“

Jay Taken Alive, ein ehemaliger Häuptling der Sioux, hatte spontan vorgeschlagen, dass Greta Thunberg mit einem Lakota-Namen geehrt werden sollte: „Du weckst die Welt“, sagte er. Der Name: Mahpiya Etahan hi wi – die Frau, die aus dem Himmel kam.

Vor einem Jahr führten der Fotograf Roger Turesson und ich unser erstes Interview mit Greta Thunberg. Wir saßen auf dem kalten, grauen Straßenpflaster am Mynttorget vor dem schwedischen Reichstag. Nur wenige Wochen zuvor hatte sie die erste Rede ihres Lebens über das Klima gehalten. Vor mehreren Hundert Personen im Rålambshovsparken von Stockholm erzählte Greta Thunberg, dass der Schulstreik, mit dem sie drei Wochen vorher angefangen hatte, jeden Freitag fortgesetzt würde, bis die schwedische Klimapolitik dem Pariser Abkommen entspräche.

War sie nervös?

„Situationen, die für andere stressig sind, regen mich nicht auf. Mir fällt es leicht, ruhig zu bleiben“, sagte sie damals.

Greta Thunberg 4.jpg

Als wir uns in der Prärie treffen, ist es zwei Wochen her, dass sie vor den führenden Politikern der Welt im UN-Gebäude in New York gesprochen hat. Jetzt sitzen wir in dem Elektroauto, das ihr der ehemalige Gouverneur Arnold Schwarzenegger geliehen hat.

Wie hast du dich während der Rede vor der UN gefühlt?

Greta Thunberg: Davor war ich nicht nervös. Ich dachte nur daran, dass dies groß sein würde, dass ich mich konzentrieren müsste. Aber das war nicht schwierig. Dann bin ich dort angekommen, und ich habe einige der führenden Politiker der Welt getroffen, die Selfies mit mir machen wollten.

Wer zum Beispiel?

Thunberg: Merkel. Sie hat ein wenig geredet und natürlich gefragt, ob es in Ordnung wäre, wenn sie das Bild in den sozialen Medien verwendet.

Dann ging ich auf die Bühne und hörte den Reden der anderen zu. Als ich anfing zu sprechen, wurde das plötzlich total bewegend. In dem Moment habe ich wohl verstanden, dass dies hier eine wirklich wichtige Rede sein würde.

Wie hast du die Rede vorbereitet?

Thunberg: Ich habe etwa seit Mittsommer über den Inhalt nachgedacht. Eine Botschaft sollte lauten: „How dare you?“ – eine Schuldzuweisung und Beschämung der Machthaber. Danach habe ich das gemacht, was ich immer mache. Ich habe es vor mir hergeschoben. Und einige Tage vorher habe ich angefangen, die Rede zu schreiben.

Bekommst du Hilfe, um in der Rede die richtigen Fakten zu verwenden?

Thunberg: Ja, wenn die Rede einigermaßen fertig ist, schicke ich sie an mehrere Wissenschaftler. Das sind immer unterschiedliche, zum Beispiel ein Experte für ein bestimmtes Gebiet. Und meist bekomme ich innerhalb einiger Stunden eine Antwort. Kommentare wie: Hier solltest du noch das ergänzen, oder so. Wenn es sich um falsche Fakten handelt oder Dinge, die missverständlich sind, ändere ich das.

„Diejenige, die leidet, ist meine Schwester“

Wäre Greta Thunberg Künstlerin, würde man sagen, dass sie ihren internationalen Durchbruch während dieser fünf Minuten in dem Saal hatte, in dem normalerweise die Generalversammlung der UN tagt. Mit vor Wut bebender Stimme richtete sie den Blick auf die eingeflogenen Staats- und Regierungschefs im Saal. „How dare you?“, sagte sie und nannte Fakten des Weltklimarats der UN (IPCC). „Die beliebte Idee, unsere Emissionen in zehn Jahren zu halbieren, gibt uns nur eine 50-prozentige Chance, unter einer Erderwärmung von 1,5 Grad zu bleiben.“

Sie verlas ihre überprüften und bestätigten Zahlen, erzählte den Weltpolitikern, dass diese 50-prozentige Wahrscheinlichkeit auf dem Bericht des Weltklimarats basiere – und dass dieser Faktoren wie Klimagerechtigkeit nicht berücksichtige. Außerdem gehe das Szenario davon aus, dass es Technologien gebe, die große Mengen Kohlendioxid aus der Luft auffangen könnten. Technologien, die es bisher nicht gebe.

„Ein Risiko von 50 Prozent ist für uns einfach nicht akzeptabel. Wir müssen mit den Konsequenzen leben“, sagte sie.

Sie wurde gefeiert. Sie wurde verhöhnt. Und in der darauffolgenden Woche hat sie drei Millionen neue Instagram-Follower gewonnen.

Man muss bedenken, dass Greta Thunberg, bevor sie zu einer der einflussreichsten Personen der Welt wurde, nicht bloß ein ganz normales 15-jähriges Mädchen war. Im Alter von elf Jahren litt sie an einer schweren Depression. Sie sprach nur noch mit ihren engsten Familienangehörigen, konnte nicht mehr zur Schule gehen. Und hörte auf zu essen. Nach zwei Monaten stellte ein Arzt der Kinder- und Jugendpsychiatrie fest, dass Greta aufgrund ihrer Unterernährung demnächst ins Krankenhaus eingewiesen werden müsse. Dies war der Wendepunkt, der Anfang ihres langen Wegs zurück.

Im Sommer äußerte sich Greta Thunberg in einem Interview mit Dagens Nyheter: „Ich war irgendwie total unglücklich. Es war nichts passiert. Wenn es mir gelungen war, rauszugehen zum Supermarkt, habe ich das in meinem Tagebuch festgehalten und war stolz, dass ich das geschafft habe.“ Als sie das Tagebuch später las, habe sie gedacht, „dass ich vor einem oder zwei Jahren von dem Leben, das ich heute habe, nur träumen konnte, ganz unabhängig von dem ganzen Aktivismus und der Bekanntheit“.

Greta Thunberg sitzt auf dem Vordersitz in Arnold Schwarzeneggers Elektroauto, und es scheint ihr gut zu gehen. Die unerfreulichen Folgen ihres Erfolgs sind vor allem zu Hause in Stockholm bemerkbar.

Thunberg: Diejenige, die leidet, ist meine Schwester. Sie ist 13 Jahre alt und muss systematisches Mobbing, Hass und Schikanen ertragen.

Von wem wird sie schikaniert?

Thunberg: Alle, die mir drohen und voller Hass schreiben, richten ihren Hass gegen meine ganze Familie. Der Unterschied ist, dass meine Angehörigen zu Hause sind und ich ständig unterwegs und unerreichbar bin. Die Leute wissen nicht, wo ich wohne, wo ich nachts schlafe, wo ich mich aufhalte. Ich habe keinen Alltag. Aber meine Schwester zu Hause versucht, einen Alltag zu haben. Sie ist also viel leichter zu erreichen.

Was tut ihr gegen die Drohungen?

Thunberg: Wir melden sie der Polizei.

Wie beeinflusst dich das?

Thunberg: Es ist schrecklich. Die Menschen fragen sich, wie sie mir helfen können, aber diejenigen, die wirklich Hilfe benötigen, bekommen sie nicht. Sie werden nur verhöhnt und bekommen Hassbotschaften. Meine Schwester ist dem am stärksten ausgesetzt, aber für sie gibt es keine Hilfe. Stattdessen bekommt sie überall Gegenwind.

Welche Unterstützung wäre nötig?

Thunberg: Freunde, die sie besuchen und fragen, wie es ihr geht, die sich melden. Ich erhalte ständig feine Einladungen von Menschen, die mir helfen wollen. Die beste Art, mir im Moment zu helfen, ist, meine Schwester zu unterstützen. Nicht weil sie meine Schwester ist, sondern weil sie eine wunderbare und starke Person ist. Sie ist meine beste Freundin.

Während ihrer Atlantiküberquerung im Sommer hat Greta Thunberg nach einigen Tagen angefangen, Kinderlieder zu summen, die sie glaubte vergessen zu haben: „Wir haben eine Esche, die ist mindestens 100 Jahre alt. Jedes Jahr wird sie größer, am untersten Zweig hängt meine Schaukel. Dort sitze ich oft und lass die Beine baumeln.“ Majas Buchstabenlied, von A bis Ö. Als sie an Land ging, googelte sie als Erstes den Text der Strophe zum Buchstaben U; die einzige, an die sie sich nicht erinnern konnte.

Hört auf die Wissenschaftler!

Quelle        :          Zeit-online           >>>>>          weiterlesen

——————————————————————–

Grafikquellen         :

Oben      —Berlin (July 2019)

2.) v0n Oben       —    In August 2018, outside the Swedish parliament building, Greta Thunberg started a school strike for the climate. Her sign reads, “Skolstrejk för klimatet,” meaning, “school strike for climate”.

————————-

Unten     —        Greta Thunberg in Berlin, giving a speech in July 2019.

Abgelegt unter Bildung, International, Schicksale, Umwelt | Keine Kommentare »

Falsche Kritik verbreiten?

Erstellt von DL-Redaktion am 13. Oktober 2019

Deutsche Wohnen enteignen? Saugerne!

Quelle        :        untergrund-blättle   CH.

Von  Gruppen gegen Kapital und Nation

Falsche Kritik verbreiten? Bloss nicht! Steigende Mieten sind seit langen nicht nur in Berlin Thema; hier aber besonders stark.

Das Ausgangsniveau der Mieten war um 2004 relativ niedrig, so dass der Anstieg hinterher besonders drastisch war. Hatten zunächst die vielen Lebenskünstler*innen in Berlin ein hartes Problem, mussten sich zunehmend auch Lehrer*innen, Durchschnitts-Lohnarbeiter*innen und Durchschnitts-Rentner*innen die Frage stellen, ob man umziehen muss, weil man sich die Miete nicht mehr leisten kann und zunehmend ob man das überhaupt innerhalb von Berlin noch kann.

Die Entwicklung wurde begleitet von Mieter*innen-Protesten. Häuser- oder Wohnblöcke organisierten sich, Kiez-Initiativen wurden gegründet. Zu einer Bündelung dieser punktuellen Proteste kam es während einiger Kampagnen, die mit Volksbegehren bzw. Volksentscheiden verknüpft wurden. Das Volksbegehren Deutsche Wohnen & Co enteignen (im folgenden „DW-enteignen genannt) steht in dieser Tradition.[1]

Ziel des Volksbegehrens ist: Große Immobilienkapitale (mit mehr als 3000 Wohnungen in Berlin) zu enteignen und die Wohnungen in eine Anstalt des öffentlichen Rechts zu überführen, in denen Mietervertreter*innen über die Geschäftspolitik mitbestimmen. Das wird dann im Gegensatz zu einer bloßen Verstaatlichung, Vergesellschaftung genannt. Durch die Vergesellschaftung soll verhindert werden, dass bei einer wechselnden Politik, die neue Wohnungsgesellschaft einfach per Gesetz wieder auf Rendite getrimmt wird und schließlich privatisiert wird (wie sowas Ende der 1980er, in den 1990er und 2000er Jahren umfangreich geschehen ist).

Die Kampagne betritt juristisches Neuland, weil sie sich auf einen Grundgesetzartikel (Art. 15) bezieht, der in der Geschichte der BRD bislang gar nicht zur Anwendung kam.[2] Viele Debatten in der Öffentlichkeit beziehen sich auf die Frage, ob die Forderungen der Kampagne überhaupt verfassungsmäßig und finanziell realistisch seien. Und die Kampagnenorganisator*innen verwenden viel Energie darauf nachzuweisen: sie sei es. Wie „realistisch“, also in der heutigen politischen Wirklichkeit verwirklichungsfähig, das Ziel der Kampagne ist, können weder wir noch sonstwer zurzeit beurteilen. Langjährige Gerichtsverfahren werden erwartet.

Grundsätzlich ist es ja erst mal ein erfrischender Vorschlag, den Immobilienunternehmen das Recht zu nehmen, aus ihrem Eigentum so viel rauszuholen wie es eben nur geht, indem man sie enteignet. Selbst wenn das vielleicht nur dazu führt, dass der Mietpreis für die vergesellschafteten Mieter*innen dann bei „nur“ acht Euro pro qm liegt und nicht mehr;, selbst wenn das nur die Politik nötigen würde, mehr auf die Nöte vieler Mieter*innen einzugehen, um dieses „letzte Mittel“ (SPD-Bundesjustizministerin Lambrecht) der Vergesellschaftung bloß nicht anwenden zu müssen; dann wäre ja auch schon was gewonnen. Zumindest für die Leute, denen ihre Wohnungen ansonsten weggenommen oder unbezahlbar verteuert werden würden.

Zumindest für Teile des Kampagnenbündnisses, vielleicht aber auch für alle, ist schon was gewonnen, wenn unabhängig vom konkreten Erfolg, die Debatte über die Vergesellschaftung von Wohnraum mal losgeht. Hier gelinge eine gesellschaftliche Bewusstseinsbildung.[3]

Auch das stimmt! So sympathisch das Anliegen ist, so verkehrt aber sind die falschen, irreführenden und schädlichen Argumente, die dem breiten Publikum mit der Kampagne ins Bewusstsein gebracht werden sollen.

Die Mieten steigen rasant seit 2004, warum ist das so? Die eine weit verbreitete Antwort in der Öffentlichkeit ist: Zu wenig Wohnraum für zu viele Leute. Es kommen einfach mehr Menschen nach Berlin als abwandern. In der Konsequenz wird Neubau gefordert und gefördert. Für die CDU und die FDP eindeutig (bei den anderen Parteien teils auch) gilt daher: Unternehmen, die Wohnungen bauen wollen, sollen gefördert werden.

Gegen diese „Analyse“ und Konsequenz tritt DW-enteignen an. Mietsteigerungen sind zwar auch für sie oberflächlich betrachtet ein Phänomen von Angebot und Nachfrage am Markt. Aber: Das Angebot selber wäre mal konkreter in den Blick zu nehmen. Die Kampagnenmacher*innen stellen zu Recht fest: Wenn die neuen Wohnungen alle in der oberen Preisklasse angesiedelt sind, taugen sie als Bremse für die allgemeine Mietentwicklung nicht. Das Gegenteil scheint der Fall zu sein, wenn diese neuen, teuren Wohnungen in den Mietspiegel eingehen und dann eine Rückwirkung auf alle anderen Wohnungen haben, so dass auch da die Mieten ordentlich angezogen werden können. Und letztlich: Was nützen Kapitale, die auch mehr Wohnungen bauen, aber zugleich bestehende Wohnungen übernehmen, sie zu ihrem Geschäftsmittel machen und dafür sorgen, dass die Mieten dort ordentlich steigen?

Gegen das Projekt, sich die Angebotsseite einmal genauer anzuschauen, ist nichts einzuwenden. Ärgerlich ist, wie das innerhalb der Kampagne passiert. Wo sie „strukturelle“ Ursachen ausmacht, verfällt sie zugleich immer wieder in moralische Anfeindungen (gierig, unanständig und moralisch verdorben) und verwandelt ökonomische Gesetzmäßigkeiten des Kapitalismus somit in eine persönliche Einstellungssache der Akteure. Das gleiche geschieht bei ihrer Erklärung der staatlichen Wohnungspolitik. Das soll in diesem Text ausgeführt und kritisiert werden. Zuvor soll noch ein Mangel der Kampagne dargestellt werden, der exemplarisch für die gesamte gesellschaftliche Debatte über „bezahlbaren Wohnraum“ steht:

Das große Ziel: „Bezahlbarer Wohnraum“ oder „leistbare Mieten“

„Eine soziale Wohnungsversorgung in Großstädten wie Berlin setzt in der Fläche dauerhaft sozial gebundene Wohnungen zu leistbaren Mieten voraus. Wer auch Haushalten mit geringen Einkommen Wohnungen zur Verfügung stellen will, muss unterdurchschnittliche Mieten sicherstellen. Dieses Ziel ist mit privaten Wohnungsunternehmen mit Gewinnerzielungsabsicht nicht zu erreichen.“[4]

Die Messlatte von DW-enteignen ist die des „bezahlbaren Wohnraums“. Wie auch sonst in der gesellschaftlichen Debatte über das Thema Wohnraum, wird in der Kampagne die Frage, warum eigentlich wer wieviel Zahlungskraft zur Verfügung hat, konsequent ausgeblendet.

Auf die Unterschiede der Zahlungskraft wird zwar hingewiesen, aber immer nur als Aufzählung, nicht als Frage nach dem Grund der unterschiedlichen Lebenslagen. Es gibt Obdachlose, es gibt HartzIV-ler*innen, es gibt Lohnarbeiter*innen, die verdienen gar nicht mehr als Hartz IV, es gibt Durchschnittsverdiener*innen, es gibt Selbstständige, deren Einkommen sich gar nicht über das von Lohnarbeiter*innen erhebt, es gibt Lehrer*innen, die vor allem in Berlin nicht die Welt verdienen usw. Allen gemeinsam ist durchaus, dass die derzeitige Mietentwicklung ihnen das Leben sehr schwer macht. Auf der anderen Seite kennen die Kampagnenmacher*innen Luxusmieter*innen, z.B. Mieter*innen mit Zweit- und Drittwohnung. Und denen wollen sie (nicht in der Kampagne, aber an anderer Stelle) alle mal Sondersteuern aufbrummen, anstatt ihnen das Leben leichter zu machen.[5] »Der Mieter« ist also eine ganz schön abstrakte Figur.

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) die Auswüchse gegen Mieter in ihrer Gesamtheit keine tragischen Einzelfälle darstellen, sondern vielmehr Ausdruck eines strukturellen Problems einer rein profitorientierten Wohnraumbewirtschaftung sind.“[6]

Ob „Mieter“ Probleme haben oder nicht, liegt nicht nur an der Angebotsseite, sondern eben auch an seiner Zahlungskraft, die wiederum auf die Einkommensquellen verweisen. Daher mögen mittlerweile viele Mieter*innen in Berlin Angst wegen der Wohnungsmarktsituation haben, aber auf jeden Fall nicht alle.

Daher ist es auch absurd, wenn die Interventionistische Linke (als eine tragende Organisation der Kampagne DW-enteignen) davon redet, dass „Berlin“ Angst hat.

„Berlin hat Angst. Laut einer Umfrage befürchten 47% der Berliner*innen, in den nächsten Jahren wegen Mietsteigerungen ihre Wohnung zu verlieren. Die Angst ist begründet, denn insbesondere seit der Finanzkrise 2008 ist Berlin zur Beute geworden – aus aller Welt flüchten Kapital und Investoren ins ‚Betongold‘. Wurde deswegen anfangs noch gegen Hipster und Studierende geschimpft, so haben viele Menschen inzwischen begriffen, dass nicht andere Mieter*innen, sondern die Eigentümer*innen das Problem sind: Wohnraum als Ware, die Immobilie als Spekulation sind Quellen unserer Angst.“[7] (Das Rote Berlin, IL, S. 3.)

Dieser positive Bezug auf „Berlin“ erinnert mehr an die Werbung für die Berliner Eisbären („Du bist kein Berliner, wenn dich XY kalt lässt“) oder den Berliner Rundfunk 91,4 („Wir Berliner für unsere Stadt“), als an eine vernünftige Analyse. Diese angebliche vorstaatliche oder vorkommunale Gruppe «Wir Berliner*innen» gibt es erstens nicht. Und als Ansammlung von Leuten, die im Herrschaftsbereich Berlin leben, haben sie zweitens so gut wie keine gemeinsamen Interessen und Ängste, aber viele gegensätzliche. Keineswegs hat „Berlin“ Angst vor steigenden Mieten; Neben den Mieter*innen mit genug Kohle ist z.B. Eigenheimbesitzer*innen das alles vermutlich ziemlich wurscht oder sogar willkommen. Vermietende Grundeigentümer*innen haben vermutlich eher Angst vor dem Mietendeckel und möglicher Enteignung. Mit der Gegenüberstellung vom guten, angstgeschüttelten „Berlin“ zu den „aus aller Welt“ daherkommenden „Investoren“, wird auch indirekt ausgesagt: Am bestehenden Gemeinwesen „Berlin“ kann es eigentlich nicht liegen, wenn es Probleme gibt – die kommen von außen hereingeschneit.

Und das ist falsch. Die Probleme vieler Mieter*innen auf und mit dem Wohnungsmarkt sind die Folgen dessen, wie und wofür hierzulande gewirtschaftet wird, ganz egal welchen Erstwohnsitz oder Pass die „gierigen Profitjäger“ haben. Der Reichtum wird in dieser Gesellschaft – und eben auch in Berlin – nicht als gemeinsames Projekt, sondern in Konkurrenz produziert: Arbeiter*innen konkurrieren um Arbeitsplätze, kämpfen also gegeneinander darum, für Kapitalist*innen arbeiten zu dürfen. Kapitalist*innen konkurrieren gegeneinander um Marktanteile. Dafür ist der Preis ihrer Waren das entscheidende Mittel, und so strengen sie sich fortlaufend an, die Stückkosten billiger zu machen. Ein Weg dies zu erreichen, ist Lohndrückerei oder mehr Leistung und Überstunden durchzusetzen – also ein Kampf gegen die Arbeiter*innen. Ein weiterer Weg sind Rationalisierungen, mit denen die Kapitalist*innen die Arbeiter*innen außer Lohn und Brot setzen. Und darum ist es auch kein Wunder, dass die steigenden Mieten nicht einfach durch Lohn- oder Rentenerhöhungen abgefangen werden. Darum müssen Lohnarbeiter*innen ja fürchten, dass die Grund- und Immobilienbesitzer*innen ihnen mit immer höheren Mietforderungen das Leben schwermachen.

Dass also es überhaupt zuwenig guten und bezahlbaren Wohnraum in den meisten Metropolen gibt, ist die Konsequenz dessen, dass die Lohnarbeiter*innen so in die kapitalistische Gesellschaft eingebaut sind, dass sie von zwei Seiten mit den Ansprüchen des Kapitals zu kämpfen haben: Auf der einen Seite die Kapitale, die die Lohnarbeits-Leistung für Gewinnzwecke benutzen wollen, was eine magere Einkommensquelle ergibt (wenn die Kapitale Lohnarbeiter*innen dann gleich gar nicht mehr benutzen wollen, sieht es noch schlechter aus, wenn man als Lohnarbeiter*in ohne Lohn da steht). Auf der anderen Seite kommen dann die Kapitale, die aus der Wohnbereitstellung ihren Profit ziehen wollen.[8]

Fazit und der erste zentrale Fehler der Kampagne: »Der Mieter« hat kein Problem mit der Wohnungssituation. Es sind Lohnarbeiter*innen oder ähnliche Figuren, die Probleme damit haben. Indem die Kampagne, die Gründe für die prekären Einkommenslagen nicht angeht, sondern die Lagen nur herbeizitiert, setzt sie sich für die armen Leute in der Gesellschaft nur so ein, dass sie die als dauerhaft arme Leute unterstellt und ihnen das Leben in der dauerhaften Armut leichter machen will.

Das Immobilienkapital

Auf der Kampagnen-Seite https://dwenteignen.de gibt es eine Extra-Rubrik „Warum enteignen?“. Dort gibt es unter der Einleitung „Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…)“ eine Auflistung von Gründen:

File:20190424105DR Dresden-Mitte ABB-Hochhaus Könneritzstraße 25.jpg

„Deutsche Wohnen die Häuser vergammeln lässt, keine ausreichende Instandhaltung betreibt (siehe ständige, tagelange Heizungsausfälle im Winter), um sie dann teuer zu modernisieren und die Bestandsmieter zu vertreiben.“[9]

„Die Auswüchse gegen Mieter in ihrer Gesamtheit keine tragischen Einzelfälle darstellen, sondern vielmehr Ausdruck eines strukturellen Problems einer rein profitorientierten Wohnraumbewirtschaftung sind. Dabei nehmen die führenden Immobilienunternehmen aufgrund ihrer Größe eine marktbeherrschende Sonderstellung ein. Sie sind einerseits aufgrund ihrer Größe in der Lage, die Entwicklung der Mieten und auch der Mietgesetzgebung zu beeinflussen (siehe Angriffe auf den Mietspiegel) und sind andererseits aufgrund ihrer wirtschaftlichen Ausrichtung im Besonderen für Preissteigerungen auf dem Wohnungsmarkt verantwortlich.“[10]

Hier wird halbwegs nüchtern darauf hingewiesen, dass die Konzerne Gewinne machen wollen und die Mietwohnungen dafür ihr Mittel sind. Nüchtern wird auch die Konsequenz dargestellt: Es folgt ein Interesse an Mietsteigerungen. Ein Mittel diese Mietsteigerungen durchzusetzen ist nach dem deutschen Mietrecht eine Modernisierung. Die Instandhaltung der Wohnung beschert dagegen erstmal vor allem Kosten, die es für den Gewinn zu vermeiden gilt. Soweit gilt das noch für alle Hauseigentümer*innen, die die Wohnungen als Einkommensquelle benutzen. Die Konzerne – so wird weiter analysiert – haben aufgrund ihrer Größe zudem die ökonomische Macht eine Mietentwicklung in einem ganzen Bezirk, wenn nicht sogar in einer ganzen Stadt zu beeinflussen. Wenn sie ganze Straßenzüge modernisieren und die Mieten anheben, dann tragen sie selbst zur Steigerung des Mietspiegels bei und können dann auch an dieser gesetzlich erlaubten Ecke die Mieten alle drei Jahre weiter anheben.

„Wer auch Haushalten mit geringen Einkommen anständige Wohnungen zur Verfügung stellen will, muss unterdurchschnittliche Mieten sicherstellen. Dieses Ziel ist mit privaten Bauträgern und privaten Wohnungsunternehmen mit Gewinnerzielungsabsicht, die eine mindestens durchschnittliche Verzinsung des eingesetzten Eigenkapitals erwarten, nicht zu realisieren.“[11]

Dass die großen Immobilienkonzerne als Aktiengesellschaften Teil des Finanzkapitals sind und was das bedeutet, wird in der Kampagne nicht gut entwickelt. Man könnte hier aber anknüpfen und weitere Aufklärungsarbeit leisten:

Die eben beschriebene ökonomische Macht der Konzerne beruht auf ihrer üppig vorhandenen Geldmacht, die andere Hausbesitzer*innen so erstmal nicht haben. Diese Geldmacht speist sich bei den Immobilienkonzernen nicht einfach aus vergangenen, eigenen Gewinnen, sondern aus der Benutzung des Kreditsektors. Der funktionierende Kapitalismus entwickelt eine Bankenlandschaft, die alles gerade nicht anderweitig benutzte Geld der Gesellschaft einsammelt und zur Grundlage ihrer Kreditvergabe macht.

Damit erlaubt der Kreditsektor eine Umkehrung für die kreditnehmenden Unternehmen: Die Geschäftserweiterung wird nicht mit vergangenen Gewinnen gemacht, sondern neue Gewinnsphären werden mit Kredit erschlossen, die dann erhöhte Gewinne einbringen. Der Zins ist dann der vorab festgelegte Mindestmaßstab für die Unternehmung. Dass das vorhandene Privateigentum von Unternehmen für manche Unternehmungen zu klein ist, wird durch den Kreditsektor zwar nicht außer Kraft gesetzt, aber deutlich entschränkt. Das passiert im erweiterten Maßstab bei den Aktiengesellschaften, die Gesellschaftsform in der die großen Immobilien-Konzerne organisiert sind.[12]

Diese Analyse taucht in der Kampagne oder auch in der Broschüre der Interventionistischen Linken „Das Rote Berlin“ punktuell auf. Das stimmt alles und soweit wäre die Kampagne ein guter Beitrag zur Bewusstseinsbildung, die hilfreich für konkrete Abwehrkämpfe als auch längerfristige gesellschaftliche Veränderungen wären. Das Kapital ist kein Sozialpartner, sondern die entscheidende wirtschaftliche Rechnung und Macht, der das gesellschaftliche Leben unterworfen ist. Das tut Lohnarbeiter*innen nicht gut, sie haben einen Interessengegensatz mit dem Kapital und sie haben einen guten Grund sich das Kapital vom Hals zu schaffen. Leider belässt es die Kampagne nicht dabei in dieser Art und Weise aufzuklären. Während sie einerseits auf die Interessengegensätze hinweist, trägt sie daneben oder dabei das Ideal einer moralisch anständigen Gemeinschaft vor sich her und in diesem Lichte sind die Immobilienkonzerne nicht einfach ein Gegner, sondern unanständig, moralisch verdorben, gierig usw.:

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Es notwendig ist, eine Grenze zu ziehen. Wie lange wollen wir zusehen, dass unsere Stadt zur Beute einiger gieriger Profitjäger wird? Ja, es muss auch ein Exempel statuiert werden, damit die weiterhin nach Berlin strömenden ‚Investoren‘ abgeschreckt werden.“[13]

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Der §559 BGB (Modernisierungsumlage) von großen Konzernen gezielt missbraucht wird, um die Mieteinnahmen zu steigern. Die Energieeinsparung und somit der umweltbezogene Nutzen dieser Maßnahmen wird von vielen Baufachleuten angezweifelt.“[14]

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Die Großkonzerne das Land Berlin und somit die Berliner*innen durch sogenannte ,share dealsʻ nach Schätzungen um einen dreistelligen Millionenbetrag hintergangen haben. Diese Einsparung der Grunderwerbssteuer ist zwar legal (wer macht solche Gesetze?), jedoch nicht legitim.“[15]

,Es reichtʼ, sagt Rouzbeh Taheri, Sprecher der Initiative. ,Wenn die Mieter in dieser Stadt keine Angst mehr haben sollen, dann müssen große Wohnungskonzerne raus aus der Stadt.ʼ Denn deren Geschäftsstrategie basiere ,auf Spekulation, auf ständigen Mieterhöhungen und auf Ausnutzung aller gesetzlichen Tricksʼ“[16]

Die Unternehmen wollen nicht einfach Gewinn machen, so gut es eben geht, sie sind vielmehr „gierige Profitjäger“. Mit dieser Charakterisierung wird unter der Hand gesagt, dass es ja so nicht sein müsse. «Maßvolles Gewinnstreben» wird so als o.k. und vorbildlich eingeführt und sogar als das eher Normale vorstellig gemacht – schließlich sind es nur „einige“, die „Beute“ machen und „Profitjäger sind“.

Die Unternehmen benutzen die Gesetze nicht, wie alle anderen auch, so gut es geht für die eigenen Zwecke, sie nutzen sie aus; Gesetze werden nicht gebraucht, sondern missbraucht – unverschämt! Zwar ist das alles juristisch einwandfrei, sei aber nicht legitim. Ein anständiger Bürger zahle dagegen brav seine Steuern, damit der Staat gut finanziert ist und für die Allgemeinheit was Gutes tun kann.

Mit dieser moralischen Beurteilung des Treibens der Immobilienkonzerne nimmt die Kampagne das Urteil „hier herrscht ein Gegensatz und zwar systematisch“ zurück. Es müsste gar nicht so sein, wie es ist, wenn die Kapitalist*innen sich auf einen maßvollen, nützlichen Gewinn beschränken würden. Statt einer für Lohnarbeiter*innen schädlichen ökonomischen Systematik, bleibt eine für alle schädliche moralische Einstellung der Konzernleitung übrig.

Oben wurde bereits angedeutet, dass die Kampagne es verpasst, das Finanzkapital als Vollendung der kapitalistischen Logik darzustellen. Im Lichte der moralischen Vorwürfe, muss man die Kritik genauer fassen: Die Kampagne begreift die Logik des Profits schlicht nicht als maßlos.[17] Sie will maßvollen und maßlosen Gewinn unterscheiden. Die Kampagne begreift die Logik des Finanzkapitals nicht als Verlängerung der üblichen Profitrechnung, sondern als das ganz Andere. Das Finanzkapital ist maßlos, die normalen Kapitalist*innen dagegen nicht. Das Unterscheidungskriterium von maßvoll und maßlos, gewinnt die Kampagne nicht aus der Analyse der ökonomischen Rechnung, sondern aus der Wirkung im Lichte der moralischen Kategorie des „Allgemeinwohls“. Damit steht sie in der schlechten Tradition linker »Kapitalismuskritik«, die das schmarotzende Kapital von dem der Allgemeinheit dienstbaren Kapital unterscheiden will.

So passen dann die „strukturellen“ Erklärungen mit dem Moralismus zusammen: Die Hinweise auf die Systematik oder Struktur der mietsteigernden Wirkung der Gewinnrechnung unterstreichen in der Kampagne nur die konsequente Bösartigkeit der Figuren, die das Immobilienkapital auszeichnen. Mit diesem Moralismus agitiert die Kampagne auf einem Plakat zum Mitmachen:

„Die Deutsche Wohnen schadet nicht nur ihren Mieter*innen, sondern längst dem Allgemeinwohl.“[18]

Das ist ein sehr interessanter Hinweis. Dass die Deutsche Wohnen ihren Mieter*innen nicht guttut, scheint als Grund, der Deutschen Wohnen etwas entgegen zu setzen, nicht auszureichen. Da wird jetzt auch noch das Allgemeinwohl geschädigt. Damit befinden sich die Kampagnenmacher*innen in bester Gesellschaft mit der herrschenden staatlichen Politik. Die beansprucht gerade im Gegensatz zu den privaten Einzelinteressen in der Gesellschaft das Allgemeine zu vertreten und zu fördern. Und die Politik wird auch nicht müde die Bürger*innen darauf hinzuweisen, dass das Allgemeinwohl nicht das Wohl Aller ist. Zu Recht. Wenn die privaten Einzelinteressen miteinander harmonieren würden, dann bräuchte diese Gesellschaft auch keine politische Instanz, die gerade getrennt von den Konkurrenzinteressen, die allgemeinen Grundlagen für die Konkurrent*innen stiftet.

Wenn aber die Einzelinteressen sich ständig in die Haare kriegen (und das liegt ja gerade an der Art und Weise, wie die Ökonomie hier läuft), dann ist das allgemeine Wohl auch nur der Umstand, dass alle irgendwie ihren Dienst in der kapitalistischen Gesellschaft machen können und der Staat, der das organisiert, handlungsfähig ist. Die Politik wetteifert dann um das beste Konzept, einerseits das Wirtschaftswachstum zu steigern (damit darüber der Staat via Steuern und Staatskredit handlungsfähiger wird) und auf der anderen Seite dabei drauf zu achten, dass die Bedingungen des Kapitalismus (Arbeiter*innen und Umwelt) nicht völlig ruiniert werden. Das ist der laufenden Widerspruch bürgerlicher Politik und alle Parteien präsentieren ihr Konzept als das Beste. Alle Parteien treten dabei irgendwelchen gesellschaftlichen Gruppen auf die Füße. Und alle Parteien wollen Bürger*innen, die das Treiben der Politik als Dienst an einer vorgeblich staatlichen Gemeinschaft gewürdigt wissen – der Allgemeinheit, dem «Wir», der Stadt.

Richtig wäre es zu sagen: Dieses Allgemeinwohl lehne ich ab. Die Gesellschaft ist keine Gemeinschaft. Ich weiß, dass ich als Lohnarbeiter*in das Material bin, den Staat und die Unternehmen stark zu machen (die Unternehmen heißen ja in der bürgerlichen Gesellschaft gleich «die Wirtschaft»). Und die moralische Verpflichtung auf das Allgemeinwohl soll mich geistig verpflichten, zu meiner armen, dienstbaren Rolle «Ja» zu sagen.

Die Kampagne geht den entgegengesetzten Weg: Sie agitieren ihre potentiellen Mitstreiter*innen mit der Aussage: Wenn du Probleme hast, dann zählt das nicht viel. Aber wenn das Allgemeine beschädigt wird, dann hast du ein Recht, echt unzufrieden zu sein. Und wo der Staat will, dass sich die Menschen über die er herrscht, sich mit ihm identifizieren, weil es sich so leichter regieren lässt, fördert die Kampagne explizit diese Identifizierung:

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Die überwiegende Mehrzahl der Wohnungen im Besitz der Deutsche Wohnen früher städtisch waren: GSW und GEHAG. Wir wollen einfach unsere Häuser zurück.“[20]

Städtisch = Unser! Das ist faktisch falsch und als politische Haltung schlecht.

Fazit und der zweite zentrale Fehler der Kampagne ist die moralistische Betrachtung des Immobilienkapital. Einerseits abgebrüht: Die wollen halt Gewinn machen. Dann aber laufend: Gesetze ausnutzen, Profitgier usw. Mit dem positiven Bezug auf das Allgemeinwohl agitiert die Kampagne im Feld der Moral dann für den positiven Bezug auf die Politik. Das setzt sich fort im folgenden dritten Fehler der Kampagne:

Der Staat, die Stadt, die Kommune

„Wir brauchen eine groß angelegte Kommunalisierung beim Wohnungsbau und bei der Bereitstellung von Wohnungen, weil nur diese langfristig und auch in angespannten Situationen eine soziale Versorgung mit Wohnungen sicherstellen kann.“[21]

Vom Markt erwartet sich die Kampagne in Sachen billigen Wohnraum zu Recht nichts. Für die Kampagne ist dann die Kommune die Instanz, die dafür Sorge tragen soll. Die Politik ist gefragt. Eine bloße Enteignung der großen Wohnungskonzerne und die Überführung des Eigentums in die öffentliche Hand, reicht der Kampagne aber nicht. Sie haben nicht vergessen, dass viele Wohnungen der Immobilienkonzerne über den Weg der Privatisierung gerade aus den Beständen der öffentlichen Hand herkommen. Und die Wohnungsgesellschaften, die in der Hand des Senates sind, haben sich in Sachen Mietsteigerungen auch gründlich hervorgetan. Die Kampagne schließt daraus, dass „Mehr als Verstaatlichung“[22] her muss. Sie fordern eine Vergesellschaftung:

„Bisher ist das Staatseigentum in Berlin schlecht verwaltet worden: Mietsteigerungen zur Haushaltssanierung und die Privatisierung Zehntausender landeseigener Wohnungen sind die Ursachen der heutigen Wohnungskrise. Ohne die Privatisierungen durch schwarz-rote und rot-rote Koalitionen im Berliner Senat gäbe es Immobilienriesen wie die Deutsche Wohnen gar nicht. Weiterhin haben die landeseigenen Wohnungsgesellschaften Berlins private Rechtsformen wie die GmbH oder die Aktiengesellschaft. Ihre Politik hat sich auf Druck langjähriger Proteste langsam geändert – aber ihre Bücher sind den Bürgern verschlossen, Mieter*innenmitbestimmung findet faktisch nicht statt.

Ein Verkauf der Bestände ist jederzeit möglich, wenn sich politische Mehrheiten ändern. Wohl auch deshalb haben viele Berliner*innen Bauchschmerzen, wenn aktuell die Schulgebäude Berlins der landeseigenen HOWOGE GmbH überschrieben werden. Die von der Initiative ,Deutsche Wohnen & Co enteignenʻ angestrebte Vergesellschaftung geht daher einen anderen Weg. Erstmals soll das im Artikel 15 des Grundgesetzes erwähnte ,Gemeingutʻ mit Leben gefüllt werden. Gemeingut bedeutet, dass es der neuen Anstalt öffentlichen Rechts verboten wäre, Wohnungen zu privatisieren oder Profite auszuschütten – ihr Auftrag wäre allein die Versorgung Berlins mit bezahlbarem Wohnraum. Die AöR müsste alle Gewinne aus der Vermietung in Instandhaltung, Sanierung und Neubau bzw. Ankauf investieren. Sonst wäre das im Grundgesetz geforderte Kriterium eines Gemeingutes nicht erfüllt. Die Anstalt öffentlichen Rechts steht daher nicht in Konkurrenz zum Neubau, ganz im Gegenteil – ihre Gewinne würden den Neubau vorantreiben.“[23]

Per Volksbegehren bzw. Volksentscheid soll der Senat ein Gesetz erlassen, mit dem er die großen Immobilienkapitale enteignet und in sein Eigentum übergehen lässt. Das Eigentum soll zugleich eine besondere Rechtsform bekommen (Anstalt des öffentlichen Rechts), in der festgezurrt ist, dass der Zweck der Gesellschaft die Versorgung mit bezahlbaren Wohnraum sein soll und eine (erneute) Privatisierung ausgeschlossen wird. Das Misstrauen in die Politik soll weiter durch eine Mitbestimmung von Mietervertreter*innen bei der Geschäftspolitik Rechnung getragen werden.

In Hinsicht auf die Immobilienunternehmen lässt sich die Kampagne nichts vormachen – die taugen nichts. Hier gibt sich die Kampagne immerhin Mühe an einigen Stellen zu erklären, wie die Logik der Unternehmen funktioniert und ist sich sicher, dass die Logik notwendig „leistbare Mieten“ ausschließt.

In Hinsicht auf den Staat oder den Senat ist die Kampagne nicht so streng. Einerseits taugt die Politik auch nichts, die Politik will sie aber nicht aus der Stadt verjagen. Sie will sie benutzen und zugleich verpflichten. Sie soll das Instrument für die Beseitigung der Existenzangst an der Wohnungsfront sein. Der Grund dafür liegt in den Erklärungen der staatlichen Wohnungspolitik seitens der Kampagnenmacher*innen – und diese sollen hier auch deshalb diskutiert werden, weil es den Kampagnenmacher*innen ja neben dem konkreten, politisch aber schwierigen und langwierigen Projekt des Volksbegehrens um die Bewusstseinsbildung geht:

Warum ist dem Staat oder der Politik zu misstrauen? Eigentlich gibt die Kampagne nur empirische Hinweise. Sie verweist auf die vergangenen Jahrzehnte von Bundes- und Berlinpolitik, vergleicht die Politik mit ihrem Maßstab „bezahlbare Mieten“ und sagt: Das war Mist. Das Staatseigentum ist „schlecht verwaltet worden“ (das kann man also besser machen!). „Strukturelle“ Gründe, warum der Staat selber das Immobilienkapital unterstützt, die eigenen öffentlichen Wohnungsbaugesellschaften auf Gewinn verpflichtet hat und in den Fällen, wo das gelungen ist, sie dann privatisiert hat, finden sich auf der Kampagnen-Seite gar nicht.[24]

Man muss dann schon auf Papiere der beteiligten Organisationen oder Interviews der Kampagnenmacher*innen zurückgreifen, und da wird man dann schon fündig:

Der neoliberale Staat

„Das BImA-Errichtungsgesetz[25] von 2004, geschrieben von der rot-grünen Schröder-Regierung, sieht eine Verwaltung ,nach kaufmännischen Grundsätzenʻ vor mit dem Ziel, ,nicht betriebsnotwendiges Vermögen wirtschaftlich zu veräußernʻ. Die BImA funktioniert somit nach der Logik des neoliberalen Staates, der öffentliches Eigentum auch da abbaut, wo es rentabel ist. So werden die Staatseinnahmen geschmälert und neue Sparzwänge aufgebaut. Privatisierung spart kein Geld, sie kostet Geld und ist eine reine Herrschaftstechnik. Sie verwandelt nicht nur öffentliches Eigentum in privates Kapital, sondern beschränkt auch den Raum demokratischer Politik. Über die Verwendung von Privateigentum wird nicht diskutiert, sie unterliegt allein den Mechanismen des Kapitals. Wohnungspolitik wird so strukturell unmöglich gemacht. Jede privatisierte Wohnung schwächt politisches Handeln und stärkt kapitalistisches Privileg.“[26]

Wenn eine rot-grüne Regierung ein politisches Programm radikal durchzieht, was die vorherige christdemokratische Regierung unter Helmut Kohl nur häppchenweise angegangen ist: nämlich eine gründliche Reformierung des Lohnes und des Sozialwesens, eine Stärkung des Finanzplatz Deutschland und eine auf Signale an die Finanzmärkte bedachte Haushaltspolitik (alles Agenda 2010); das alles zum Zwecke der Stärke Deutschland in der internationalen Standortkonkurrenz, dann entdeckt die IL nur eine Schwächung des politischen Handelns. Schröders Credo war, dass man als Staat in der Globalisierung entweder Hammer oder Amboss ist und hat sich mit seinen Regierungsparteien dazu entschieden, dass Deutschland ein Hammer werden soll. Und dieser Hammer hat in einem bürgerlichen Staat nun mal seine Substanz in dem privaten Wirtschaftsleben, über das der Staat gebietet.

Das bringt ihm Steuereinnahmen, das verschafft Kreditwürdigkeit und ein starker Finanzplatz ist letztlich für eine Währung, die Weltgeld sein soll, unverzichtbar. Mit einem erfolgreichen privaten Geschäftsleben, über das der Staat gebietet, kann er Druck auf andere Staaten ausüben, sei es zum Zwecke einer vorteilhaften Hierarchie in der EU, sei es zum Eingemeinden neuer Staaten in die EU (und Herausbrechen aus der russischen Einflusssphäre), sei es zum Zwecke der Abwehr von Flüchtlingen, wenn afrikanische Staaten das für die EU übernehmen sollen. Wo Regierungen (Kohl, Schröder und Merkel, die Schröders Erbe verwaltet und hie und da eine Übertreibung korrigiert) deutlich machen, dass ein handlungsfähiger Staat eine florierende Privatwirtschaft braucht und die Armut von vielen Menschen geradezu die Bedingung dafür ist, da entdeckt die IL nur eine Logik des Neoliberalismus. Diese Logik hat für die IL staatlicherseits keinen Sinn, außer: sie fördert Privilegien der Kapitalisten, die doch einfach nur schädlich für die Allgemeinheit seien.

Mit ihrem Ideal von bürgerlicher Politik geht die IL agitieren, denkt sich in lauter Staatsnotwendigkeiten rein und präsentiert ihre »realistische Alternativen« und versöhnt damit am laufenden Meter die betroffenen Menschen mit der Politik. Und dann wieder nicht, wenn es um die Erklärung der doch offensichtlich unsinnigen Politik geht:

Korruption

„Die SPD ist, gerade in Berlin, eng mit den großen Playern der Immobilienwirtschaft verbunden. So kam 2014 heraus, dass der Berliner Baulöwe Klaus Groth gestückelte Spenden an die SPD getätigt hat, auch an den Kreisverband des damals zuständigen SPD-Bausenators Andreas Geisel. ,Kooperative Strategieʻ hört sich schön an, bedeutete aber in der Vergangenheit, dass der SPD die Interessen der Immobilienwirtschaft wichtiger waren als die Bedürfnisse der Mieterinnen und Mieter.“[27]

„Die Privatisierung der GEHAG war durch die Große Koalition in Berlin bereits im Jahr 1998 erfolgt. Der zuständige Bausenator war damals übrigens ein gewisser Jürgen Klemann (CDU). Funfact: Etwa ein Jahr später wurde er Chef der von ihm mitprivatisierten GEHAG. (…) Aber niemandem käme in den Sinn, hierfür das Wort Korruption zu verwenden (lacht).“[28]

Mit Bezug auf Korruptionsfälle im alten West-Berlin:

„Das Bauen war Instrument lokaler Wirtschaftsförderung, da Berlin als Inselstadt ohne öffentliche Subventionen ökonomisch kaum überlebensfähig war. Realistische Abschätzungen von Kosten und Bedarf waren geradezu unerwünscht, Risiken wurden mit Bürgschaften des Senats abgefedert, die Profite durch private Bauträger erwirtschaftet. Jüngere Skandale wie etwa der seit Jahren stillstehende Hauptstadtflughafen BER weisen ein ähnliches Profil auf: unrealistische Bedarfsplanung, Bevorzugung lokaler Unternehmen mit dem Argument der Wirtschaftsförderung, Haftung des Landes bei mangelnder oder völlig fehlender Kostentransparenz.“[29]

„Unsere Vorstellung für eine sozialistische Wohnungspolitik in einem ‚Roten Berlin‘ beginnt mit der Kritik des Immobilienmarktes und des privaten Wohnungseigentums. Wohnungspolitik in (West-)Berlin und der BRD wollte diesen Markt durch öffentliches Eigentum ergänzen, meist auch private Investitionen durch öffentliches Geld locken. Insbesondere Letzteres hat in Berlin zur Herausbildung eines korrupten Filzes aus Bauwirtschaft und Politik geführt.“[30]

Der Sprecher der Kampagne und die IL verweisen bei der »Erklärung« der stattgefundenen Politik auf Korruptionsfälle und Filz. Damit erklären sie sich, warum Politiker*innen Sachen machen, die in ihren Augen politisch völlig unverständlich sind. Dass es Korruption gibt und warum es das gerade in der Bauwirtschaft häufig gibt, stimmt und wäre gesondert zu erklären. Dass aber die bloße Bestechung der Grund dafür sei, warum die Politik die Immobilienkapitale, die Bauwirtschaft oder einzelne Unternehmen davon fördert, ist zu bezweifeln. Warum nicht die wirtschaftspolitischen Spekulationen der Politik einmal ernst nehmen und den Gehalt davon erklären?

  • dass das politische Projekt „Wirtschaftswachstum fördern“ den dabei erfolgreichen Staat (oder die Stadt) durchaus handlungsfähig macht;
  • dass diese Wirtschaftspolitik notwendig eine Spekulation auf zukünftigen Erfolg seitens der Kommunen darstellt und Staaten und Städte sich dabei wechselseitig Konkurrenz machen;
  • dass daher diese Spekulation auch mal danebengehen kann, wie sich im Berliner Bankenskandal gezeigt hat;
  • dass diese Spekulation auch Erfolg haben kann, wie sich in Berlin ab 2004 gezeigt hat;
  • aber egal, ob der Staat oder die Stadt erfolgreich ist oder nicht, in jeden Fall eine Armut für viele Leute eingepreist ist.[31]

Dann käme man nämlich bei einem nüchternen, negativen Urteil über bürgerliche Politik raus und müsste nicht die moralische Integrität der Politiker*innen bemühen. Die spielt nämlich dann umgekehrt bei den positiven Beispielen eine Rolle, wenn „glaubwürdige“ Politiker*innen unterstützt werden sollen:

„Außerparlamentarisch bedeutet: Wir sind nicht an Koalitionsverträge gebunden und unterliegen keinem Fraktionszwang. Wenn Einzelne, wie im Gefolge des Mietenvolksentscheid geschehen, öffentliche Ämter annehmen, müssen sie in eine andere Rolle wechseln. Dies bedeutet nicht das Ende jeder Solidarität, wie die Solidaritätskampagne für Andrej Holm 2017 gezeigt hat. Auch nach seinem Wechsel aus Wissenschaft und Aktivismus auf einen Staatsekretärsposten verteidigte ihn die Bewegung. Sozialer Druck bedeutet auch, dass glaubwürdige politische Persönlichkeiten gegen Angriffe des Immobilienkapitals verteidigt werden. Ebenso müssen sinnvolle Ziele des Rot-Rot-Grünen Berliner Koalitionsvertrages immer wieder eingefordert werden. Die meisten dieser Ziele stimmen ohnehin eins zu eins mit langjährigen Forderungen der stadtpolitischen Bewegung überein.“[32]

Das ist schon ein starkes Stück. Am Koalitionsvertrag unterscheidet sich kaum etwas von den Kampagnenmacher*innen? Es ist nur eine Frage der glaubwürdigen Umsetzung? Nur dafür braucht es die außerparlamentarische Opposition, damit Politiker*innen auch machen, was sie sich vorgenommen haben? Und verteidigen musste man Holm nur gegen das Immobilienkapital, nicht etwa gegen alternative politische Konzepte der Herrschaftsausübung etwa seitens der CDU/FDP/SPD/Grüne/Die Linke in Berlin? So kommt raus: Macht macht Leute irgendwie korrupt, bringt sie von ihren Zielen ab – daher muss man sie ständig unter Druck setzen. Was ist aber, wenn es andersherum ist und die Tatsache, dass jemand es vernünftig findet, bestimmte Anliegen mit Hilfe staatlicher Macht durchzusetzen, diese Anliegen einfach modifiziert? Dass, wer den Staat für welche Anliegen auch immer benutzen will, sich dann auch um die Handlungsfähigkeit des Staates kümmern muss und dann auf den sozialdemokratischen Sinnspruch bezüglich des Kapitals kommt: Wer die Kuh melken will, darf sie nicht schlachten. Und daher müsse man als verantwortlicher Sozialpolitiker immer zugleich wirtschaftspolitisch denken.

Fazit und der dritte zentrale Fehler der Kampagne: Eine Erklärung der Politik, die davon geleitet ist, dass sich viel von ihr erwartet wird, gleitet in lauter Fehler ab, so dass sie letztlich da landet, womit Politiker*innen immer Werbung für sich machen: alles eine Frage von Ehrlichkeit und Glaubwürdigkeit der Person.

So endet also eine Kampagne, die angetreten ist, Leute davon zu überzeugen, sich gegen die Zumutungen des Mietmarktes auch mal politisch zu wehren und dabei das Eigentum nicht als unantastbares Heiligtum anzuerkennen, dabei, ein recht vertrauensseliges Misstrauen in die Politik und eine Prise alternativen Patriotismus zu verbreiten. Dem konkreten Anliegen der Kampagne, die DW & andere zu enteignen, ist aller Erfolg zu wünschen. Ihren Analysen und Argumenten hingegen nicht

Fussnoten:

[1] Ein Volksbegehren in Berlin verläuft immer in drei Stufen: Zunächst muss die Initiative genügend Unterstützer*innen finden, um dieses Volksbegehren zu beantragen. In dieser ersten Stufe sind 20.000 Unterschriften der wahlberechtigten Berliner notwendig. Die Initiative hätte sechs Monate Zeit gehabt, diese Zahl zu erreichen. Die Unterschriftenaktion startete am Samstag, 6. April 2019 und ist am 14. Juni abgeschlossen worden. Die 77.000 Unterschriften wurden von den Behörden geprüft, es sind genügend Gültige vorhanden. Geprüft wird derzeit noch (Stand 21.09.2019), ob das Volksbegehren mit höherrangigem Recht vereinbar wäre. Ist der Antrag auf Einleitung des Volksbegehrens zulässig, teilt der Senat dem Abgeordnetenhaus seinen Standpunkt zu dem Volksbegehren mit. Sodann muss die Trägerin vier Monate abwarten, ob das Abgeordnetenhaus das Begehren in seinem wesentlichen Bestand übernimmt. Will das Abgeordnetenhaus das Anliegen nicht einfach selber umsetzen, folgt die zweite Stufe – das Volksbegehren. Sieben Prozent der wahlberechtigten Berliner*innen ab 16 Jahren müssen diesem zustimmen. Das sind derzeit etwas mehr als 170.000 Personen. Vier Monate ist dafür Zeit. Ist das Volksbegehren erfolgreich, kommt es zum Volksentscheid. Er ist dann erfolgreich, wenn 50 Prozent der Abstimmenden und mehr als 25 Prozent der Wahlberechtigten zustimmen.

[2] Übliche Enteignungen etwa für den Bau einer Autobahn berufen sich auf den Artikel 14. Dort geht es um „Enteignung (…) zum Wohle der Allgemeinheit (..)“. In Art. 15 heißt es: „Grund und Boden, Naturschätze und Produktionsmittel können zum Zwecke der Vergesellschaftung durch ein Gesetz, das Art und Ausmaß der Entschädigung regelt, in Gemeineigentum oder in andere Formen der Gemeinwirtschaft überführt werden. Für die Entschädigung gilt Artikel 14 Abs. 3 Satz 3 und 4 entsprechend.“

[3] So die Interventionistische Linke (IL): „Unsere erste Aufgabe muss sein, einen nicht-kapitalistischen Wohnungsmarkt denkbar zu machen. Einige Schritte dazu sind bereits getan. So hat eine neue Generation von Mieter*innenprotesten in den letzten zehn Jahren den neoliberalen Ausverkauf unserer Stadt angeprangert und an vielen Stellen ausgebremst. Neue Privatisierungen wurden verhindert, Großprojekte von Investoren gestoppt. Außerdem gibt es neuen Aufbau öffentlichen Eigentums. Doch dies ist noch nicht die Wohnungswende. Unser erstes Ziel muss es daher sein, Bewusstsein zu schaffen, dass nur die Vergesellschaftung des Wohnungsmarktes den Namen ‚Wohnungswende‘ wirklich verdient.“ Broschüre „Das Rote Berlin“ von der IL, S. 33;https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[4] Beschluss für ein Gesetz zur Vergesellschaftung von Grund und Boden (Rekommunalisierungsgesetz): https://dwenteignen.de/2018/11/27/beschlusstext-fertig/; eingesehen am 10.06.2019.

[5] Eine ,Luxuswohnsteuerʻ wäre sinnvolle Umverteilung (…).“; „Das Rote Berlin“ von der IL, S. 19; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[6] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[7] „Das Rote Berlin“ von der IL, S. 3; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[8] Warum es vielen Selbstständigen und auch vielen öffentlichen Bediensteten oft nicht besser geht als den Lohnarbeiter*innen, kann man im folgenden Buch nachlesen: Die Misere hat System: Kapitalismus, S. 141-143. Als Buch zu kaufen oder als PDF umsonst runter zuladen unter: https://gegen-kapital-und-nation.org/page/die-misere-hat-system-kapitalismus/

[9] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[10] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[11] Beschluss für ein Gesetz zur Vergesellschaftung von Grund und Boden (Rekommunalisierungsgesetz): https://dwenteignen.de/2018/11/27/beschlusstext-fertig/; eingesehen am 10.06.2019.

[12] Das Privateigentum einzelner Kapitalist*innen ist zu klein für manche großangelegten, aber vielleicht sehr gewinnträchtigen Geschäftsstrategien. In der Aktiengesellschaft schließen sich Kapitalist*innen zusammen. Sie haben dann als Aktiengesellschafter keine freie Verfügung über das Eigentum der Gesellschaft mehr, kein einzelner Kapitalist kann als Aktiengesellschafter irgendwie über ein paar Häuser verfügen und entscheiden. Stattdessen haben die einzelnen Kapitalist*innen nur den Rechtstitel auf einen Anteil des Gewinns in Form einer Dividende. Dieser Rechtstitel bekommt selber einen Preis in Form von Kurswerten an der Börse. Wenn eine Aktionärin ihr Eigentum verkauft, dann wird nicht ein Haus verkauft, sondern ein Rechtstitel auf Gewinn. Die Aktiengesellschaft ist satzungsgemäß darauf verpflichtet, seinen eigentümlichen Eigentümer*innen einen Gewinn auszuschütten oder aber den Kurswert der Aktien zu steigern – im besten Falle beides zu gleich. Das Finanzkapital ist also eine Vollendung der kapitalistischen Profitrechnung, wenn es die letzte Schranke, die das Kapital in einer fertig befriedeten Klassengesellschaft hat (nämlich seine privateigentümliche Größe), durch die Kooperation von Kapitalist*innen überwindet.

[13] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[14] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[15] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[16] https://www.rbb24.de/politik/beitrag/2019/04/volksbegehren-deutsche-wohnen-enteignen-berlin-brandenburg.html; eingesehen am 10.06.2019

[17] Warum der Profit generell eine maßlose Angelegenheit ist, kann man hier nachlesen: Die Misere hat System: Kapitalismus, drittes Kapitel. Als Buch zu kaufen oder als PDF umsonst runter zuladen unter: https://gegen-kapital-und-nation.org/page/die-misere-hat-system-kapitalismus/

[18] Zitat von einem Plakat der Kampagne. Zu finden unter: https://dwenteignen.de/2019/02/27/entschädigungszahlung/; eingesehen am 10.06.2019.

[19] Ausführlicher wird diese Sorte von Unzufriedenheit hier kritisiert: „Von Schland nach Gauland – Das Krisenprogramm der AfD und seine demokratische Grundlage“, im Abschnitt „Berechtigte Kritik in der Demokratie: Was geht und was nicht geht“, S. 7-10, nachzulesen: https://gegen-kapital-und-nation.org/media/broschüre_schland.pdf

[20] https://www.dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[21] Beschluss für ein Gesetz zur Vergesellschaftung von Grund und Boden (Rekommunalisierungsgesetz): https://dwenteignen.de/2018/11/27/beschlusstext-fertig/; eingesehen am 10.06.2019.

[22] https://www.dwenteignen.de/2019/04/05/eine-antwort-auf-die-wohnungskrise/; eingesehen am 10.06.2019.

[23] https://www.dwenteignen.de/2019/04/05/eine-antwort-auf-die-wohnungskrise/; eingesehen am 10.06.2019.

[24] Liest man das längere Papier „Das Rote Berlin“ der Interventionistischen Linken durch, die die Kampagne als eine Organisation von vielen unterstützt, wird man ebenfalls enttäuscht. Zwar machen auch sie sich einerseits nichts vor: „Denn Spaltung wird die Antwort von Staat und Immobilienkapital sein, um unsere Kämpfe klein zu halten“ (S. 35). Sie kennen also den Staat als Subjekt, das den eigenen Interessen entgegensteht. Und auch über linke Parteien haben sie keine Illusion: „Denn natürlich wird Rot-Rot-Grün seine Wahlversprechen nicht einhalten.“ (S. 35) Was der eigenständige Zweck des Staates oder der Politik ist, was dessen Logik ist, darüber steht in der ganzen Broschüre nichts – und dann doch so einiges, was gleich weiterverfolgt werden soll. https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[25] BImA steht für Bundesanstalt für Immobilienaufgaben.

[26] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 28; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[27] Rouzbeh Taheri (Sprecher des Bündnisses »Spekulation bekämpfen – Deutsche Wohnen & Co. Enteignen«) in einem Interview mit Marx21: https://www.marx21.de/deutsche-wohnen-co-enteignen-spekulanten-berlin-verschrecken/; eingesehen am 16. Juni 2019.

[28] Rouzbeh Taheri (Sprecher des Bündnisses »Spekulation bekämpfen – Deutsche Wohnen & Co. Enteignen«) in einem Interview mit Marx21: https://www.marx21.de/deutsche-wohnen-co-enteignen-spekulanten-berlin-verschrecken/; eingesehen am 16. Juni 2019.

[29] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 14; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[30] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 6; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[31] Siehe hierzu den zweiten Teil des Textes „Gentrification“ von den Gruppen gegen Kapital und Nation: https://gegen-kapital-und-nation.org/media/broschüre_gentrification.pdf

[32] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 35; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————-

Grafikquellen  :

Oben        —         Deutsche Wohnen in Berlin-Wilmersdorf

Abgelegt unter Berlin, Deutschland, Mensch, Umwelt | Keine Kommentare »

Widerspruch gegen „NO5G“

Erstellt von DL-Redaktion am 8. Oktober 2019

WIDERSPRUCH gegen Ihren abschlägigen Bescheid vom 1. Oktober 2019 zu „NO5G für Ravensburg und deutschlandweit“

Ravensburg Blick von Federburgstraße.jpg

Von Stefan Weinert – Ravensburga)

Übergabe per Papierdokument mit Unterschrift bei der Stadtverwaltung (Vorzimmer OB) am Montag, 07. Oktober 2019, gegen Empfangsbestätigung – erledigt  — b) per Email am 7. Oktober 2019 mit Verteiler RP Tübingen, Stadträte, 5G+ [bcc]

Sehr geehrter Herr Oberbürgermeister Dr. Rapp, sehr geehrte Herr Bürgermeister Blümcke,

sehr geehrter Herr Bürgermeister Bastin, sehr geehrte Damen und Herren des Verwaltungs- und Wirtschaftsauschuss’ Ravensburg,

hiermit lege ich WIDERSPRUCH gegen Ihren abschlägigen Bescheid (Aktenzeichen wurde nicht vergeben) vom 1.Okoiber 2019 ein. Ihr Verwaltungsakt richtet sich gegen meine Petition „NO 5G in Ravensburg und deutschlandweit“. Mein Widerspruch gegen Ihren Bescheid gliedert sich in vier Punkte:

  1. Die von mir im Juli 2018 initiierte Petition, war und ist zum Zeitpunkt der Entscheidung Ihres Verwaltungs- und Wirtschaftsausschuss‘ (VuW) am 30. September 2019 noch gar nicht abgeschlossen, was Ihnen aber bekannt war. In meinem – an den Herrn OB gerichteten Anschreiben  vom 15. Juli 2019 heißt es: „Weitere Unterschriften dieser Petition  übersende ich Ihnen zu einem späteren Zeitpunkt.“ Am 15. Juli  2019 hatte die Petition 2.320 Unterschriften. Zum Zeitpunkt der Abfassung dieses Widerspruchs sind es jedoch 3.939 Unterschriften , darunter neue und zusätzliche handschriftliche aus Ravensburg und dem Umland. Diese insgesamt zusätzlich 1.619 Gegner/innen (70 Prozent Zuwachs) von 5G in Ravensburg und deutschlandweit hatten demnach keine Chance,  bei Ihrer Entscheidung berücksichtigt zu werden und diese zu beeinflussen. Über die immer noch (wie Sie wussten) geöffnete Petition hätten Sie zum 30. September 2019 demnach gar nicht abschließend entscheiden dürfen. Gegen diesen Tatbestand richtet sich mein Widerspruch in Punkt 1.
  2. Die Petition lautet offiziell „NO5G – in Ravensburg und deutschlandweit“ und in ihrer  „Präambel“  heißt es ausdrücklich: „WIR – DIE UNTERZEICHNERINNEN UND UNTERZEICHNER DIESER PETITION – SPRECHEN UNS ENTSCHIEDEN GEGEN DIE IMPLEMENTIERUNG DER 5G-MOBILFUNKSTRAHLUNG IN UND UM RAVENSBURG AUS.  WIR LEHNEN DIESE GIGA[N]TOMIE NICHT NUR FÜR UNS, SONDERN AUCH BUNDESWEIT OHNE „WENN UND ABER“ AB. –  WIR ALLE BITTEN DIE RAVENSBURGER VERWALTUNGSSPITZE UND DIE VERANTWORTLICHEN JEDER KOMMUNE IN DEUTSCHLAND, VON DIESER MASSNAHME ABSTAND ZU NEHMEN. DENN DIE UNSICHTBAREN STRAHLEN DER 5G-MOBILFUNKTECHNIK GENERIEREN NACHWEISBAR GESUNDHEITSSCHÄDEN UND KRANKHEITEN BIS HIN ZUM TOD (KREBS)“.

In meinem o. e. Schreiben vom 15. Juli 2019 schrieb ich deshalb auch: „Auch wenn nicht alle Unterschriften direkt aus Ravensburg, dem Schussental, dem Landkreis Ravensburg oder dem PLZ-Gebiet „88“ kommen, so solidarisieren sich doch  alle Mitpetent/innen mit dem Anliegen, auch in 88212/14 Ravensburg keine 5G –Mobilfunktechnik einzuführen.“ – Wenn es nun  in Ihrem Bescheid heißt: „Seitens der Stadt Ravensburg konnte der Petition nicht abgeholfen [Anm. unterstrichen] werden,“ dann übersteigt das Ihre Kompetenz. Sie können zwar „der Petition – insofern sie die Stadt Ravensburg betrifft – abschlägig bescheiden“, nicht aber grundsätzlich, wie Sie es aber getan haben. Gegen diesen Tatbestand richtet  sich mein Widerspruch in Punkt 2.

3a. Als Begründungen für Ihren abschlägigen Bescheid führen Sie zum einen an, dass „allein die Bundesnetzagentur  für die Erfüllung der dort festgelegten Aufgaben zuständig“ sei, und zum anderen schreiben Sie: „Städtische Zuständigkeiten zum neuen Mobilfunkstandard sind ausschließlich in den Bereichen des Bauplanungs- und Bauordnungsrechts gegeben. Sofern aber die gesetzlich vorgeschriebenen Grenzwerte für Mobilfunkanlagen eingehalten werden und keine weiteren baurechtlichen Vorgaben bestehen, hat die Kommune nicht die Möglichkeit, eine lokale Einführung des 5G-Mobilfunkstandards gänzlich zu verhindern.“

Sie berufen sich bei der ablehnenden  Haltung  zur Petition „NO5G“  auf die Bundesnetzagentur und das  Bauplanungs- und Bauordnungsrecht, und unterschlagen dabei Wichtiges und Unabdingbares, das in Ihrer Verantwortung steht, Sie aber unterlassen haben, zu tun. Ich verweise in meinem Widerspruch zu diesem Punkt auf die Bauleitplanung und den § 1 BauGB., die durch zu führen und zu beachten in Ihrer Verantwortung stehen. Für die Aufstellung von Bauleitplänen sind die Gemeinden in kommunaler Selbstverwaltung zuständig und haben somit die kommunale Planungshoheit. Im Rahmen der Gesetze können Sie als Stadt Ravensburg somit ihre städtebauliche Entwicklung eigenverantwortlich steuern. Sie unterliegen dabei aber der Rechtsaufsicht höherer Verwaltungsbehörden und der Normenkontrolle der Justiz. Bei der Bauleitplanung müssen Sie als Gemeinde Ravensburg  Ziele der Raumordnung, die sich aus Raumordnungsplänen ergeben, beachten. § 1 Abs. 4 BauGB spricht hier von der  Anpassungspflicht, sowie von öffentlichen und privaten Belangen, die zu berücksichtigen sind (§ 1 Abs. 7 BauGB, Abwägungs­pflicht).

Ravensburg Hochhaus Osten.jpg

  • 1 BauGB stellt im Übrigen auch und vor allem hohe Anforderungen an die Bauleitplanung. Nach den dort festgelegten Grundsätzen sollen Bauleitpläne u. a. dazu beitragen, eine menschenwürdige Umwelt zu sichern und die natürlichen Lebensgrundlagen zu schützen und zu entwickeln. Zum Beispiel ist in § 1 Abs. 6 Nr. 7 festgelegt, dass bei der Aufstellung der Bauleitpläne „die Belange des Umweltschutzes, des Naturschutzes und der Landschaftspflege, insbesondere des Naturhaushaltes, des Wassers, der Luft und des Bodens einschließlich seiner Rohstoffvorkommen sowie das Klima“ zu berücksichtigen sind. Die Bauleitplanung wird daher in der Regel durch die Landschaftsplanung naturschutzfachlich begleitet und enthält regelmäßig einen gesonderten Umweltbericht.. Gegen diese, in Ihrer Beurteilung zu 5G unterlassene Versäumung und Nichtbeachtung der Bauleitplanung und den Vorschriften des  § 1 BauGB richtet sich mein Widerspruch in Punkt 3a. Eine Verfassungsbeschwerde und eine Klage wegen unterlassener Hilfeleistung behalte ich mir vor.

3b. Wie Ihnen bekannt, wird die 5G-Mobilfunktechnik unter den Profis, wie beispielsweise Ärzten, Strahlentechnikern, Umweltverbänden, Arbeitskreisen, Organisationen und  Sachverständigen sehr kontrovers diskutiert, und es ist noch lange nicht klar, in welchem Maße die 5G-Strahlung menschliches Leben, die Fauna und Flora gefährdet. Dass die 5G-Tehnik das Lebende allerdings gefährdet ist erwiesen und steht außer Frage, und Sie als Stadtverwaltung gestehen das ja auch an mehren Stellen selbst ein. Dennoch haben  Sie unter dieser Prämisse und auch der Ihnen  zu diesem Zeitpunkt schon bekannten Proteste aus der Bevölkerung trotzdem am 18. Februar 2019 beschlossen (Gemeinderatsbeschluss), „um das Geschehen aktiv mitbestimmen zu können, strebt die Stadt Ravensburg an, als Pilotkommune die Einführung  des 5G-Standards wissenschaftlich begleiten zu lassen. Dabei soll geprüft werden, ob eine Steuerung der Mobilfunkversorgung unter gesundheitlichen Aspekten möglich ist, etwa die Möglichkeit zur Einrichtung möglichst strahlungsarmer Bereiche für elektrosensible Menschen.“ (Zitiert aus Ihrem Brief vom 1. Oktober 2019).

Dazu ist zu bemerken, dass – wenn die 5G-Strahlung die Gesundheit gefährdet, bis hin zur Krebserkrankung, dies  dann aber – im Sinne der Bioethik – allem Lebenden gegenüber gilt. Im Gegensatz  zur Schädigung der Fauna und Flora, die juristisch allerdings leider nur als „Sachbeschädigung“ (bei Tieren) eingestuft wird, handelt es sich bei den mehr als 51.000 Frauen, Männern, Säuglingen, Kindern, Schüler/innen, Auszubildenden, Studenten, Erwachsenen und Pflegebedürftigen um MENSCHEN.

Jene alle eben aufgezählten Vertreter des homo sapiens, vor (prä) der eigentlich dringend notwendigen, vorsorglich allgemeinen Prüfung (gesetzlich verankertes Vorsorgeprinzip) der gefährlichen Technologie 5G, in den Feldversuch zu schicken, ist skandalös, kriminell  und auch unzulässig. Dagegen richtet sich mein Widerspruch in Punkt 3b. Auch in diesem Punkt behalte ich mir eine Verfassungsbeschwerde und eine Klage wegen unterlassener Hilfeleistung vor.

Die Petition „NO5G in Ravensburg und deutschlandweit“ bleibt bis zum 31. Dezember 2019, 24:00 Uhr geöffnet und kann bis zu diesem Zeitpunkt unterzeichnet werden.

Ich bitte, meinen Widerspruch  zeitnah zu bearbeiten.

Mit freundlichen Grüßen

Stefan Weinert

Hier geht es   >>>     Zur Petition auf Change  <<<

—————————————————————

Grafikquellen        :

Oben      —        Ravensburg Blick von der Federburgstraße (Höhe Urbanstraße) über die Südstadt zur Altstadt

Abgelegt unter Baden-Württemberg, Deutschland, Opposition, Umwelt | Keine Kommentare »

Atomkraftgegnerin in Lingen

Erstellt von DL-Redaktion am 6. Oktober 2019

Gefährden Rollstuhlfahrer*innen die Polizei?

File:Demo gegen Brennelemntefabrik Lingen – 31.1.2016 (24403116379).jpg

Absurder Prozess gegen Atomkraftgegnerin in Lingen

Quelle          :      untergrund-blättle   CH.

Von  pm

Am 8.10. wird vor dem Amtsgericht ein absurd anmutender Fall verhandelt: Eine auf ihren Rollstuhl angewiesene Person soll Widerstand gegen die Polizei geleistet haben, in dem sie die Rollstuhlhandbremse angezogen habe.

Im Strafbefehlsverfahren hatte das Gericht exakt das verurteilt, nur aufgrund des Einspruchs der Rollstuhlfahrerin kommt es jetzt zum Prozess am Amtsgericht Lingen.

Allein betrachtet ist der Vorwurf einfach diskriminierend und nur mit einem gewissen Humor zu ertragen. So erklärt die Angeklagte Cécile: „Die Handbremse beim Rollstuhl ist dazu da um stehen zu bleiben, so wie Fussgänger*innen anhalten, muss ich eben die Handbremse anziehen. Werden jetzt auch alle Fussgänger*innen angeklagt, die im Weg stehen bleiben? Oder ist es einfach politische Verfolgung?“

Wirklich Verstehen lässt sich der Vorwurf wohl nur mit einigem Hintergrund. Im Januar gab es in Lingen eine Anti-Atom-Demonstration gegen die Brennelementefabrik und das Atomkraftwerk. Am Rande kletterten zwei Aktivistinnen auf das Rathaus-Vordach und zeigten dort ein Transparent. Der Atomstadt Lingen und der eilends herbeigeeilten Polizei passte das gar nicht und als die beiden vom Dach herabkamen, wurden sie kurzer Hand festgenommen. Dagegen protestierte die jetzt Angeklagte wortreich – ein Transparent auf dem Rathausdach, eine Gefährdung der öffentlichen Sicherheit? Die Beteiligten sehen viel mehr den Brand in der Brennelementefabrik wenige Wochen zuvor als Gefährlich an. Angeklagt wird nicht der Betreiber ANF, der unser Leben gefährdet, sondern Menschen, die daran erinnern.

Die Polizei war genervt vom Protest und konnte an der Kletteraktion selbst nichts Strafbares finden. Resultat sind drei Strafverfahren wegen Widerstands gegen Vollstreckungsbeamte, gegen die beiden Kletterer*innen und eben die nervige Rollstuhlfahrerin. „Wie so oft, soll hier unliebsamer Protest in der Atomstadt unterdrückt werden. Wenn sonst nichts funktioniert, wird eben ein Widerstand herbeikonstruiert – da muss dann auch schonmal eine Rollstuhlhandbremse herhalten.

Das ist so absurd, dass es schon fast wieder witzig wäre – würde es nicht reale Strafen für die Betroffenen nach sich ziehen.“ erklärt Unterstützerin Irene, „Es ist bezeichnend, dass Gerichte in ihrer Verteidigung der Atomfabriken und der Unterbindung jeglichen Protests gegen die herrschende Ordnung soweit gehen, Sondergesetze für Menschen, die nicht laufen können, auszulegen. Vertrauen in diesen Staat ist fehl am Platz, wenn wir für eine lebenswerte Welt ohne Atom- und Kohlestrom streiten.“

Die Anti-Atom-Aktiven fordern deshalb alle auf, selbst aktiv zu werden, die Angeklagte beim Prozess zu unterstützen oder bei der Demonstration in Lingen am 26.10. auf die Strasse gegen die umweltzerstörische Atomkraft zu gehen.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————————–

Grafikquelle       :        Rund 130 Menschen nahmen im Januar 2016 die Pannenserie in den belgischen AKW Thiange und Doel zum Anlass, in Lingen gegen die dortige Brennelemente Fabrik zu demonstrieren. Die von der ANF (AREVA) betriebene Anlage beliefert Atomkraftwerke in aller Welt, darunter in Belgien und Frankreich. Rund 30 AktivistInnen blockierten dann am frühen Montag für ca. 5 Stunden die Anlage.

ROBIN WOOD (CC BY-SA 4.0

This image was originally posted to Flickr by ROBIN WOOD e.V. at https://flickr.com/photos/45283546@N04/24403116379. It was reviewed on by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc-by-2.0.

Abgelegt unter APO, Energiepolitik, Niedersachsen, Umwelt | Keine Kommentare »

Kolumne die eine Frage

Erstellt von DL-Redaktion am 5. Oktober 2019

Die neue Kraft der jungen Frauen

Von Peter Unfried

Was meint der New Yorker Schriftsteller Jonathan Safran Foer damit, dass wir nicht an die Erderhitzung „glauben“?

assen wir die großartige Greta Thunberg zunächst kurz in Frieden und ­reden über etwas wirklich Unangenehmes.

Über uns.

Der New Yorker Schriftsteller Jonathan Safran Foer hat eine spektakulär logische These, was unsere bisherige Unfähigkeit angeht, die immer größer werdende Bedrohung durch die Erderhitzung ernst zu nehmen. Wir glauben es nicht.

Doch, doch: Wir wissen es. Aber wir glauben es nicht.

Spoiler: Foer redet hier nicht von Donald Trump, der AfD und dem klaren Akt des Leugnens. Er redet von denen, die die Wirklichkeit mit dem Kopf akzeptieren und bei Partys, beim Abendessen oder bei Grünen-Parteitagen gepflegt darüber reden, was mit einer kaum gebremsten Erderhitzung auf uns zukommt: schrumpfende Wirtschaft, soziale Verwerfungen, dramatisches Artensterben, über 100 Millionen Klimaflüchtlinge, brutale Klimakriege, untergehende Mil­lio­nenstädte und Staaten. Aber in der Wirklichkeit geht auch bei uns alles „normal“ weiter.

„Wenn wir die Tatsache, dass wir den Planeten zerstören, zwar akzeptieren, sie aber nicht glauben können, sind wir nicht besser als die, die den menschengemachten Klimawandel ganz verleugnen“, schreibt er in seinem Buch „Wir sind das Klima!“. Das ist die Begründung für den „Merkel ist schlimmer als Trump“-Gedanken von Klimapolitik-Aktivistin Luisa Neubauer. Die entscheidende Differenz ist nicht rational akzeptieren oder nicht, sondern Handeln und Nichthandeln.

Quellbild anzeigen

Aber was meint Foer damit, dass wir es wissen und nicht „glauben“? Ich dachte bisher, es geht genau darum: eben nicht nur glauben, sondern wissenschaftliche Fakten zugrunde zu legen.

Foer erzählt die Geschichte seiner jüdischen Familie, die in einem polnischen Dorf lebte. Alle wussten, was die Nazis tun würden. Aber nur seine Großmutter packte 1941 ihre Sachen und floh. Der Rest blieb, weil er dachte, das würde schon irgendwie weitergehen. Sie wurden alle ermordet.

Quelle       :         TAZ          >>>>>          weiterlesen

————————————————————————

Grafikquellen         :

Oben         —         Luisa Neubauer auf der TINCON @ re:publica 2019

Urheber Elke Hollmann
Diese Datei wird unter der Creative-Commons-Lizenz „CC0 1.0 Verzicht auf das Copyright“ zur Verfügung gestellt.
Die Person, die das Werk mit diesem Dokument verbunden hat, übergibt dieses weltweit der Gemeinfreiheit, indem sie alle Urheberrechte und damit verbundenen weiteren Rechte – im Rahmen der jeweils geltenden gesetzlichen Bestimmungen – aufgibt. Das Werk kann – selbst für kommerzielle Zwecke – kopiert, modifiziert und weiterverteilt werden, ohne hierfür um Erlaubnis bitten zu müssen.

 

Abgelegt unter APO, International, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Damals und heute :

Erstellt von DL-Redaktion am 5. Oktober 2019

Wunderwaffen :
Klimawandel, Atomkraft & Krieg gegen die Natur

Castle Union.jpg

Quelle      :       Scharf  —  Links

Von Axel Mayer, BUND Südlicher Oberrhein

Als der bisher letzte Weltkrieg schon längst verloren war, setzte die Propaganda in Deutschland mit Durchhalteparolen auf die „neuen Wunderwaffen“, mit denen der aussichtslose Krieg doch noch gewonnen werden sollte und viele Menschen in Deutschland hofften bis zuletzt auf den vermeintlichen „Endsieg“.

Auch im heutigen globalen Krieg gegen die Natur (Artensterben, Klimawandel, Atommüllproduktion, Ressourcenverschwendung, Atom- und andere Massenvernichtungswaffen….) setzen die politisch Verantwortlichen für die große globale Zerstörung auf den alten neuen Mythos der Wunderwaffen, allerdings unter neuen Bezeichnungen.

Klimawandel, Artensterben, Endlichkeit der Ressourcen? Einfach weitermachen wie bisher!

Der menschengemachte Klimawandel soll mit Atomkraft und Geoengineering bekämpft werden und aussterbende Arten werden mit Gentechnik wieder erschaffen. Das Verkehrsproblem wird mit Lufttaxis angegangen. Der fehlerhafte, menschliche Mensch wird mit Technik nach den Ideen des Transhumanismus überwunden und durch den neuen, perfekten Übermenschen ersetzt. Irgendwann werden wir mit Raumschiffen die zerstörte Welt hinter uns lassen und neuen, unverbrauchten Planeten und neuen Mythen entgegen fliegen…

Der Glaube an die vermeintlichen Wunderwaffen hat die Opferzahlen und das Leid in den letzten Kriegsjahren des bisher letzten Weltkrieges massiv vergrößert. Die von Konzernen, Lobbyisten, neoliberalen Netzwerken, Transhumanisten, von industriegelenkten Bürgerinitiativen, Ökooptimisten und der Nuclear Pride Coalition angepriesenen Wunderwaffen im aktuellen Krieg gegen die Natur werden die bestehenden Probleme und das Leid vergrößern.

Briksdalsbreen Norway 2003 & 2008.JPG

Es geht nicht um Technikfeindlichkeit. Gerade die Umweltbewegung hat in den letzten Jahrzehnten den technischen Fortschritt immer wieder menschengerecht optimiert. Es geht um einen nicht hinterfragten, industriegelenkten Fortschrittsglauben und um die globale Wachstumsreligion vom unbegrenztem Wachstum im begrenzten System Erde.

Der umweltfreundliche Teil der uns zur Verfügung stehenden modernen Technik, klug und menschenfreundlich angewandt, könnte menschengerechten Fortschritt ermöglichen. Warum sollen wir z. Bsp. auf eine gefährliche, teure Hochrisikotechnologie wie den Thorium Reaktor setzen, wenn wir kostengünstige, umweltfreundliche Alternativen haben aus denen sich keine Atombomben bauen lassen? Häufig bekämpfen die gut organisierten Verfechter des „weiter so“ aggressiv die umweltfreundlichen, zukunftsfähigen Alternativen.

Eine positive Wende für Mensch, Natur und Umwelt wäre eine menschen- und umweltfreundliche, nachhaltige und gerechte Umgestaltung der Welt, Energiegewinnung aus alternativen Energiequellen, ein Ende des zerstörerischen Wachstumspfades und der Massenvernichtungswaffen, mehr globale Gerechtigkeit, eine Beendigung der Kriege und das gute Leben mit einem massiv verringerten Input an Energie und Rohstoffen. Das mit den neuen Wunderwaffen angestrebte -weiter so- ist zutiefst zerstörerisch. „Die Welt hat genug für jedermanns Bedürfnisse, aber nicht für jedermanns Gier“ sagte schon der weitsichtige Mahatma Gandhi.

Axel Mayer, BUND-Geschäftsführer, Vizepräsident TRAS,

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————-

Grafikquellen      :

Oben      —        Nuclear weapon test Union (yield 6.9 Mt) on Bikini Atoll. The test was part of the Operation Castle.

Abgelegt unter International, Kriegspolitik, Kultur, Umwelt | Keine Kommentare »

Urzeitliche Inselbewohner

Erstellt von DL-Redaktion am 4. Oktober 2019

Der Fund stellt die Evolutionsgeschichte auf den Kopf

Blick auf die Tabon-Höhlen

Von Lea Ebeling

Der Fund einer neuen hominiden Spezies auf den Philippinen gilt als einer der wichtigsten archäologischen Funde der letzten Jahre. Er stellt die Evolutionsgeschichte auf den Kopf.

„Als mein Kollege Dr. Piper mich aus dem Labor anrief und mir mitteilte, dass ich menschliche Überreste gefunden hatte, sind wir rausgegangen und haben uns betrunken“, sagt Armand Salvador Mijares, Leiter des internationalen Forschungsprojektes, das für den Fund einer neuen menschlichen Spezies auf den Philippinen verantwortlich ist.

Mijares promovierte in Archäologie und Paläoanthropologie an der Australian National University (ANU) und ist Professor an der University of the Philippines. Bereits 1998 begannen seine Ausgrabungen in der Callao-Höhle in der Region Peñablanca auf Luzon in den Philippinen. Das Team war klein aber international. Mijares wurde unterstützt von Florent Détroit, Paläoanthropologe am Muséum national d’histoire naturelle in Paris, Rainer Grun, Professor der Geochronologie an der Griffith University Queensland und Philip Piper, Archäozoologe und Paläoökologe an der ANU.

Zunächst fanden sie nur tierische Überreste von Rehen, Mäusen, Wildschweinen und Wasserbüffeln, die über 60.000 Jahre alt waren. Doch das menschliche Leben war in ihre Knochen eingeschrieben, denn die Fossilien wiesen klare, v-förmige Schnittstellen auf, die nur durch den Gebrauch menschlicher Werkzeuge entstanden sein konnten. Sie fanden zwar keine Steinwerkzeuge, aber Hornsteinsplitter, die als solche genutzt werden konnten. Also grub das Team weiter.

Inspiration aus Indonesien

Es waren nicht die ersten philippinischen Ausgrabungen. In den 1970er Jahren entdeckte der amerikanische Historiker Robert B. Fox menschliche Überreste mehrerer Individuen in der Tabon-Höhle auf der Insel Palawan. Damals war es unüblich, weiter als zwei Meter tief zu graben, da dies sehr kostspielig und mit erhöhten Sicherheitsrisiken verbunden war.

In den 90er Jahren begann der australische Anthropologe Mike Moorwood Ausgrabungen auf der indonesischen Insel Flores, auf der schon seit den 50er Jahren immer wieder Werkzeuge und tierische Fossilien entdeckt worden waren. 2003 grub er tiefer als gewöhnlich und beförderte in der Höhle Liang Bua eine menschliche Schädelkappe und diverse Knochen zutage.

File:Callao Cave.jpg

Der Fund war eine Sensation. Bisher hatte man geglaubt, dass erst der Homo sapiens die Insel Flores besiedelt haben konnte, da sie nie Teil der asiatischen Kontinentalplatte gewesen war und man seinen Vorgängern eine Seeüberfahrt nicht zugetraut hatte. Der über 60.000 Jahre alte Homo floresiensis widersprach dieser Theorie.

Eine neue Spezies?

Auch Luzon war nie Teil des asiatischen Festlandes und stets von Wasser umgeben. 2007 kehrte Mijares, inspiriert von den indonesischen Funden, in die Callao-Höhle zurück, um tiefer zu graben. Es war in diesem Jahr, als Piper ihn während der Analyse der tierischen Fossilien anrief und ihm mitteilte, dass er den dritten Mittelfußknochen eines menschlichen Lebewesens gefunden hatte.

Ein Rätsel, denn er ließ sich mit keiner bisher bekannten hominiden Spezies vollständig vergleichen. Mijares veröffentlichte den Fund, doch die Wissenschaft wies ihn zurück. Ein einzelner Knochen war noch nicht genug. Mit internationaler Finanzierung setze er seine Ausgrabungen fort und hatte Glück. 2011 fand das Team zwei Handknochen, zwei Fußknochen, mehrere Zähne und Teile des Oberschenkelknochens eines Kindes, 2015 einen weiteren Backenzahn.

Quelle       :          TAZ         >>>>>         weiterlesen

——————————————————————

Grafikquellen     :

Oben        —       Blick auf die Tabon-Höhlen

Alexcooper1 (Diskussion · Beiträge) • CC BY-SA 3.0

—————————

Unten     —            Inside the firth chamber of Callao Cave in Peñablanca, Cagayan. Photo was taken during Schadow1 Expeditions mapping project in Cagayan Valley.

Author Ervin Malicdem

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

Abgelegt unter Asien, Bildung, Kultur, Umwelt | Keine Kommentare »

Climate: Justice – Chaos ?

Erstellt von DL-Redaktion am 4. Oktober 2019

Wetterfeste FFF Bewegung

Quelle      :  Scharf  —  Links

Von Jimmy Bulanik

Das Thema von FFF ist das Klima. Deshalb gilt es für die Bewegung unabhängig an Lebensjahren, Raum der Sozialisierung, gegenwärtiger Aufenthaltsort (wie von Besucherinnen und Besucher einer Messe oder Touristinnen und Touristen), Bildungsgrad, soziale Stellung in der Gesellschaft und Wohnorten mit ihrer Wetterfestigkeit wie der aktuell bevorstehenden Herbstferien auch zur Weihnachtsferien, Weihnachtszeit 2019, im Übergang zum Jahr 2020 das bestehende Ausmaß an Entschlossenheit öffentlich und medial unter Beweis zu stellen. Das stärkt ihre bereits bestehenden Glaubwürdigkeit im Inland als auch im Ausland. Sofern die Menschen in der Bundesrepublik Deutschland weiter unbeirrt Freitags für das Klima demonstrieren, desto höher die Chance das die Menschen im EU Ausland es vor Ort gleich handhaben werden.

Insbesondere die Menschen in Großstädten mit ihrem vorhandenen ÖPNV stehen in der Verantwortung. Ebenfalls wichtig dabei ist, dass von allen Landeshauptstädten, der Bundeshauptstadt Berlin, den EU Großstädten und EU Hauptstädten ein sichtbares und hörbares Signal ausgesendet wird, das weltweit nicht zu ignorieren ist. Jene Menschen welche im Umland einer Landeshauptstadt, Großstadt, EU Hauptstadt wohnen haben die Option eine Gemeinschaft zu bilden um gemeinsam in einer Großstadt vor Ort an den FFF Veranstaltungen teilzunehmen. Um Hürden abzubauen, gerne sich an die eigene Familie, Freundeskreis, ein (Sport) Verein, die Gewerkschaft oder eine Partei zu wenden um nach Unterstützung zu fragen. Einen Mangel an Fahrräder wird es mit Sicherheit nicht geben. Eine weitere Möglichkeit besteht darin Geld zusammenzulegen damit mehrere Personen auf ein ÖPNV Ticket fahren dürfen. Was allen offen steht ist die Menschen im persönlichen Zirkel, Zirkeln in jeglicher Form der analogen, digitalen Form der Kommunikation zu motivieren auch an den FFF Demonstrationen teilzunehmen. Die Bundesrepublik Deutschland hat viele Rentnerinnen und Rentner, Pensionärinnen und Pensionäre dessen Bedeutung an politischen Wahlen stetig wächst.

In der Thematik der Verschmelzung von Ökologie, Ökonomie und Soziales insbesondere in Verbindung mit der Digitalisierung befindet sich erheblich viel an positiver und progressiver Macht. Mitunter die Behandlung einer globalen Frage des bestehenden und zukünftigen System. Dies darf gerade in global volatilen Zeiten zu keinem Zeitpunkt unterschätzt werden und immer richtig eingeordnet. Menschen die an Kapitalmärkten, Banken, Unternehmungen dahinter arbeiten wissen dies nur zu präzise. Deshalb ist es ratsam das teilnehmende Personen an den FFF Demonstrationen mittels des dem Smartphone, Laptop, dem Internet ungefiltert Öffentlichkeit schaffen. Für die Qualität sind alle selbst verantwortlich und können sich dahingehend gemeinsam und gegenseitig fachlich optimieren.

Die Motive zur Teilnahme an den FFF Demonstrationen gibt es genug. Die neueste Augenwischerei der gegenwärtigen Bundesregierung in Sachen Klimapolitik ist aktuell lediglich eines davon.

Die innerdeutsche Landschaft der politischen Parteien wird die Entwicklung der FFF Demonstrationen bemerken. Es obliegt allen Menschen ob sie und ihre legitimen Inhalte und Ziele von der bestehenden Bundesregierung weiter ernst genommen werden oder ob die Parteien der neoliberalen FDP und der menschenverachtenden AfD, dessen Funktionär Höcke laut Gericht als Faschist betitelt werden darf bei ihren bevorstehenden Veranstaltungen zum Karneval im Jahr 2020 im Fernsehen in der Live Übertragung wie beispielsweise der politische Aschermittwoch hämische Witze auf Kosten von über 1,4 Millionen Menschen in der Bundesrepublik Deutschland, weitere Millionen Menschen in der Europäischen Union und weltweit der FFF, Klima Demonstrantinnen und Demonstranten artikulieren und obendrein dafür noch Applaus bekommen werden und beim geneigten Publikum lautes Gelächter auslösen werden. Die deutsche und internationale Industrie wie zum Beispiel der Automobilindustrie, Pharma Konzerne  würde es ihren Erfüllungsgehilfinnen und Erfüllungsgehilfen in den politischen Parteien mittels Aufträge, Posten und monetäre Zuwendungen danken.

Daher ist es allen möglich sich wetterfeste Kleidung anzuziehen, sich ökologisch und gerecht gehandelten vegetarisch oder veganen Proviant vorzubereiten und Fairtrade Kaffee, Kräutertee in einer Thermokanne auf die FFF Demonstrationen mitzunehmen. Von Menschen aus Südkorea habe ich vor vielen Jahren in meinem Leben gelernt, das diese ziemlich gerne eine warme Suppe in einer Thermokanne transportieren um dies außer Haus zu genießen. Vielleicht ist dies in kalten Zeiten auch etwas für die Menschen im Herzen oder Westen von Europa, bzw. der Europäischen Union.

Quelle:

https://fridaysforfuture.de

Bodo Wartke – Hambacher Wald

https://www.youtube.com/watch?v=tTKcnlp0x_Y

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————-

Grafikquelle      :

Wellington, Neuseeland, 15. März 2019

Abgelegt unter APO, International, Köln, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 3. Oktober 2019

Mit Wutantrieb ruckzuck das Klima retten

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Nina Apin

Es war die Woche der ganz großen Gefühle: Zu Hause erregte ein in Plastikfolie verpacktes Fladenbrot, von der berufstätigen Mutter eilig auf dem Heimweg aufgegabelt, die Wut der Tochter. Plastikfolie – how dare you, Mama?! Sämtliche Einwände (ist eine Ausnahme, Schatz, du weißt, dass ich sonst immer einen Leinenbeutel dabei habe und im Bioladen einkaufe, außerdem hatte ich einen Laptop in der Tasche, der soll nicht vollgekrümelt werden) werden ungnädig beiseite gewischt: Mutti hat’s verkackt.

Ungebremst alles rauslassen, die Wut, den Frust, die Verzweiflung über die Erwachsenengeneration, die es einfach nicht hinkriegt mit der Klimawende: Diese Herangehensweise hat auch Greta Thunberg, immerhin sechs Jahre älter als meine Tochter, für ihre Rede vor den Vereinten Nationen gewählt. Viele, vor allem diejenigen, die seit Jahren, wenn nicht Jahrzehnten für den Umweltschutz kämpfen, fanden das großartig: Endlich kommt mal Schwung in die festgefahrene Debatte! Und wer lässt sich nicht zum Umdenken bringen von den Tränen eines jungen Mädchens?

Nun, zum Beispiel Donald Trump. Der Klimaleugner ist einer geblieben, auch nach seinem Überraschungsbesuch beim Klimagipfel. Für die Trägerin des alternativen Nobelpreises hat er nur Sarkasmus übrig. „Sie scheint mir ein sehr glückliches junges Mädchen zu sein, das sich auf eine fröhliche, wunderbare Zukunft freut. Das ist so schön zu sehen!“, twitterte er. Widerlich, klar. Aber die Tränen der G. waren für D. T. und seine Freunde im Geiste eben auch eine Steilvorlage: Seht, wie hysterisch diese ganze Klimabewegung ist!

Faschingsumzug Heidelberg - Angela Merkel - 2017-02-28 15-51-19.jpg

Prima – gutes Klima. Ein Narr welcher sich nicht mit fremden Federn schückt.

Leider ist sie das auch in Teilen. Wer auch nur ansatzweise Kritik übt an der Angst-und Verzichtsrhetorik der Klimaretterbewegung, kriegt gleich sein Fett ab: Alles Penner bei der taz, die „gar nichts verstanden“ hätten – so reagierten LeserInnen Mitte der Woche auf eine Seite, auf der taz-RedakteurInnen persönlich Stellung bezogen zum Thunberg-Hype. Einer wollte gar seine langjährige „Beziehung“ zur taz beenden – nur weil drei von sieben Beiträgen kritische Töne anschlugen. Wenn nicht mal mehr Menschen, die einander im Grunde zugetan sind, eine abweichende Sichtweise aushalten können, dann ist die Debattenfähigkeit im Keller.

Quelle         :          TAZ            >>>>>         weiterlesen

—————————————————————-

Grafikquellen       :

Oben    —    Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Feuilleton, International, Kultur, Umwelt | Keine Kommentare »

Ein Stadtgespräch aus Essen

Erstellt von DL-Redaktion am 1. Oktober 2019

RWE baut das Portfolio um – Heuchlerische Pläne

Kuckum.jpg

Von Ingo Arzt

Die RWE feiert sich dafür, dass man jetzt auf Ökoenergien macht. Dabei ist der Konzern viel zu spät dran und zerstört weiterhin Dörfer für die Kohle.

Sie nennen sich „Menschenrecht vor Bergrecht“ und hatten zumindest am Montag keine Chance gegen RWE: Der Essener Energiekonzern generierte eine Menge positiver Schlagzeilen an der Börse und in der Wirtschaftspresse. Am Morgen präsentierte Vorstandschef Rolf Martin Schmitz die Neuaufstellung des Konzerns und bastelte daraus eine Jubelmeldung.

Fast zeitgleich schickten Anwohner*innen des Tagesbaus Garzweiler II einen Brief an Schmitz. Sie forderten eine „Klarstellung, dass in Zeiten des beschlossenen Kohleausstiegs und der Klimakrise keine Dörfer mehr für den Kohleabbau zerstört werden dürfen“. Der Konzern will die Orte Keyenberg, Kuckum, Berverath, Ober- und Unterwestrich und weitere trotz Kohleausstiegs zerstören und abbaggern. Das, obwohl Berechnungen etwa des Deutschen Instituts für Wirtschaftsforschung ergeben haben, dass für die Restlaufzeit der Kraftwerke bis 2038 mehr als genug Kohle in den vorhandenen Tagebauen abgebaut werden kann.

Schmitz‘ Konzernumbau ist deshalb heuchlerisch. Bis 2040 will er RWE „klimaneutral“ und zu einem weltweiten Player für erneuerbare Energien machen. Bereits 2018 hat RWE dabei mit Eon, dem zweiten großen deutschen Energiekonzern, das Terrain in Sachen Energiewende abgesteckt: Die beiden Energiealphatiere haben die Eon-Tochter Innogy unter sich aufgeteilt. Eon bekommt die Stromnetze, die wegen der Energiewende digitaler und intelligenter werden müssen, und außerdem das Geschäft mit den Endkunden, also uns. RWE übernimmt dafür komplett die Stromerzeugung aus erneuerbaren Energien von Eon und Innogy.

20170613 xl P1120777-Ostsee-Windpark-zwischen-Deutschland-und-Schweden.jpg

Kurzum, beide Konzerne kommen sich nicht in die Quere, in guter, alter Tradition: Seit der Weimarer Republik haben sich in Deutschland RWE und die Firmen, aus denen Eon im Jahr 2000 zusammenfusioniert wurden, den deutschen Strommarkt staatlich abgesegnet fein aufgeteilt. In den Nullerjahren sprachen sich die Konzerne regelmäßig ab, das Bundeskartellamt sprach damals von einem „Duopol“.

Quelle         :      TAZ        >>>>>        weiterlesen

———————————————————————

Grafikquellen        :

Oben        —        Beschreibung Bildbeschreibung: Ortseingang Kuckum. Quelle: eigenes Foto… Fotograf/Zeichner: bodoklecksel 20:31, 25. Jun 2006 (CEST) Datum: Juni 2006… Sonstiges: …

Abgelegt unter Nordrhein-Westfalen, Überregional, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Resignation oder Widerstand

Erstellt von DL-Redaktion am 30. September 2019

Wie wir durch unser Verhalten das Klima retten können

2019 CSD Kölm 127.jpg

von Jonathan Safran Foer

Am Morgen des 14. April 2018 betrat der Bürgerrechtsanwalt David Buckel einen Teil des Prospect Park in Brooklyn, in dem ich selbst Tausende Male war. Als ich in der Gegend wohnte, ging ich dort oft mit dem Hund spazieren, spielte mit meinen Kindern oder sammelte meine Gedanken. Um 5.55 Uhr morgens schickte er eine E-Mail an mehrere Nachrichtensender, in der er die Entscheidung begründete, die er kurz darauf treffen würde. Dann übergoss er sich mit Benzin und zündete sich an.

Seinem Mann und seinen Freunden zufolge war er nicht depressiv. Und er war gedanklich auch klar genug, um neben der E-Mail mindestens drei verschiedene Abschiedsbriefe zu hinterlassen, in denen er seine Tat erklärte. Der kürzeste davon war handgeschrieben: „Ich heiße David Buckel und habe mich aus Protest gerade selbst verbrannt.“

Ein zweiter Brief befand sich in einem Umschlag, der in eine Mülltüte eingewickelt in einem Einkaufswagen in der Nähe gefunden wurde. Darin stand: „Umweltverschmutzung verwüstet unseren Planeten und macht Luft, Boden, Wasser und Wetter immer lebensfeindlicher. Unsere Gegenwart wird immer verzweifelter, und für unsere Zukunft ist mehr nötig, als wir bisher getan haben.“

Buckel war Bürgerrechtsanwalt und hatte allen Grund zu glauben, dass Fortschritt mehr als nur eine Phantasie ist. Er war ein landesweit anerkannter Pionier für Schwulen- und Transgender-Rechte. Dass die Ehe zwischen Gleichgeschlechtlichen zu Buckels Lebzeiten legalisiert wurde, war nicht zuletzt seinem Einsatz zu verdanken. In einer Atmosphäre von Apathie und Resignation wirkte er hoffnungsvoll und motiviert. Jene, die seinen Selbstmord als schwarzseherischen Akt bezeichnet haben, lassen außer Acht, dass sein Tod explizit ein Protest war. Und es gibt keine Tat, die mehr auf der Überzeugung fußt, dass Dinge anders sein könnten, als der Protest. „Ehrbares Wirken zu Lebzeiten legt ehrbares Wirken im Tod nahe“, schreibt Buckel in seinem Abschiedsbrief.

Drei Monate später veröffentlichte die „New York Times“ einen Essay, „Raising my child in a doomed world“. Ein halbes Dutzend Freunde schickten ihn mir. Beim ersten Lesen fand ich ihn treffend. Geschrieben hatte ihn Roy Scranton, derselbe Autor, der auch schon zuvor „Learning how to die in the Anthropocene“ geschrieben hatte. Scranton beschreibt die intensive Gefühlsmischung bei der Geburt seines ersten Kindes: „Als meine Tochter geboren wurde, habe ich zweimal geweint.“ Zuerst kamen Freudentränen, dann Tränen der Trauer: „Meine Partnerin und ich hatten unsere Tochter in unserem Egoismus zu einem Leben auf einem dystopischen Planeten verdammt, und ich sah keine Möglichkeit, sie vor der Zukunft zu beschützen.“

Ich war dankbar, dass sich noch jemand in die Diskussion über die Krise des Planeten einmischte. Scranton ist nicht nur ein reflektierter, sondern auch ein leidenschaftlicher, gebildeter und verdammt guter Schriftsteller. Er fasste etwas in Worte, das ich als Vater oft empfunden hatte. Und es war kein Zufall, dass mir so viele Menschen seinen Essay weiterleiteten, allesamt selbst Eltern. In diesem Essay (und anderen) wendet sich Scranton der Umweltkrise mit einer philosophischen Präzision zu, die der gegenwärtigen Debatte fehlt – eine Denkweise, die wir dringend brauchen, um unsere Krise verstehen zu können. Wie David Wallace Wells in seinem Artikel „Die unbewohnbare Erde“ bemerkt: „Wir haben kaum eine sinnstiftende Religion rund um den Klimawandel entwickelt, die uns angesichts unserer möglichen Auslöschung Trost spenden oder Entschlossenheit verleihen könnte.“ Scranton beginnt, eine solche Religion zu entwickeln, aber das Problem ist, dass sie uns angesichts der Auslöschung keine Entschlossenheit verleiht – sie gibt auf. Als ich den Essay noch einmal las, war ich frustriert, ja sogar wütend. Je öfter ich ihn las, desto mehr kam er mir wie eine Art Abschiedsbrief vor.

Im Zusammenhang mit der „moralischen Haltung dazu, in einer CO2-basierten Konsumgesellschaft zu leben“, bemerkt Scranton, dass sich viele Menschen für einen verantwortungsvolleren Lebensstil aussprechen. „Nehmen Sie zum Beispiel das viel zitierte Forschungspapier des Geographen Seth Wynes und des Umweltforschers Kimberly Nicholas, in dem sie argumentieren, das Wichtigste, was der Einzelne tun könne, um seinen CO2-Ausstoß zu verringern, sei sich pflanzlich ernähren, Flugreisen vermeiden, autofrei leben und ein Kind weniger bekommen.“ Er bezieht sich dabei auf den Aufsatz „The Climate Mitigation Gap: Education and Government Recommendations Miss the Most Effective Individual Actions“, in dem dargelegt wird, dass das meiste, was zur Begrenzung des Klimawandels gelehrt und empfohlen wird, vergleichsweise unbedeutend ist. Das eigentlich Problematische an diesem Vorschlag, so Scranton weiter, seien nicht die Empfehlungen, sparsam zu sein, weniger zu fliegen oder sich vegetarisch zu ernähren, was alles gut und schön sei, sondern vielmehr das Gesellschaftsmodell, auf dem solche Empfehlungen beruhen: „die Vorstellung, wir könnten die Welt durch individuelle Verbraucherentscheidungen retten. Das können wir nicht.“ Warum nicht? Weil die Welt eine „komplexe und rekursive Dynamik“ mit „internen und externen Antriebskräften“ sei.

Ich bin mir nicht hundertprozentig sicher, was das bedeutet, aber egal wie komplex die Welt auch sein mag, es sind doch die Menschen, die recyceln, protestieren, wählen gehen, Müll aufsammeln, bei ethischen Unternehmen kaufen, Blut spenden, eingreifen, wenn jemand in Gefahr ist, sich gegen rassistische Bemerkungen wehren und den Weg für den Krankenwagen frei machen. Diese Taten dienen nicht nur dem individuellen Wohl desjenigen, der sie ausführt, sondern sind wichtig für das gesellschaftliche Wohlergehen: Verhalten wird wahrgenommen und nachgeahmt.

Millionen einzelner Entscheidungen verändern die Welt

In ihrem Buch „Die Macht sozialer Netzwerke“ bezeichnen Nicholas A. Christakis und James Fowler soziale Netzwerke als „eine Art menschlichen Überorganismus“. Was sie herausfanden, war: „Wenn ein Freund eines Freundes Ihres Freundes zunimmt, dann nehmen Sie zu. Wenn ein Freund eines Freundes Ihres Freundes mit dem Rauchen aufhört, dann hören Sie mit dem Rauchen auf. Und wenn ein Freund eines Freundes Ihres Freundes glücklich ist, dann sind Sie glücklich.“ Obwohl wir Übergewicht häufig als „Epidemie“ bezeichnen, halten wir es kaum für ansteckend. Christakis und Fowler zeigen allerdings, dass Fettleibigkeit – und dasselbe gilt für Rauchen und Nichtrauchen, sexuelles Fehlverhalten und dessen Ablehnung – genau wie Fitness ein Trend ist: „Mit Hilfe von mathematischen Modellen gelang es uns jedoch zu beweisen, dass diese Häufungen von normal- und übergewichtigen Personen kein Zufallsprodukt, sondern tatsächlich statistisch relevant sind. Nicht nur das, die Konzentration gehorchte außerdem unserem Gesetz der drei Schritte: Die Wahrscheinlichkeit, dass krankhaft übergewichtige Menschen Freunde, Freunde von Freunden und Freunde von Freunden von Freunden hatten, die ebenfalls unter Übergewicht litten, war so groß, dass es sich nicht um einen Zufall handeln konnte. Ganz ähnlich hatten normalgewichtige Personen in einem Radius von drei Schritten mit größerer Wahrscheinlichkeit normalgewichtige Personen in ihrem persönlichen Umfeld. Nach drei Schritten endete diese Konzentration.“

Es scheint also, als würden Menschen innerhalb des Netzwerks Nischen besetzen, in denen Über- und Normalgewicht eine Art regionale Norm darstellen. Wenn es um die Gesundheit geht, legt diese Studie nahe, dass individuelles Verhalten deutlich einflussreicher ist als offizielle Ernährungsempfehlungen, an die sich die meisten Amerikaner nicht halten. Während Strukturen zwar eine wichtige Rolle spielen – Nahrungswüsten, Subventionen oder ungesundes Kantinenessen –, sind die ansteckendsten Normen die, die wir selbst leben.

Wir sind nicht machtlos innerhalb unserer „komplexen, rekursiven Dynamik“ mit „internen und externen Antriebskräften“ – wir sind die Antriebskräfte. Ja, es gibt mächtige Systeme – den Kapitalismus, die industrielle Tierhaltung oder die Erdölindustrie –, die schwer zu beeinflussen sind. Ein einzelner Autofahrer kann keinen Stau verursachen. Aber ohne einzelne Autofahrer gibt es keinen Stau. Wir stecken im Verkehr fest, weil wir der Verkehr sind. Die Art und Weise, wie wir leben, was wir tun und was wir nicht tun, kann im System begründete Probleme verstärken, sie aber auch verändern: Gerichtliche Klagen von Einzelnen veränderten die Boy Scouts, die Aussagen Einzelner brachten die #MeToo-Bewegung ins Rollen, und Einzelne, die am Marsch auf Washington für Arbeit und Freiheit teilnahmen, ebneten den Weg für den Civil Rights Act von 1964 und den 1965 folgenden Voting Rights Act. Genau wie Rosa Parks dabei half, die Rassentrennung in öffentlichen Verkehrsmitteln zu beenden, und Elvis dabei half, die Kinderlähmung zu besiegen.

Scranton schreibt weiter: „[W]ir können ebenso wenig frei wählen, wie wir leben wollen, wie wir uns über die Regeln der Physik hinwegsetzen können. Wir wählen aus möglichen Optionen, nicht ex nihilo.“

Ja, unsere Handlungen unterliegen gewissen Beschränkungen, es gibt Konventionen und strukturelle Ungerechtigkeiten, die die Parameter des Möglichen festlegen. Unser freier Wille ist nicht omnipotent – wir können nicht tun, was wir wollen. Aber, wie Scranton sagt, wir können zwischen verschiedenen Optionen wählen.

Und eine unserer Optionen ist es, bei unseren Entscheidungen die Umwelt zu berücksichtigen. Man braucht sich nicht über die Regeln der Physik hinwegzusetzen – noch nicht einmal einen grünen Präsidenten zu wählen –, um von dem, was auf der Karte steht, etwas Veganes auszuwählen oder im Supermarkt pflanzliche Lebensmittel zu kaufen. Und während es ein neoliberaler Mythos sein mag, dass die Entscheidungen Einzelner grenzenlose Macht haben, ist es ein schwarzseherischer Mythos, dass sie überhaupt keinen Einfluss haben. Handeln kann sowohl auf Makro- als auch auf Mikroebene etwas bewirken, und wenn es darum geht, die Zerstörung unseres Planeten zu bremsen, ist es unmoralisch, eins von beiden abzutun oder zu sagen, man brauche es im Kleinen gar nicht zu versuchen, weil es im Großen nicht zu schaffen sei.

Ja, wir brauchen einen strukturellen Wandel – wir müssen weltweit weg von fossilen Brennstoffen und hin zu erneuerbarer Energie. Wir müssen eine Art CO2-Steuer durchsetzen, uns für eine Kennzeichnungspflicht der Umweltverträglichkeit von Produkten starkmachen, Plastik durch nachhaltige Lösungen ersetzen und fußgängerfreundliche Städte bauen. Wir brauchen Strukturen, die uns in Richtung der Entscheidungen stupsen, die wir schon jetzt treffen wollen. Wir brauchen einen ethischen Umgang des Westens mit dem globalen Süden. Wir brauchen vielleicht sogar eine politische Revolution. Für diese Veränderungen sind Umbrüche nötig, die ein Einzelner allein nicht auf den Weg bringen kann. Doch einmal abgesehen davon, dass große Revolutionen sich aus Einzelnen zusammensetzen, von Einzelnen angeführt und durch Tausende individueller Revolutionen verstärkt werden, haben wir keine Chance, unser Ziel einer Begrenzung der Umweltzerstörung zu erreichen, wenn Einzelne nicht sehr individuell für sich entscheiden, sich anders zu ernähren. Es stimmt natürlich, dass ein Einzelner, der sich ab sofort vegan ernährt, die Welt nicht verändern wird, aber genauso wahr ist, dass Millionen solcher Entscheidungen in Summe sie verändern werden.

In Bezug auf den veränderten Lebensstil, den Wynes und Nicholas vorschlagen, schreibt Scranton: „Sich [ihre] Empfehlungen zu Herzen zu nehmen, würde bedeuten, sich vom modernen Leben abzuschneiden. Es würde bedeuten, eine abgeschiedene, isolierte Existenz zu führen und jede tiefere Verbindung zur Zukunft aufzugeben. Wynes’ und Nicholas’ Argumente wirklich ernst zu nehmen, würde bedeuten, sich einzugestehen, dass die einzige wirklich moralische Reaktion auf den Klimawandel darin besteht, sich umzubringen. Es gibt einfach keine effektivere Weise, um den eigenen CO2-Fußabdruck zu verkleinern. Wenn man tot ist, verbraucht man keine Energie mehr, isst kein Fleisch mehr, verbrennt kein Benzin mehr und bekommt auch sicher keine Kinder mehr. Wer den Planeten wirklich retten will, sollte sterben.“

Das ist ein extremer Sprung. Stellen Sie sich vor, Sie nehmen vor dem Abendessen keine tierischen Produkte mehr zu sich und fliegen pro Jahr zweimal weniger. Einmal abgesehen davon, ob Ihnen das möglich wäre, klingt es nach einer „abgeschiedenen, isolierten Existenz“? Oder eher nach einer Anpassung an ein leicht gesunkenes Einkommen?

Verabschieden wir uns vom Hedonismus

Quelle         :            Blätter           >>>>>         weiterlesen

———————————————————————-

Grafikquellen         :

Oben       —         Colgne Pride 2019

————————————-

Unten           —         Hafeneinfahrt mit Imperia

Abgelegt unter Arbeitspolitik, Ernährungspolitik, International, Umwelt | Keine Kommentare »

„friday for future“

Erstellt von DL-Redaktion am 30. September 2019

Was wir von Greta Thunberg auch über uns lernen können

Sie schafft, was den Sinn von Bewegungen ausmachen. Menschen bewegen !

Quelle        :    Scharf  —  Links

Von Franz Witsch

Es wird viel über die Klima-Aktivistin Greta Thunberg gesprochen, geschrieben, kritisiert, verunglimpft etc. Deshalb ist es vielleicht angebracht, einen mir wichtigen Aspekt im Hinblick auf ihre Person herauszustellen. Dazu möchte ich den interessierten LeserInnen Texte (Tx01, Tx02, Tx03) zur Kenntnis geben. Sie sind am Ende des Briefs unter „Quellen“ einsehbar.

Um es gleich zu sagen: Ich finde Greta Thunberg gut. Allerdings bemühe ich mich, sie nicht zu überhöhen; das hieße, in ihre Person oder ihre Aussagen einen zu großen Bedeutungsüberschuss zu projizieren. Der hätte zur Folge, ihre Existenz bzw. ihr Innenleben von der äußeren Realität („wie sie ist“) zu isolieren, sowohl im Bewusstsein (Innenleben) des Überhöhenden als auch der überhöhten Person; dies im „Modus psychischer Äquivalenz“ (vgl. K14, S. 2f).

In diesem Modus mutierte die überhöhte Person in unserer Vorstellungswelt oder im Denken zum irrealen oder imaginären Objekt, das dann ohne Bezug zur äußeren Realität fühlen, denken und sprechen würde – tatsächlich unverstehbar gefangen in „Weltlosigkeit“, wie Hannah Arendt über den Holocaust-Organisator Adolf Eichmann sagte. Sie sprach in diesem Zusammenhang von der „Banalität des Bösen“: Eichmann sei eigentlich ein Mensch wie jeder andere, nur eben überzeugt seine Pflicht gegenüber Hitler erfüllen zu müssen, weil er ihm einen Treueeid geschworen habe.

Überhöhte Personen sind eben unantastbar, jeglicher Kritik entzogen. Wie sagte Karl Krauss, gestorben 1936, nach der Machtübernahme noch gleich? Ach ja: zu Adolf Hitler fiele ihm nichts mehr ein. Unverstehbar. Etwas, was übrigens Heidegger, angelegt in seinem Werk „Sein und Zeit“ (SuZ), nicht verstanden hat, als er sich nach 1933 den Nazis andiente, um, wie er später zu seiner Rechtfertigung zu behaupten, das Schlimmste zu verhüten. Er entwickelte einen Entfremdungsbegriff, demzufolge sich der Mensch aus allen sozialen Bezügen (zunächst) verabschieden müsse (vgl. DP4, S. 126-136), um das, was Heidegger das „eigentliche Sein“ (Seyn, vgl. SaHei, S. 323f) nennt, erfahrbar zu machen.

Die eigentliche Erfahrung werde indes „zugestellt“, unerfahrbar gemacht, durch die modernen Wissenschaften (seit dem 19. Jh.), denen es allein um Sachfragen zur Beherrschung bzw. Instrumentalisierung der Natur, auch die des Menschen, gehe, und nicht darum zu erspüren, was der Mensch „eigentlich“ sei.

Dummes Zeug.. Nach meinem Dafürhalten wäre das Eigentliche die Beziehungsebene, nämlich die Fähigkeit, soziale Beziehungen „im Sinne aller“ zu gestalten; eine Fähigkeit, die in unserer Gesellschaft immer mehr abhandenkommt. Würde Heidegger dies verstanden haben, hätte er sich den Nazis nicht angedient. Recht hat er indes damit, dass der Mensch sich seine Existenz (Innenleben) zustellt, indem er sich allein um Sachfragen bemüht – ich würde, anders als Heidegger, ergänzen: unter Ausklammerung der Beziehungsebene, die bei Heidegger keine Rolle spielt, es sei denn eine negative. Etwas, was Rüdiger Safranski (in SaHei) nicht klar genug herausarbeitet, wiewohl er sich hier an Hannah Arendt hätte orientieren können, die allerdings auch, wie die meisten Philosophen heute noch, dazu neigt, Heideggers „Sein und Zeit“ von seinem Engagement für die Nazis zu trennen.

Kritikfähigkeit verweist primär auf die Beziehungsebene; diese steht über der Sachebene. Das schließt ein: (inhaltliche) Sachfragen (zur Klimaerwärmung), zu denen mir als Laie „zu wenig einfällt“, sind von sekundärer Bedeutung; mich interessiert an Greta, dass sie mit ihrem Auftritt vor der UNO die Beziehungsebene einbringt; ihre Fähigkeit Beziehungen einzugehen, die sie als Botschaft zusammen mit ihren Sachaussagen absondert. Weniger wichtig ist mir, ob ihre Aussagen (als solche) richtig oder falsch sind, namentlich ob der Klimawandel menschengemacht ist oder natürliche Ursachen hat.

Anders verhält es sich im Hinblick auf die Gestaltung des Innenlebens: Dort könnten wir uns kompetenter äußern, wenn wir es denn wirklich wollten und unser Innenleben durch Sachfragen nicht beständig zustellen würden, das Wesentliche aussparend: wie gehen wir miteinander um? Dazu gehört Mut, kämen auf der Beziehungsebene doch auch Defizite, der „Verlierer in uns“ (vgl. DP3, S. 92-99), zur Sprache kämen, mit denen wir uns nicht gern konfrontieren lassen. Ganz besonders Politiker, die es nicht zuletzt deshalb nötig haben, einem 16-jährigen Teenager die Leviten zu lesen.

Andrerseits kommen wir, wiewohl wir sie ausklammern, um die Beziehungsebene nicht herum, weil wir jeden Tag, ob wir es wollen oder nicht, mit der Notwendigkeit, Beziehungen eingehen und gestalten zu müssen, konfrontiert werden. Das passiert regelmäßig eher schlecht als recht, mehr oder weniger sozialverträglich im Hinblick auf die Entwicklung sozialen Strukturen. Darüber beschwert sich Greta vor der Weltgemeinschaft bei den Politikern, indem sie über Sachfragen redet und dabei, nun die Beziehungsebene unausgesprochen einbeziehend, ihre Tränen (Wut) kaum zu verbergen vermag. Ich finde das gut und mutig obendrein; weil sie sich Schmähungen aussetzt bei den Menschen, die sich im Inneren getroffen fühlen und diese ihre Betroffenheit rationalisieren, indem sie Greta Sachinkompetenz vorwerfen. Ärmlich.

Auf der Beziehungsebene geht es primär um Wahrhaftigkeit und Authentizität einer Person. Sie kommt bei Greta in erster Linie zum Ausdruck, wie sie spricht und welche Botschaften im unausgesprochenen „Wie“ sie nonverbal zusätzlich zum „Was“ aussendet (Bedeutungsüberschuss); indem sie mit ihrer emotional vorwurfsvollen Frage eine einzulösende Erwartungshaltung auf der Beziehungsebene transportiert, eben dadurch, dass sie Gefühle authentisch ins Spiel bringt. So gesehen könnte die Frage etwas anders vom Wortlaut her auch lauten: „Wie können Sie es wagen, die Welt mit Ihrer Beziehungsunfähigkeit zu zerstören?“

Solch eine Kritik, recht verstanden, geht tiefer als es Irrtümer in Sachfragen zur folge haben; das zeigen einige Reaktionen der Politiker, die lediglich hilflos reagieren, wenn man ihre Fähigkeit, Beziehungen zu gestalten, infrage stellt (vgl. Tx03), etwas, was sie, besonders wenn’s um sie selbst geht, feinfühlig spüren, ohne es zu sagen. Aber auch sonst reagieren viele Menschen irritiert bis aggressiv, jedenfalls nicht souverän, wenn Gefühle, die das Gesagte mit überschüssiger Bedeutung gleichsam transzendieren, ins Spiel kommen. Sie denken, dass das, was gesagt worden ist, im Zeichen identifiziert sei, als wäre das, was sie sagen, identisch mit dem, was sie meinen, wenn sie es sagen, also der Interpretation nicht zugänglich. In diesem Fall fühlen, denken und sprechen Menschen im „Modus psychischer Äquivalenz“ (vgl. Svenja Taubner in K14, S. 2f). Wäre dem tatsächlich immer so – die meisten Menschen wissen nicht, dass sie in Wirklichkeit so nicht „ticken“ –, könnten wir uns Kommunikation sparen. Sie bliebe öde, langweilig, leidenschaftslos. Immer mehr Menschen sind es ja auch: öde, langweilig, leidenschaftslos, abgeschnitten von sich selbst und ihrer Umgebung; „weltlos“, wie Hannah Arendt sagen würde.

Allen voran Politiker. Die meisten Bürger hören nicht mehr zu, ohne genauer zu wissen, warum, wenn Politiker sprechen oder diskutieren. Sie verleugnen, verdrängen, verdrehen unentwegt, selbst über das notwendige Maß ihrer Existenzsicherung hinaus; oder schauen weg, wie Greta sagt.

Wegschauen tut man nicht, indem man irrt: auf der Sachebene falsch liegt. Im Gegenteil kommt Authentizität auf der Beziehungsebene dadurch zum Ausdruck, wie man mit Irrtümern und damit auch mit einem Gegenüber umgeht, der den eigenen Irrtum identifiziert, ob man also in der Lage ist, Irrtümer produktiv zu verarbeiten, v.a. dann, wenn die Verarbeitung an die Substanz geht, die eigene Existenz (wenn auch nicht existenziell, sozusagen auf Leben und Tod) berührt. Wird sie negativ wiewohl nicht existenziell berührt, etwa Ruf oder Karriere in Mitleidenschaft gezogen, oder werden vielleicht einfach nur liebgewordene Gewohnheiten berührt, schauen Menschen dennoch nachhaltig weg. Einfach weil sie es gewohnt sind, tief verinnerlicht haben, ihr Innenleben zu tabuisieren. Dann greifen vielleicht einfache Mechanismen, die jegliche Kommunikation, bei der es „um etwas geht“, zusätzlich erschweren, sodass die Beziehungsebene massiv in Mitleidenschaft gezogen werden kann.

Auffällig vor allem bei Politikern: sie ignorierten allesamt selbst auf der Sachebene grundlegende Probleme, die uns unser Wirtschaftssystem, der Kapitalismus, auferlegt; namentlich das Problem, dass der Kapitalismus jede Menge Unsinn, z.B. Autos (für den privaten Verkehr), produziert, die zu lieben wir „gelernt“ oder verinnerlicht haben; der ferner Unsinn produziert wie Rüstung, Kriege, Plastik, Zerstörung von (Regen-) Wälder, landwirtschaftlicher Nutzfläche sowie die Zu-Betonierung der Landschaft mit Straßen für den privaten Autoverkehr.

Derartige Unsinns-Produktionen gehören unabhängig davon eingestellt, ob die dabei verwendeten Ressourcen und Energieträger Kohlendioxid (Co2) ausstoßen oder nicht, und unabhängig davon, ob ein wachsender Co2-Ausstoß unser Klima signifikant erwärmt oder nicht; sodass die Frage nach den menschengemachten Ursachen der Klimaerwärmung zwar interessant, politisch aber weniger relevant ist.

Nun ist die Wahrscheinlichkeit, dass Greta das versteht, ungleich größer, als bei einem Politiker, zumal wenn dieser etwas zu verlieren hat; ganz zu schweigen, dass er begreift, dass der wachsende Ressourcen-Verbrauch zur Produktion von Unsinn ein riesiges Problem ist, den der Kapitalismus gleichwohl braucht, um die gesamtwirtschaftliche Nachfrage hoch zu halten, besser noch stetig zu erhöhen, um Wachstum ad infinitum zu generieren, um mit Wachstum Einkommen und Sozialstaat zu sichern, selbst wenn die Spatzen es längst von den Dächern pfeifen, dass das nicht ewig so weitergehen kann; zumal Wachstum sich nachfrage- und einkommenseffektiv nur noch durch Unsinns-Produktionen stabilisieren lässt. Und die setzen im Falle wachsender Rüstungsanstrengungen Kriege voraus, wie sie überall in der Welt insbesondere vom Westen geführt oder inszeniert werden, weil dort ganz besonders hohe Einkommenseffekte zu verteidigen sind.

Um auf die Beziehungsebene zurückzukommen: die Wahrhaftigkeit einer Person kommt in Abhängigkeit davon zum Ausdruck, ob sie in der Lage ist, sich allen Fragen, die wichtig sein könnten, zu öffnen; selbst wenn sie das eigene Innenleben berühren, z.B. durch geringeres Einkommen. Mit Letzterem kommen die meisten Menschen nicht zurecht, noch ohne zu durchschauen, mit was sie tatsächlich nicht zurechtkommen (mit dem Verlierer in sich), und interessieren sich deshalb vorsichtshalber nur für einen kleinen Ausschnitt ihrer inneren und der äußeren Welt – bis hin zur völligen „Weltlosigkeit“ ihrer Person (Hannah Arendt), nämlich in Abhängigkeit davon, ob jener Ausschnitt ihre persönlichen (Karriere- oder Einkommens-) Interessen berührt oder nicht. Berührt er sie negativ, verkleinern sie den Ausschnitt, d.h. sie schauen noch ein Stück weiter weg bis zu einem Punkt, wo sie nur noch orientierungslos in der Weltgeschichte herumlaufen, um zur Knetmasse in den Händen von Rechtspopulisten zu degenerieren. Das macht sie unwahrhaftig, nicht-authentisch, mit anderen Worten („strukturell“) verlogen – noch im Vorfeld einer rechtspopulistischen Gesinnung, fällt diese doch nicht einfach vom Himmel.

Sicherlich ist nicht auszuschließen, dass der wachsende Ressourcen-Verbrauch das Weltklima über das notwendige Maß hinaus erwärmt, das zur Ernährung der Weltbevölkerung nötig ist; tatsächlich ein Nebenaspekt auf der Sachebene, die Beziehungsebene ausklammernd, wiewohl das eigentlich gar nicht geht, auf den Nebenaspekt sich aber alle Welt im Konflikt mit einem 16-jährigen Mädchen konzentriert, um von der Zerstörungswut unseres Wirtschaftssystems abzulenken, wegzuschauen, wie Greta sagt, und um dabei die eigene Person, das, was ihr Innenleben ausmacht, zuzustellen (Heidegger in „Sein und Zeit“).

Zum Schluss möchte ich einen zusätzlichen Aspekt ins Spiel bringen im Hinblick darauf, dass Greta Autistin ist (vgl. Tx02). Vor diesem Hintergrund frage ich noch einmal: Was macht Greta so authentisch? Es ist, wie gesagt, ihre Beziehungsfähigkeit und damit, wie ich meine, ihre Fähigkeit zu „wirklicher“ Empathie: Beziehungen einzugehen, zu strukturieren, zu mentalisieren, wie es in K14 (S. 2ff) heißt. Das setzt die Fähigkeit zur Empathie voraus, nicht zu verwechselt damit, Gefühle lesen und in sich generieren zu können (vgl. K14, S. 63; S. 75f, Fußnote, ferner die Besprechung eines Romans, geschrieben von einem Autisten, in MP2, S. 158 ), sodass Greta, vermutlich weil sie Autistin ist, sich sehr wahrscheinlich nicht wird irre machen lassen davon, dass man sie vor der Weltgemeinschaft hat reden lassen. Eben weil beim Autisten die Wahrscheinlichkeit zur Selbst-Überhöhung ungleich geringer ist als beim sogenannten Normalbürger. Das schließt ein, dass Autisten vermutlich viel weniger korrumpierbar sind als die meisten Politiker.

Herzliche Grüße

Franz Witsch

www.film-und-politik.de

Quellen:

DP3: Franz Witsch, Die Politisierung des Bürgers. 3. Teil: Vom Gefühl zur Moral, Norderstedt 2017, erste Aufl. 2013

DP4: Franz Witsch, Die Politisierung des Bürgers. 4. Teil: Theorie der Gefühle, Norderstedt 2015, erste Aufl. 2012

MP2: Franz Witsch, Materialien zur Politisierung des Bürgers, Band 2: Kommunikation unter Verdacht, Norderstedt 2015

Tx01: „Wie können Sie es wagen, weiter wegzuschauen?“

Telepolis vom 25.09.2019, Wolfgang Pomrehn

https://heise.de/-4539313

Tx02: Die Mär vom empathielosen Autisten

Telepolis vom 07.09.2019, von Konrad Lehmann

https://heise.de/-4501615

Tx03: Bierdeckel-Fachmann Friedrich Merz, der Klimawandel und die Verunglimpfung der Klimaaktivistin Greta Thunberg

Telepolis vom 27.09.2019, von Rainer Schreiber

https://heise.de/-4541225

K14: Franz Witsch, Mentalisieren: Anmerkungen zur Gestaltung des Innenlebens. http://www.film-und-politik.de/Politik/K14.pdf

SaHei: Rüdiger Safranski, Ein Meister aus Deutschland. Heidegger und seine Zeit, Frf./Main 2001, 9. Auflage 2015, erstmals erschienen 1994.

SuZ: Martin Heidegger, Sein und Zeit, Tübingen 2001, erstmals  erschienen 1927

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————————

Grafikquellen      :

Oben     —           Demonstration anlässlich des Global Climate Strike am 20. September 2019 in Sydney.

Abgelegt unter International, Kultur, Regierung, Umwelt | Keine Kommentare »

Ein Wettlauf mit der Zeit

Erstellt von DL-Redaktion am 29. September 2019

Welt und Zeit und ich als Kreatur

Ian and Susan jogging on Maunganui beach 3 (5644495596).jpg

Quelle          ;      untergrund-blättle CH.

Von Eckhard Mieder

Wenn ich morgens aufwache und nicht aufstehen möchte, das Grübeln ersetzt den Frühsport, die Zweifel über einen Sinn des Lebens (des eigenen und des menschlichen) drücken mich in das Kissen, dann erfreue ich mich an der freien Zeit, die ich habe und die mir noch bleibt.

Wenn ich dann aufgestanden bin, muss ich mich zurechtfinden. In einer Welt, die sich in „atemberaubendem Tempo“ verändert. In einer Zeit, die „schnelllebig“ geworden ist. In einer Welt, die „sich beschleunigt“. Ich befinde mich, kaum dass meine Füsse den lappländischen Flickenteppich neben dem Bett berühren, im „Wettlauf mit der Zeit“. Und kaum, dass ich Stulle, Apfel und Skyr gegessen habe, prasselt es auf mich ein: das Chaos dieser Welt und dieser Zeit, in der die „mediale Geschwindigkeit nicht mehr kompatibel ist mit der Trägheit moderner Gesellschaften“. Hä?

Habe ich nicht zwei Hände zum Greifen, zwei Beine zum Laufen, zwei Ohren zum Hören und zwei Augen zum Schauen? Liegt es nicht an mir, mich mithilfe der grauen Masse zwischen meinen Schläfen zurechtzufinden; dafür brauche ich weder ein digitales Navigiersystem, und auch irgendwelche Messgeräte nicht, die meine Schritte, meine Herzschläge, meinen Blutdruck und die Zahl der Wörter, die ich spreche, messen oder aufzeichnen. Kann man machen; macht doch.

Im Übrigen halte ich die Welt für so riesig-schön wie überschaubar-schlicht. Gehe ich nach links, gehe ich nach links. Gehe ich geradeaus, komme ich irgendwann ans Meer. Einem Moschusochsen weiche ich aus, wenn ich sehe, dass er mich sieht. Diese Schlichtheit der Betrachtung kommt vermutlich von meinen wochenlangen Wanderungen im Norden Europas. Oder von Island und Grönland, wo mich die Nachrichten aus der „beschleunigten Welt“ weder „in medialer Geschwindigkeit“ auf ihrem Kollisions-Geschwirbel mit der „Trägheit der modernen Gesellschaft“ erreichen noch … Noch vermisse ich irgendeinen Wettlauf. Den mit der Zeit schon gar nicht. (Es gab, erinnere ich mich dunkel, eine Sendereihe des DDR-Fernsehens, die den Titel „Wettlauf mit der Zeit“ trug. Eine irre Idee, fand ich. Wie konnte man darauf kommen, mit der Zeit olympisch umzugehen? Es konnte ein Bild gewesen sein; aber was aus solchen Bildern wird, hat die Zeit erwiesen. Und die Welt. Gut, das konnte niemand so genau voraussehen, auch diejenigen nicht, die sich in diesem Hürden-Lauf ganz vorn wähnten.)

Wer oder was ist es, der oder das mir einredet, ich müsse durch Welt und Zeit hetzen wie durch den schwedischen Wald der Elch, wenn er freigegeben ist zur Jagd? Bin ich recht eigentlich nur noch geduldet und ausgehalten als Rezipient, als Konsument, als Patient, als Instrument einer „beschleunigten Macht“, von der ich nicht wissen kann, ob sie sich als Regierung, als Ökonomie, als Medium verkleidet? Ist alles ein Karneval, drehen alle durch oder am Rad der Geschichte? Oder sind die nicht auch Getriebene, Gehetzte, Benutzte? Noch einmal: hä? Was für eine –Ente soll ich sein? Und was für –Enten sind die anderen?

Was mache ich heute? Lesen? Was schreiben? Ich könnte mich in ein Café setzen und den Leuten zuschauen. Mache ich ganz gern mal. Ich könnte mich für ein Philosophiestudium bewerben; ich las davon, dass ältere Herr- oder Frauschaften sich zwischen die jungen Leute im Hörsaal drängen und Antwort auf die Frage nach – da haben wir ihn wieder! – dem Sinn des Lebens suchen. Ich könnte in den Garten gehen, den ich sträflich vernachlässigt habe; und nur die Pflaumen und Äpfel ernte ich derzeit, so ein Garten muss ja auch einen Sinn haben. Im Wettlauf mit der Sommerzeit habe ich allerdings hoffnungslos verloren. Ich fühle mich noch im Sommer, doch da ist er schon an mir vorbei. Ich könnte für das Klima streiken.

File:Rudergerät Bewegungspark Losbergpark.jpg

 Ich könnte mich um meine Enkelkinder kümmern und mich als grossartiger Opa erweisen; diesbezüglich könnte ich mich beschleunigen, damit ich nicht in atemberaubender Langsamkeit ihr Wachsen und Werden verpasse. Dazu neige ich: zu dieser Entschleunigung, die Züge (Züge! Achtung! Eile! Tempo! Ziele!) einer leichten Asozialität hat. Eine gewisse Kontaktscheu, eine kleine Prise Autismus, kaum merklich für andere, weil ich meistens höflich bin. Und Höflichkeit, eine gewisse Dezenz, wird gern genommen. Befremdet auch, das muss ich hinnehmen. Ich muss ja auch die Welt und die Zeit hinnehmen.

Nun also nach dem Becher Frühstückstee eine Tasse Kaffee. Es braucht etwas zum endgültigen Wachwerden. Die kalte Dusche nach dem Aufstehen ist schon mal was. Heiss, kalt, im Wechsel. Oder ein Bad in einem norwegischen Bergsee, in einem lappländischen Fluss, aus dem Zelt heraus in die kalte Klarheit -, aber jetzt wird es zu romantisch und driftet in die Leibesertüchtigung ab. Apropos: Ich könnte auch zum Medizinischen Fitnesstraining gehen, auf dem Rudergerät sitzen und den Fisch-Imbiss auf der anderen Seite der Strasse anschauen … Gibt es nicht bald wieder Skrei? Nein, dafür muss es Winter sein. Denk doch mal ein bisschen über die Zeit nach, du Freizeit-Philosoph!, die es braucht, einen prächtigen Kabeljau wachsen zu lassen, auf dieser Welt, als Kreatur … Wo war ich gleich noch mal stehengeblieben?

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

———————————————————————

Grafikquellen          :

Oben      —             Ian and Susan jogging on Maunganui beach 3

———————————–

Unten        —          Rudergerät im Bewegungspark im Losbergpark Stadtlohn

Source Own work
Author Tetzemann
This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.
The person who associated a work with this deed has dedicated the work to the public domain by waiving all of their rights to the work worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law. You can copy, modify, distribute and perform the work, even for commercial purposes, all without asking permission.

Abgelegt unter Feuilleton, Kultur, Mensch, Umwelt | Keine Kommentare »

Angst und Endlichkeit

Erstellt von DL-Redaktion am 29. September 2019

Greta Thunbergs „How dare you“

Rep Kathy Castor talks with Greta Thunberg.jpg

„How dare you“ –  „wie können sie es wagen“ – ein Satz welcher sich in der Reaktionen verdeutlicht welche von diesen selbsternannten Groß-Kotzen als Antworten zu hören sind.  Es zeigt die ganze Hilflosigkeit einer gängigen Politik auf, welche den Wählern zur Zeit geboten wird.   – DL – Red. – IE-

Von Georg Diez

Greta Thunberg hat in New York eine beeindruckende Rede gehalten. Auch weil sie dezidiert als Kind auftrat und Verantwortung zum Thema machte.

Es war ein Satz für das Wörterbuch des immer noch jungen 21. Jahrhunderts, ein Satz, der eine Welt zum Einstürzen bringen könnte, wenn diese Welt dafür bereit wäre: „How dare you“, sagte Greta Thunberg in ihrer Rede bei der Uno in New York diese Woche – es war das „Yes, we can“ der Generation Greta, und nicht so sehr Wut, Enttäuschung oder Verletzung trieb diese Rede, trieb diesen Satz an, sondern etwas, für das es ein altmodisches deutsches Wort gibt: Entrüstung.

Wie kann es sein, sagte sie, wie könnt ihr es wagen, sagte sie, wer gibt euch das Recht, sagte sie, unsere Welt zu zerstören – und die Wachheit, die Wundheit, die Direktheit, mit der sie es sagte, machte klar, wie verstellt, verdreht, verlogen die Worte derjenigen sind, die eine rhetorische Rüstung tragen, die sich verstecken hinter Begriffen von Wahrheit, von Politik, von Rationalität, die längst brüchig geworden sind vor dem Hintergrund der Klimakrise, und je länger sie sich verstecken, desto mehr verlieren sie an Legitimität.

Denn das war das Einschneidende dieses Auftritts: Sprachlich, symbolisch, rhetorisch stellte Greta Thunberg die Systemfrage – wenn ihr, Demokraten, Kleptokraten, Technokraten, Autokraten, Erwachsene, nicht in der Lage seid zu sehen, dass das Versprechen von Immer-weiter-so und ewigem Wachstum in den kollektiven Ruin führt, dann habt ihr das Recht verloren, für uns zu sprechen. Dann kündigen wir von unserer Seite, der Jugend, der Zukunft, den Generationenvertrag auf, den ihr gebrochen habt.

Das war die Kraft, das war die Bedrohlichkeit dieses Auftritts: Greta Thunberg, die in dieser Woche auch noch mit dem Alternativen Nobelpreis ausgezeichnet wurde, war in dieser New Yorker Rede dezidiert Kind, mehr als sonst, sie war Tochter, sie machte die existenziell zwischenmenschliche Dimension zum Thema, die Verantwortung füreinander – sie offenbarte einerseits eine Armut der Sprache, eine Verkümmerung der Affekte, eine Sterilität des Denkens in der gegenwärtigen Politik; und gleichzeitig appellierte sie an die tiefere Dimension dessen, was die Menschen ausmacht, an die Zeitlichkeit, die alles beherrscht, die Frage also, was nach uns kommt, das ewige Dilemma der eigenen Sterblichkeit.

Sie würde Angst verbreiten, sagen die, die sie kritisieren, sie würde Panik verursachen, und das sei schädlich, weil es die Menschen lähme – und zeigten vor allem, dass sie nur über ihre Sicht auf die Dinge reden und nicht über die Dinge selbst.

Tatsächlich ist die Botschaft, wenn man es so nennen will, von Greta Thunberg eine ganz andere. Es geht nicht um die Apokalypse, auch wenn sie, vollkommen zu Recht, von der Massenauslöschung spricht, die wir erleben, dem Sterben von Millionen von Spezies, verursacht durch den Menschen; das ist alles faktenbasiert, wissenschaftlich fundiert, oft im Gegensatz zu der beschwichtigenden Rhetorik derjenigen, die die Vernunft für sich reklamieren, und hat deshalb nichts mit biblischen Untergangsszenarien zu tun.

Die Botschaft von Greta Thunberg ist eine der praktischen Vernunft und der säkularen Ethik: Ich habe erkannt, vor dem Hintergrund der Endlichkeit allen Lebens, dass mein Handeln dazu führt, den Planeten zu zerstören, und ich ändere darum dieses Handeln, ich sehe die systemischen Zusammenhänge, aber ich fange mit mir an, im Sinne des kategorischen Imperativs Kants, seltsam verdammt dieser Tage und dabei Grundlage ethischen Handelns überhaupt – wie kann es sein, dass ihr, Erwachsene, sehenden Auges weitermacht mit der Zerstörung der Erde? Wie kann es sein, dass ich, das Kind, euch zeigen muss, was Vernunft ist?

 

Quelle        :     TAZ       >>>>>         weiterlesen

——————————————————————–

Grafikquellen        :

Oben      —      U.S. House Representative Kathy Castor talks with Swedish environmental activist Greta Thunberg in the Congress

Abgelegt unter APO, International, Regierung, Umwelt | Keine Kommentare »

Der Schwarze Feminismus

Erstellt von DL-Redaktion am 27. September 2019

„Die Schwarze Bevölkerung ist nicht einfach arm.
Sie ist arm, weil sie Schwarz ist“

Djamila Ribeiro.jpg

Ein Interview non Simon Sales Predo mit Djamila Ribero

Die brasilianische Philosophin Djamila Ribeiro spricht mit der taz über Schwarzen Feminismus, die Fehler der brasilianischen Linken und Europas Scheinheiligkeit.

taz: Frau Ribeiro, seit Januar regiert in Brasilien mit Jair Bolsonaro ein rechtsextremer Präsident, viele waren von seinem Wahlsieg überrascht. Sie auch?

Djamila Ribeiro: Mich hat überrascht, welche Zustimmung er von Beginn an als Kandidat erfahren hat. Als er schließlich gewann, hatte ich schon damit gerechnet. Bolsonaro hat seinen Wahlkampf emotional geführt, er hat ein politisches Klima für sich genutzt. Viele haben ihn gewählt, weil sie ihre Stimmen auf keinen Fall der ehemals regierenden Arbeiterpartei geben wollten. Es ist traurig, dass sie einen menschenfeindlichen Präsidenten unterstützen.

Im Mai erklärte Bolsonaro, Rassismus sei in Brasilien eine Seltenheit. In der brasilianischen Gesellschaft hält sich hartnäckig der sogenannte mito da democracia raci al. Was hat es damit auf sich?

Dieser Mythos der „Rassendemokratie“ behauptet, in Brasilien existiere kein Rassismus. Weil es im Kontrast zu Ländern wie den USA oder Südafrika weder eine offizielle Segregationspolitik noch ein Apartheidregime gab, konnte man ein romantisiertes Bild des Zusammenlebens von Menschen aller Hautfarben entwickeln.

Sie schreiben, in Brasilien Schwarz zu sein, fühle sich an, als wären Sie im eigenen Land eine Ausländerin.

Mehr als die Hälfte der brasilianischen Bevölkerung ist Schwarz. Schaltet man aber den Fernseher an, sind fast alle weiß. Alle 23 Minuten wird in Brasilien ein junger Schwarzer Mensch ermordet, die Schwarze Bevölkerung sitzt überdurchschnittlich oft in Gefängnissen. Brasilien ist ein extrem rassistisches Land, es wurde auf dem Blut der Schwarzen und Indigenen aufgebaut. Aber diese Gewalt wird unsichtbar gemacht. Und etwas, von dem die Leute nicht glauben, dass es existiert, lässt sich nur schwer bekämpfen.

Welche Rolle spielt bei alldem Europa?

Eine wichtige, immerhin waren europäische Länder Kolonialmächte. Brasilien war eine portugiesische Kolonie, aber Portugal hat für seine Taten nie historische Verantwortung übernommen. Ich vermisse eine ernsthafte Auseinandersetzung der europäischen Länder mit ihrer eigenen Geschichte.

Inwiefern?

Man echauffiert sich in Europa über Migration, dabei hat man die Länder der Menschen, die heute kommen, zuvor ausgebeutet. Und man tut es noch immer. Europa behandelt Brasilien weiterhin, als wären wir eine Kolonie. Man zeigt sich besorgt darüber, was in Brasilien passiert, profitiert aber von der Privatisierung von Staatsunternehmen. Man beklagt, was im Amazonas-Gebiet vorgeht, und beutet gleichzeitig unsere natürlichen Ressourcen aus. Wir erleben einen Prozess der Neokolonialisierung.

Als im August der Brand des Amazonaswaldes in Europa Aufmerksamkeit erregte, boten die G7-Staaten Brasilien finanzielle Hilfe an. Bolsonaro lehnte ab, auch er sprach von Neokolonialismus.

Er weiß vermutlich nicht einmal, was dieses Wort bedeutet. Er verteidigt einen Diskurs der nationalen Souveränität, während seine Regierung sich für das Gegenteil einsetzt. Als die gesamte Welt ihre Augen auf Brasilien richtete, hat er sich diesen Diskurs angeeignet, um sich gegen Kritik zu verteidigen.

In ihrem 2017 erschienen Buch „O que é lugar de fala“ entwickeln Sie den Begriff lugar de fala, also Position, von der aus jemand spricht. Worum geht es da?

Es geht mir darum, sichtbar zu machen, dass wir alle aus historisch gewachsenen gesellschaftlichen Positionen sprechen. Traditionell galt der weiße Mann als universell, er erklärte die Welt. Aber Narrative, die sich universell geben, sind in Wirklichkeit sehr einseitig. Sie sind von einem spezifischen, meist privilegierten Blick geprägt. Wie alle wird auch der weiße Mann von Kultur, Politik und Geschichte beeinflusst, er spricht zu einer bestimmten Zeit von einem bestimmten Ort aus. Dass er sprechen kann und gehört wird, hängt damit zusammen, dass er ein weißer Mann ist. Schwarze sprechen hingegen von einer Randposition, ihre Stimmen werden nicht gehört. Indem wir den lugar de fala thematisieren, schaffen wir einen demokratischen Raum, zu dem alle Zugang haben. Das geht nur, wenn wir erkennen, dass wir aus verschiedenen Positionen sprechen.

Wieso fällt es vielen so schwer, das zu verstehen?

Quekke       :          TAZ          >>>>>         weiterlesen

———————————————————————

Grafikquellen       :

Oben         —       Djamila Ribeiro, no informe da Agência PT de Notícias sobre sua posse como Secretária-adjunta de Direitos Humanos do município de São Paulo.

Abgelegt unter Amerika, Debatte, Mensch, Umwelt | Keine Kommentare »

Debatte über Waldsterben

Erstellt von DL-Redaktion am 27. September 2019

Ein Wald voller Fragen

File:Pine forest.jpg

Kommentar von Heike Holdinghausen

Der Zustand des Waldes ist ernst. Forstleute und Umweltschützer sind verunsichert. Das bietet Chancen für eine neue Streitkultur.

Gerät da etwas in Bewegung, oder verhärten sich die Fronten? Das ist schwer einzuschätzen nach dem Waldgipfel von Forstministerin Julia Klöckner am Mittwoch in Berlin. Das Setting war klassisch: Ein prall gefüllter Konferenzsaal mit dickem Teppich, Herren in Anzug und Loden. Immerhin die Tischdeko zeigte in Richtung Mischwald: Jutesäcke mit Stecklingen aus Buchen, Tannen, Eichen. Erwartbare Reden von Politik, Forschung und Verbänden reihten sich aneinander, in denen die Katastrophe des Waldes – 180.000 Hektar Fläche, die von Dürre, Hitze, Stürmen und Borkenkäfer vernichtet worden sind – beschrieben und interpretiert wurde.

Die verschiedenen Interessengruppen meldeten ihre Ansprüche an – Waldbesitzer, Förster, Wissenschaftler, Jäger – oder bedankten sich schon mal artig für den Scheck von rund 800 Millionen Euro, den Bund und Länder zur Krisenbewältigung ausstellen wollen. Das tat auch die Vorstandsfrau des Dachverbands Netzwerk der Forstunternehmer und Forsttechnik: Angesichts von 105 Millionen Festmetern Schadholz, die es aus dem Wald zu räumen gilt, rief sie fröhlich in den Raum: „Sie haben ein Problem, wir sind die Lösung.“

Mit ihrem peinlichen Werbeauftritt traf die Verbandsvertreterin ungewollt den Punkt: dass die Forsttechniker, also die Firmen, die das schadhafte Holz aus dem Wald holen, nicht die Lösung sind. Sondern dass sie ganz im Gegenteil nicht einmal eine Ahnung haben davon, was die Lösung sein könnte. Genauso wenig wie die Waldbesitzer:innen, Förster:innen, Forstwissenschaftler:innen und Umweltschützer:innen – exakt niemand weiß derzeit, wie es weitergehen soll mit und im Wald. Wie unter einem Brennglas zeigen sich dort die Zielkonflikte unserer Industrienation, die an der Startlinie steht, um den Marathon anzutreten, den eine sozialökologische Transformation bedeutet – oder auch nicht. Denn dass die Bundesrepublik ­wirklich losläuft, ist ja noch keineswegs ausgemacht.

Im Wald also zeigen sich Zielkonflikte zwischen Artenschutz und Klimaschutz; zwischen dem Ersatz fossiler Rohstoffe durch erneuerbare; zwischen privatem Unternehmertum und den Interessen der Allgemeinheit. Im Einzelnen: Das Artensterben gebietet es, so viel Wald wie möglich einer natürlichen Entwicklung zu überlassen und nicht zu nutzen. Dem Klima hilft das nicht. Wälder speichern dann am meisten Kohlenstoff, wenn sie als Laubmischwälder naturnah bewirtschaftet und nicht stillgelegt werden. Wer weniger fossile Rohstoffe nutzen will – Öl, Kohle, mit viel Energie und auf Kosten der Landschaft gewonnene Erze –, muss auf nachwachsende Rohstoffe umsteigen.

Die Allgemeinheit hat ein Mitspracherecht

File:Timber harvesting in Kielder Forest.JPG

Holz gilt als wichtigstes ökologisches Baumaterial der Zukunft. Wenn wir unseren Holzbedarf nicht weiter aus den nordischen Nadel-Urwäldern decken wollen, müssen wir eigene Bäume nutzen. Nicht zuletzt haben Inhaber privater Forstbetriebe ihre wirtschaftliche Existenz an den Forst gekoppelt. Sie stecken ihr Geld, ihre Arbeitskraft und Lebenszeit in den Forst – und leiten daraus verständlicherweise Rechte ab. Sie wollen entscheiden, welche Bäume im Wald wachsen oder welche Maschinen darin eingesetzt werden sollen.

Quelle       :       TAZ          >>>>>         weiterlesen

——————————————————————–

Grafikquellen         :

Oben        —        Pine forest at Leningrad Region

Source Own work
Author Макс Колчин
I, the copyright holder of this work, release this work into the public domain. This applies worldwide.
In some countries this may not be legally possible; if so:

———————–

Unten     —       Timber harvesting at Kielder, a Valmet 941 harvester working in (southern) Kielder Forest, Northumberland, England

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license. Subject to disclaimers.
Attribution: The Boy that time forgot

Abgelegt unter International, Kultur, Regierung, Umwelt | Keine Kommentare »

Klima Religion+Engel Greta?

Erstellt von DL-Redaktion am 26. September 2019

Klima unser im Himmel

File:Greefus groinks - A lot of sky (by-sa).jpg

Kommentar von Ingo Arzt

Der Klimabewegung wird vorgeworfen, zu moralisierend, quasireligiös und irrational zu sein. Dieser Ruf ist das Beste, was ihr passieren kann.

Aus Klimaschutz muss dringend eine Religion werden. Rational sollte sie sein, global und ohne Gott. Der hat genug Mist gebaut. Gibt’s so ähnlich doch schon, werden jetzt einige sagen, nennt sich Humanismus. Und da sind wir schon beim eigentlichen Punkt: Der Vorwurf, die neue Klimabewegung sei moralisierend, quasireligiös und im Kern irrational, ist das Beste, was ihr passieren kann.

Die Vorwürfe gegen radikalen Klimaschutz wie Kohleausstieg sofort oder CO2-Neutralität bis 2035 sind: Das sei weder technisch noch ökonomisch noch mit Zustimmung der demokratischen Mehrheit möglich. Der Klimabewegung sei weniger CO2 in der Atmosphäre wichtiger als der Zusammenhalt der Gesellschaft, die Pendler auf dem Land, die Beschäftigten in der Autoindustrie.

All das ist richtig. Die neue Klimabewegung ist nicht nur rational, auch wenn sie sich in bestem Sinne der Aufklärung auf Empirie und Naturwissenschaft beruft. Aber ihre Kritiker sind eben noch viel weniger rational.

Mit Kritiker sind nicht die Fanatiker gemeint, die meinen, irgendeine Weltverschwörung hätte sämtliche Klimadaten gefälscht, um den Sozialismus einzuführen. Sondern all diejenigen, für die das Klimapaket der Bundesregierung gemacht worden ist. Das sagt im Prinzip: Wir machen jetzt mal richtig Klimaschutzbetrieb hier, seid endlich zufrieden. Und dann nörgeln die Klimafanatiker und sagen: Ja, aber das reicht doch nicht, um das 1,5-Grad-Ziel einzuhalten.

Hand aufs Herz: Wer hat da nicht innerlich schon mal die Augen verdreht? Das 1,5-Grad-Ziel mag rational alle Berechtigung haben, aber es nutzt sich als ewiges Mantra ab. Ebenso wie Greta Thunbergs Wut bei ihrem Auftritt vor den Vereinten Nationen ihren Zenit erreicht hat. Thunberg hat das grellste Mittel gewählt, Tränen, Wut, Verzweiflung, das funktioniert nur einmal.

Von jenen Kritikern ist also die Rede, die im Prinzip für Klimaschutz sind, aber praktisch nicht überfordert und ständig angebrüllt werden wollen. Die das Gefühl haben, die Klimadebatte werde zunehmend hysterischer, von allen Seiten. Und am hysterischsten brüllen die, die der Meinung sind, alles werde immer hysterischer. Man kann freilich auf den Konsum von Nachrichten oder Timelines verzichten. Aber wir reden hier nicht von der individuellen Entscheidung, sich aus einer öffentlichen Debatte auszuklinken, sondern davon, an ihr teilzuhaben.

File:Apocalypse-Albert Goodwin.jpg

Die Debatte ließe sich entschärfen, würden diese Kritiker der Klimabewegung anerkennen, dass die Freiheiten, die der Klimaschutz vermeintlich einschränken könnte, reine Mythen sind. Es ist ein Irrglaube, eine möglichst breite Produktpalette an Urlaubszielen, Turnschuhen, Parfums oder Würsten sei Ausdruck einer freien Gesellschaft. Sie ist Ausdruck dessen, dass wir alle zum Konsum erzogen worden sind. Angst vor Arbeitsplatzverlusten? Unternehmen verschwinden nicht nur wegen des Kohleausstiegs, sondern aus viel banaleren Gründen: Profitstreben etwa.

Auch jene, die meinen, wir lebten in einem freien System freier Märkte, denken tief irrational: Das System führt dazu, dass die Erde ökologisch kollabiert. Wer immer noch an die Funk­tio­nalität dieser Märkte glaubt, ist ein wesentlich stärker verblendeter Eiferer als eine Person, die der Idee nachhängt, man könne binnen zehn Jahren ein Industrieland klimaneutral machen.

Quelle        :         TAZ         >>>>>         weiterlesen

——————————————————————-

Grafikquellen       :

Oben       —         Viel Himmel

A lot of sky
Date
Source https://www.flickr.com/photos/stinkypeter/443672088/
Author greefus groinks
Permission
(Reusing this file)
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.

—————————-

Unten        —  

Artist
Albert Goodwin
Description
Polski: Apokalipsa
Date 1903

date QS:P571,+1903-00-00T00:00:00Z/9
Source/Photographer http://www.artrenewal.org/artwork/154/3154/32410/apocalypse-large.jpg

This is a faithful photographic reproduction of a two-dimensional, public domain work of art. The work of art itself is in the public domain for the following reason:

Public domainPublic domainfalsefalse
Public domain This work is in the public domain in its country of origin and other countries and areas where the copyright term is the author’s life plus 70 years or fewer.

Abgelegt unter International, Kultur, Religionen, Umwelt | Keine Kommentare »

„F f. f.“ in Bad Kreuznach.

Erstellt von DL-Redaktion am 25. September 2019

Erlebnisse und Eindrücke auf der DEMO
„Fridays for future“ in Bad Kreuznach.

Bahnhof Kreuznach Front.jpg

Quelle     :        Scharf  —  Links

Von Wolfgang Gerecht

Gegen 11:30 Uhr sammelten sich nacheinander die Demonstrant Innen, Schüler und Erwachsene, junge und ältere Menschen am Bahnhof in Bad Kreuznach.

Mit hunderten selbstgemachten Schildern auf denen ihre Forderungen an die Politik phantasievoll mit Wort und Bild dargestellt werden, zogen sie durch die Innenstadt von Bad Kreuznach.

Für mich beeindruckend war das beschriftete Leinen-Tuch mit dem Text:

„WARUM für die ZUKUNFT lernen wenn ihr sie ZERSTÖRT?“  und das Schild“

„Euch gehen die Ausreden aus UNS DIE ZEIT“.

Aus meiner Sicht, richten sich solche Fragen und Aussagen inhaltlich sehr treffend an die Bundesregierung aus CDU-CSU-SPD.

Besondere Verantwortlichkeit trifft  die Ober-BremserIn einer sachgerechten Umwelt und Naturschutz-Politik, die heutige Bundeskanzlerin Frau Merkel. Ausgerechnet sie war von 1994 bis 1998 Bundesministerin für Umwelt, Naturschutz und Reaktorsicherheit in der Regierung von Bundeskanzler, Herr Kohl.

Diese war von den einkaufenden Passanten und Mit-Bürger Innen stark frequentiert, zumal an diesem Freitag-Mittag die Markt-Beschicker aus Bad Kreuznach und Umgebung vor Ort waren. Frisches Obst und Gemüse, selbsthergestellte Fleisch und Wurstsorten bis Fisch, Käse und das übliche Angebot aus der Region Bad Kreuznach waren im Angebot.

Die „Fridays for future“ Aktivisten vorwiegend jung aber auch von einer bedeutenden Anzahl älterer Menschen begleitet, konnten ihre Forderungen an die Politik in Berlin deutlich bei den Menschen vor Ort bekannt machen. Dazu bedienten die Schüler Innnen sich auch nicht nur der Info auf Papier sondern benutzen auch Laut-Sprecher-Geräte um die einkaufenden Mit-Bürger Innen auch akustisch gut zu erreichen.

Der nicht enden wollende „Zug“ durch die Innenstadt führte über die Nahebrücke. Am Ufer der Nahe, in Blickweite der Paulus-Kirche, endete der Demonstrations-Zug, der von den Veranstaltern mit ca. 1.200 Teilnehmer Innen angegeben wurde. Am Endpunkt der „DEMO“ waren Tische u Bänke mit mehren Zelten aufgebaut. Dort konnten sich diejenigen die nicht mehr so gut bei Fuß waren niederlassen. Hungrige sich mit Essbarem und Getränke versorgen.

Für gute Stimmung sorgte die gute Musik einer Band zur  Freude aller TeilnehmerInnen.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————-

Grafikquelle      :      Train station of Bad Kreuznach

Abgelegt unter Opposition, Rheinland-Pfalz, Überregional, Umwelt | Keine Kommentare »

Hildegard von Bingen

Erstellt von DL-Redaktion am 25. September 2019

„Alles ist mit allem verbunden.“
(Hildegard von Bingen, 1098 – 1171 n.Chr.)!

Karlheinz Oswald Hildegard von Bingen, Eibingen.JPG

Von Stefan Weinert

vor einigen Tagen hatte ich das „Ravensburger Kolloquium für Holistische Umweltethik“ angestoßen und habe heute den ersten Artikel formuliert. Wie der Name schon sagt, sind Befürworter, Kritiker, Andersmeinende, Impulsgeber etc. eingeladen, ihre Beiträge zum Kolloquium beizusteuern. Allerdings und ganz explizit, ist hier für aggressive, verunglimpfende  und beschimpfende „Vertreter der so genannten Klimalüge“ und andere Verschwörungstheorethiker – besonders aus dem politisch rechten Lager – kein Platz. Toleranz hat ihre Grenzen – damit nicht eines Tages wieder Fackeln durch das Brandenburger Tor getragen werden.

Über diesen interdisziplinären Austausch hinaus, ist dieses Kolloqium/Forum gleichzeitig als Petition an den Deutschen Bundestag zu verstehen (wird auch noch offiziell auf dem Portal des Deutschen Bundestages eingestellt), in Zukunft die UmweltETHIK vor die UmweltTECHNIK zu stellen.

Ich bitte daher, diese Petition in diesem Sinne zunächst einmal hier

>>>>> http://chng.it/5gFF46pd <<<<<

zu unterschreiben, da nicht gewiss ist, ob der Petitionsausschuss in Berlin meine Petition auch veröffentlicht. Das nämlich kann bis zu acht Wochen in Anspruch nehmen. Eure/Ihre Beiträge zu diesem Thema können jeweils als Kommentare (Kommentarfunktion der Petition) hinzugefügt werden. Ich bitte aber um Beachtung dessen, wa ich oben geschrieben habe. Unpassende Beiträge werden gelöscht.

WIR – DIE UNTERZEICHNERINNEN UND UNTRZEICHNER DIESER PETITION – FORDERN DIE REGIERUNG DER BUNDESREPUBLIK DEUTSCHLAND AUF, IN SACHEN „KLIMASCHUTZ“ DIE MAXIMEN DER UMWELT-ETHIK VOR DIE MASSNAHMEN DER UMWELTTECHNIK ZU STELLEN. DENN NUR SO – DAS IST UNSERE ÜBERZEUGUNG – WERDEN WIR DEN UNS FOLGENDEN GENERATIONEN EINE LEBENSWERTE UMWELT HINTERLASSEN KÖNNEN.

IM NAMEN DER MITPETENT/INNEN UND MIT UMWELTFREUNDLICHEN GRÜSSEN

Auch in der Petition enthalten: 

Kolloquium für Holistische Umweltethik

Ildegarda Von Bingen.jpg

Beitrag 01, Stefan Weinert (24.09.19)

Da weder ich, noch eine der Leserinnen oder Leser,  Erfinder der „Umweltethik“ ist, berufe ich mich neben meiner eigenen Gedanken hauptsächlich auf das, was im Laufe der Jahrzehnte zu diesem Thema publiziert und zusammen getragen wurde. Teilweise zitiere ich auch unverändert, oder gekürzt, oder neu formuliert. Vor allem sind da wikipedia und der Autor Wolfgang Lienemenn (siehe Quellenangabe am Schluss)  zu nennen. manches ist auch auf meinem „Ökomist“ gewachsen. Persönlich bin der festen Überzeugung, dass nicht die milliardenschwere Umwelttechnik primär, als „re-aktionäre“ oder re-agierende Maßnahme auf unsere vorherigen Umweltsünden, den „Planet e)“  retten wird, sondern es wird die monetär wesentlich günstigere „Holistische Umweltethik“ sein, die unseren Enkeln und Ur-Ur-Enkeln eine lebenswerte Welt hinterlässt. Jede Technik, eben auch die eigentlich in sich unlogische „Umwelttechnik“, benötigt Energie und wertvolle Rohstoffe (von der Herstellung bis zur Entsorgung = Ökobilanz), während die Umweltethik auf freiwilligen Verzicht, Sparsamkeit, Respekt, Rücksichtnahme und Entschleunigung setzt. Dazu sind keine Milliardenbeträge Not-wendig, sondern „nur“ die Einsicht und der Wille zur Lebensveränderung. Das wird primär der Schlüssel für die rettende Tür sein. Der Kreis „Umweltsünde – Umwelttechnik“ wird sich als Teufelkreis herausstellen

Schon 1913 spricht der Philosoph Ludwig Klages angesichts der industriellen Produktion von einer „Verwüstunsorgie ohnegleichen“,
und der Soziologe Max Weber prophezeit am Vorabend des I. Weltkrieges, dass der moderne Kapitalismus sich so lange austoben werde, bis der letzte Zentner fossilen Brennstoffes verbraucht sei. Industrielle Produktion, Expansion der kapitalistischen Produktionsweise und Naturzerstörung bilden einen Zusammenhang. Immanuel Kant ging damit radikaler um: In Besitz nehmen, als mein Eigentum betrachten, darf ich auf Dauer und von Rechts wegen nur dasjenige, das ich auch beschützen kann. Er nimmt eine ganz moderne Einsicht vorweg, nämlich die, dass die Natur gleichsam als ein Wesen, dem auch Rechte zukommen sollen, betrachtet werden muss.

Die Umweltethik bezieht sich auf moralische Fragen beim Umgang mit der belebten und unbelebten Umwelt des Menschen. Im engeren Sinne verstanden, beschäftigt sie sich in moralischer Hinsicht mit dem Verhalten gegenüber natürlichen Dingen und dem Verbrauch von natürlichen Ressourcen (Umgang mit natürlichen Ressourcen und Umweltmedien (beispielsweise Wasser, Boden, Klima, genetische Vielfalt) beschäftigt.. Im weiteren Sinne umfasst sie auch Tierethik und ebenso die Pflanzenethik. Zu den zentralen Fragen der Umweltethik gehört, welche Dinge bzw. Lebewesen einen Wert oder Rechte im moralischen Sinne haben. Zwischenzeitlich gesteht man Tieren durchaus Rechte zu, im Gegensatz zu Pflanzen, Bergen und Seen. Ob diese einen Eigenwert haben, ist umstritten, jedoch in Hinsicht auf den Menschen für schützenswert. Einen solchen Anthropozentrismus kritisierend, bezieht der Physiozentrismus auch Pflanzen (Biozentrismus) oder Berge und Seen ein (Holismus). allerding gehören ie alle zu einem zu schützenden Ökosystem. Deshalb versteht sich die Umweltethik auch als ökologische Ethik und setzt sich in ihrer Richtungs gebenden Ausprägung für den Erhalt von Tieren und Pflanzen bzw. deren Arten und eine Schonung von Ressourcen ein.

Die Umweltethik ist die ethische Teildisziplin, die sich mit dem normativ richtigen und moralisch verantwortbaren Umgang mit der äußeren, nichtmenschlichen Natur befasst. Innerhalb der Umweltethik kann zwischen der philosophisch-ethischen, der politisch-rechtlichen Ebene und der praktischen Einzelfallarbeit unterschieden werden. Auch mit der Theologie gibt es Berührungspunkte. Die geistige Auseinandersetzung auf der philosophisch-ethischen Ebene führt zu unterschiedlichen Naturschutzbegründungen, die angeben, an welchen Werten sich das menschliche Handeln gegenüber der Natur orientiert (Umweltphilosophie).

Eine zentrale Frage der Umweltethik ist, welchen Wesen oder Dingen ein Eigenwert beigemessen werden sollte, welche Wesen also um ihrer selbst willen zu berücksichtigen sind. Hierzu gibt es unterschiedliche Positionen. Grundsätzlich kann unterschieden werden zwischen Anthropozentrismus und Physiozentrismus (siehe oben). Bei Ersterem ist nur der Mensch als Wesen relevant; im Physiozentrismus wird auch die weitere Natur einbezogen. Während der so genannte Pathozentrismus allen schmerzempfindlichen Wesen einen Eigenwert zuschreibt, gehen Biozentrismus und Ökozentrismus bzw. Holismus darüber hinaus. Im Biozentrismus werden alle lebendigen Wesen als moralisch wertvoll betrachtet, im Holismus zusätzlich sogar nicht individuelle Wesenheiten der Natur (z. B. Arten, Ökosysteme oder die Biosphäre in ihrer Gesamtheit, Biodiversität). Anthropozentrische Positionen berücksichtigen die moralisch relevanten Interessen von Menschen, die auch zukünftige Generationen umfassen können.

Die Umweltethik ersetzt jedoch nicht die sozialen und aktiven Bewegungen und würde ohne diese einem isolierten Spezialdiskurs gleichkommen. Die Umweltethik  bietet aber eine ganze Reihe verschiedener Argumente, die für einen schonenden Umgang mit Natur und Umwelt sprechen. Nicht zuletzt sind hier Pflichten gegenüber zukünftigen Generationen und naturästhetische Argumente zu nennen. Sie geht insofern über die Umweltphilosophie hinaus, als diese nur Erklärungsmodelle, aber keine Handlungsrichtlinien liefert.

Der Holismus  (Ganzheitslehre), ist die Vorstellung, dass natürliche Systeme und ihre Eigenschaften als Ganzes und nicht nur als Zusammensetzung ihrer Teile zu betrachten sind. „Alles ist mit allem verbunden.“ (Hildegard von Bingen, 1098 – 1171 n.Chr.) *) Der Holismus vertritt die Auffassung, dass die Bestimmung der Einzelteile eines Systems von ihrer funktionalen Rolle im Ganzen abhängig ist. Entgegengesetzte Positionen sind Reduktionismus und Atomismus, die Systeme als Anordnung von unabhängig von Zusammenhang bestimmbaren Elementen und deren Eigenschaften beschreiben. Der Reduktionismus  stößt rasch an unüberwindbare Grenzen der Berechenbarkeit. Ein entscheidender Schwachpunkt des Reduktionismus liegt in der Annahme, dass der Zufall der einzige Motor der Evolution sei. Der Grad der Unwahrscheinlichkeit dieser Annahme erscheint jedoch angesichts der unendlichen Kompliziertheit des genetischen Codes als viel zu groß.(Siehe auch „Quantensprünge“)

Holistische Ansätze versuchen, die Evolution ganzheitlich aus Strukturen und Prinzipien zu erklären. Dabei wird der Holismus selbst zur treibenden Kraft der Evolution. Im Modell der emergenten Selbstorganisation (Emergenz = Möglichkeit der Herausbildung von neuen Eigenschaften oder Strukturen eines Systems infolge des Zusammenspiels seiner Elemente) entstehen aus Elementen, die untereinander Wechselwirkungen haben, Systeme mit neuen Strukturen, Eigenschaften und Fähigkeiten.Diese sind wie im Modell des Holismus nicht aus dem Verhalten der unteren Systemebenen vorhersagbar und müssen empirisch durch Beobachtungen, Messungen usw. festgestellt werden. Emergente Prozesse sind meist rückgekoppelt und deshalb nichtlinear, ihr Ablauf ist dann durch das deterministische (vorher bestimmbar, festgelegt) Chaos bestimmt. Deterministisches Chaos ist ein zufällig erscheinendes Verhalten eines dynamischen Systems, das jedoch deterministischen Regeln folgt. Aufgrund der Nichtlinearität der Prozesse bilden sich die Strukturen und Systeme und die damit verbundene Komplexität.

Maulbronn-stauferstele1.jpg

Da sich Natur und Gesellschaft im Laufe der Entwicklung der Welt in aufeinanderfolgenden und hierarchisch aufeinander aufbauenden emergenten Prozessen entwickelt haben, ist seit dem hypothetischen Urknall eine Hierarchie von zunehmend komplexen Systemen entstanden, bis hinauf zur menschlichen Gesellschaft und ihren Institutionen. Diese kontinuierliche Entwicklung wird nur hin und wieder durch schöpferische Katastrophen  beeinträchtigt, deren Ursache Prozesse anderswo in der Welt sind.

*) Wir müssen auf unsere Seelen hören,
wenn wir gesund werden wollen.
Letztlich sind wir hier,
weil es kein Entrinnen vor uns selbst gibt.
Solange der Mensch sich nicht selbst
in den Augen und im Herzen seiner Mitmenschen begegnet,
ist er auf der Flucht.
Solange er nicht zulässt,
dass seine Mitmenschen an seinem Innersten teilhaben,
gibt es keine Geborgenheit.
Solange er sich fürchtet durchschaut zu werden,
kann er weder sich noch andere erkennen,
er wird allein sein.
Alles ist mit Allem verbunden.

(Hildegard von Bingen)

— — —

Ethik grundsätzlich und damit auch die Umweltethik als Theorie (Darstellung und Kritik) umfasst zwei Aspekte. Zum einen beschreibt sie,
was Menschen (auch Tiere) typischerweise tun oder nicht tun, welche beobachtbaren oder erschliessbaren Ursachen dabei wirksam sind, wie die Ursachen wirken und wie sie mitgeteilt werden. Beschrieben wird auch, welche Rechtsordnungen, Institutionen und Organisationen dabei eine Rolle spielen, welche individuellen und kollektiven Einstellungen und Erwartungen wichtig sind, und wie dies alles in komplexen Wechselwirkungen steht. Eine wichtige Beschreibungsperspektive ist die (reflektierte) Beobachtung eines Systems in einer Umwelt.

Zum anderen fragt und argumentiert sie, aufgrund welcher Gründe und Ursachen (Motiven, Überzeugungen, Zielsetzungen; Bestrebungen, Handlungen, Wirkungen) etwas, was ist, aber auch (in näher zu bestimmenden Grenzen) anders sein könnte, so ist, wie es ist, und warum es so sein (und bleiben) soll oder anders werden soll, als es ist. Es wird auch gefragt, ob und wie und warum/woraufhin Institutionen (z.B. rechtliche
Verfassungen) verändert werden können und sollen und wie entsprechende Organisationsformen (z.B. eine Behörde zum Umweltschutz) und Verfahrensordnungen (z.B. das Instrument der Verbandsklage) aussehen sollen.

Während zur Sphäre des Umweltrechts alle die Bestimmungen und Standards, die das Handeln von  Menschen und Institutionen verbindlich regeln (sollen) gehörn; gehören zur Moral diejenigen Motive, Überzeugungen und Hintergrundannahmen, die das Handeln, Verhalten und Unterlassen von Menschen prägen und prägen sollten, ohne dass diese mit den Mitteln des Rechts notfalls gegen Widerstreben durchgesetzt werden können und müssen: Ethische Fragen und Forderungen —> Politsiche Diskusion, Diskurs —> Gesetzgebung

Umweltethische Ziele müssen also in politische Forderungen und gesetzgeberische Initiativen übersetzt werden. Der Wille zur Politik – frei nach Max Weber: das Bohren dicker Bretter mit Leidenschaft und Augenmaß zugleich – nötigt Menschen mit einer bestimmten umweltethischen
Überzeugung dazu, sich am Kampf um Mehrheiten und Meinungen aktiv am demokratischen Prozess im Rahmen verfassungsmässiger Regeln zu beteiligen. Dies wiederum setzt, wenn man nicht permanente Frustrationen sich einhandeln will, eine sorgfältige Einschätzung und einen kontrollierten Einsatz der eigenen Möglichkeiten voraus. Wer umweltethisch handeln will, kann schwerlich anders, als die Nähe zur
Politik zu bejahen. Dies impliziert notwendigerweise die Einübung in die demokratische Tugend der Kompromisses, es sei denn, es tun sich dabei  Grenzen der demokratischen Zumutbarkeit und Kompromissfähigkeit auf, insbesondere dann, wenn technische Innovationen in ausserordentlicher Weise elementare (Über-)Lebensinteressen von Menschen gefährden oder bedrohen.

Die Holistische Umweltethik muss folgende Felder berücksichtigen:

Ressourcennutzung und Stoffwirtschaft – Verbrauch natürlicher Ressourcen, (Roh-)Stoffverwendungen, Recycling; Gebrauchs-
/Nutzwertfunktionen), Rahmenkonzepte: Nachhaltigkeit; Systemanalysen

Energie, E-Smog, Strahlenschutz – Gewinnung, Mix, Transport, Nutzung und Verbrauch, Gefahrenabwehr, Vorsorgeprinzip
Klimaschutz –
Emissionsminimierung durch Anreize und Verbote
Umwelt und Gesundheit –
Konzepte der Präventiv- und Sozialmedizin
Natürliche Schutzbereiche (Tierschutz, Pflanzenschutz, Landschaftsschutz, Boden, Gewässer)
Verkehr –
Beruf, Freizeit, Sport; Energieverbrauch und Emissionen; Verlagerung von Verkehrsaufkommen; Tourismus
Abfall/Emissionen –
Vermeiden, Verwerten, Beseitigen
Anlagensicherheit und Störfallvorsorge – Industriepolitik, Verwaltungsverantwortung und (öffentliche) Bürgerbeteiligung, technische Sicherheitsstandards, Produktehaftung der Produzenten

Umweltforschung hat zahlreiche Träger, Verantwortliche und Finanzierungsquellen. Dadurch ergeben sich ein gewisser Wildwuchs und gleichzeitig ein Bedarf an Koordinierung (nicht: Reglementierung). Folgende Forschungsschwerpunkte könnten hier helfen:

Schwerpunkt 1 – Gefährdung von Mensch und Umwelt durch Schadstoffe, physikalische Belastungen und künstlich veränderte Organismen

Schwerpunkt 2 – Verlust der natürlichen Ressourcen sowie der biologischen und landschaftlichen Vielfalt

Schwerpunkt 3 – Änderungen des Klimas und dessen Auswirkungen auf Natur und Gesellschaft

Schwerpunkt 4 – Umgang der Gesellschaft mit Risiken (integrales Risikomanagement)

Quellen: wikipedia, verschiedene, Unterlagen „Umweltethik –  Eine Skizze“ (von Wolfgang Lienemann)

———————————————————————————

Grafikquellen       :

Oben         —       Sculpture of Hildegard of Bingen by Karlheinz Oswald, 1998, in front of Eibingen Abbey

———————————–

 2.) von Oben        —       Hildegard of Bingen.

  • Unten     —         Maulbronn – Stauferstele. Die Stele steht außerhalb der Klostermauern in der Parkanlage im Südosten des Klosters. Im Hintergrund der Faustturm mit seinem markanten Fachwerkaufsatz.

Abgelegt unter Religionen, Rheinland-Pfalz, Schicksale, Umwelt | Keine Kommentare »

Alptraum Elektroauto

Erstellt von DL-Redaktion am 24. September 2019

Winfried Wolf: Mit dem Elektroauto in die Sackgasse

File:Elektroauto Tesla Ladestation (175330579).jpeg

Quelle        :        untergrund-blättle CH.

Günter Schneider streifzuege.org

Unter dem Titel „Alptraum Auto“ fand im Jahr 1986 in München eine Ausstellung zum 100. Geburtstag des Automobils statt, die sich mit den Auswirkungen der Motorisierung kritisch auseinandersetzte.

Jetzt, mehr als 30 Jahre später – nach der Dieselkrise –, setzt die Autoindustrie auf einen neuen Anfang und forciert die E-Mobilität. Seit den 1970er Jahren hat die weltweite Automobilbranche fünf Krisen überstanden und ist aus jeder gestärkt hervorgegangen. Wurden im Jahr 1960 weltweit 16,5 Millionen Autos gebaut, hat sich der Ausstoß nach der Ölkrise in den 70er Jahren auf 40 Millionen erhöht. Trotz diverser Rückschläge für die Autobauer wurde die Produktion inzwischen auf 100 Millionen Stück pro Jahr gesteigert.

Nunmehr soll eine weitere Steigerung mittels massenhafter Produktion von E-Autos erfolgen. Dies ist die These von Winfried Wolf, die er in seinem neuen Buch „Mit dem Elektroauto in die Sackgasse“ aufstellt. Der promovierte Politikwissenschaftler beschäftigt sich seit den 80er Jahren eingehend mit Verkehrspolitik. Von 1994 bis 2002 war er Abgeordneter im deutschen Bundestag für die PDS, später für die Linke. 1986 publizierte er sein Standardwerk „Eisenbahn und Autowahn“. Seither hat er das Thema einschlägig bearbeitet und immer wieder Veröffentlichungen getätigt.

Mit vielen Daten gespickt beschreibt Wolf die Probleme, die bei der vermehrten Herstellung von Elektroautos auftreten. Zum einen sind es Fragen der für die E-Mobile benötigten Rohstoffe. Ist es für die E-Motoren vor allem das bereits selten gewordene und dadurch teure Kupfer, so wird für die Anfertigung von Batterien vor allem Lithium und Kobalt benötigt. Beides sind äußerst seltene Rohstoffe, die im Fall von Lithium im südlichen Teil Lateinamerikas in hochandinen, sensiblen Regionen Chiles und Argentiniens vorkommen und nur unter umweltzerstörerischen Bedingungen abgebaut werden können.

Zum anderen ist es die mit dem Autogebrauch verbundene Umweltbelastung. Winfried Wolf versucht nachzuweisen, dass die Ausweitung des E-Anteils, die vor allem in China forciert wird, gleichzeitig auch einen massenhaften Anstieg des Verbrennungssektors zur Folge hat. Und natürlich wird Strom zur Aufladung der Batterien benötigt. Dieser kommt in China, dem Land mit den meisten Elektroautos, vor allem aus Kohle- und Atomkraftwerken. Bis 2050 sollen in China deshalb an die 100 Atomreaktoren am Netz sein. Eine gefährliche Entwicklung, denn der nächste Gau ist wohl nur eine Frage der Zeit.

Der Bau einer Batterie für einen Tesla ist ähnlich umweltbelastend wie der achtjährige Betrieb eines Verbrennungsmotors. Tesla ist der Inbegriff für Elektroautos. Firmenchef Elon Musk versteht es offenbar, sich bzw. seine Autos zu verkaufen. Obwohl die Marke einschließlich des neuen, als massentauglich gepriesenen Modell 3, das in Österreich noch nicht zu haben ist, ausschließlich leistungsstarke Luxusautos in einem Preissegment von mehr als 50.000,- Euro herstellt oder verkauft. Winfried Wolf schildert die „andere Marktwirtschaft“ von Tesla & Musk ausführlich, die mit öffentlichen Förderungen und Vorauszahlungen der Kunden Profite generiert. Musk, der auch in Kooperation mit der Nasa gutes Geld verdient, indem er mit seiner Firma Space X Nachschub zur Raumstation ISS transportiert, baut momentan in der Wüste von Nevada an einem riesigen Batteriewerk.

Die massenweise E-Mobilproduktion soll sich hauptsächlich in China abspielen, das mit seiner Vorgabe eines 10%-igen Anteils an strombetriebenen Autos aus der Smogbelastung herauskommen will. Diese ist aber nicht nur auf die in den letzten Jahrzehnten über China, das noch vor kurzem das Radfahrland Nummer eins in der Welt war, hereingebrochene Motorisierung zurückzuführen, sondern vor allem auf seine auf Kohle ausgerichtete Energie- und Industrieproduktion.

Können in China, das noch immer ganze Städte aus dem Boden stampft, Infrastrukturmaßnahmen für E-Autos gleich mitgeplant werden (etwa Stromtankstellen in Parkgaragen), ist in Europas Städten der Umstieg auf E-Mobilität schwer vorstellbar und wird zumindest mittelfristig eine Minderheitenveranstaltung bleiben. Hausbesitzer mit eigener Ladestation – im besten Fall Fotovoltaik – tun sich da leichter. Somit werden laut Wolf E-Autos gehobeneren Schichten als Zweitautos vorbehalten bleiben.

Die Probleme des Individualverkehrs bleiben auch bei Elektroantrieb bestehen. Das ist einerseits der enorme Platzverbrauch, der mit Zweitautos noch größer wird, andererseits das Unfallrisiko. Nur in wenigen begünstigten Ländern (Österreich Norwegen, Schweiz) gibt es einen Energiemix, der nicht den Bau weiterer fossiler oder atomarer Kraftwerke notwendig macht. Einzig die geringe Lärmentwicklung von E-Mobilen, die von den Autoherstellern immer beworben wird, erscheint als Vorteil.

Im Buch wird jedoch aufgezeigt, dass die Fahrtgeräusche von Elektroautos ab einer Geschwindigkeit von etwa 35 km/h denen von Fahrzeugen mit Verbrennungsmotor vergleichbar sind. Das bewirken Abroll- und Windgeräusche. Ab Mitte 2019 müssen Elektroautos zusätzlich künstlichen Lärm machen. Hier wurde Forderungen von Blindenverbänden Rechnung getragen, damit Sehschwache durch entsprechende Warngeräusche vor Unfällen geschützt werden.

Einen Ausweg aus der Mobilitätskrise sieht Wolf in einer Verkehrswende: Die drei „grünen“ Verkehrsarten Zufußgehen, Radfahren und öffentlicher Verkehr müssen begünstigt, die „roten“, zu denen der Autoverkehr zählt, eingeschränkt werden. Bei der Ausstellung „Alptraum Auto“ wurden diese Maßnahmen damals unter dem Begriff „Allgemeine Verkehrsberuhigung“ zusammengefasst. Eine Maßnahme, die auch schon 40 Jahre oder länger von Umweltgruppen und Grünen Parteien gefordert wird, gar nichts kostet und eine sofortige Reduktion der giftigen Autoabgase bringt, ist die Reduzierung der Geschwindigkeit (100 km/h auf Autobahnen, 80 km/h auf Bundesstraßen).

Winfried Wolf: Mit dem Elektroauto in die Sackgasse. Warum E-Mobilität den Klimawandel beschleunigt, Promedia 2019. 216 Seiten, ca. SFr 22.00, ISBN 978-3853714508

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————

Grafikquelle       :        Elektroauto Tesla Ladestation

Photographer
Source Imported from 500px (archived version) by the Archive Team. (detail page)
Permission
(Reusing this file)
w:en:Creative Commons
attribution
This file is licensed under the Creative Commons Attribution 3.0 Unported license.

Abgelegt unter Energiepolitik, Europa, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Im Westen nichts Neues:

Erstellt von DL-Redaktion am 24. September 2019

’Fridays for Future’
mit immerhin 1% der Saarländer!

Quelle       :          Scharf  —  Links

Von Dr. Nikolaus Götz

Es hätten auch weniger Teilnehmer sein können! Doch wenn man den Angaben der ermittelnden Polizei Glauben schenkt, dann haben allein am letzen Freitag in Saarbücken, der Landeshauptstadt der westlichsten Westprovinz der B(erliner) R(epublik) D(eutschland), sich unglaubliche „10 000“ Menschen für eine weitergehende Klimapolitik engagiert und sind mit ihren Forderungen protestierend auf die Straße gegangen. Wie der politisch Engagierte weiß, korrigiert die ’objektiv’ schätzende Staatsmacht unbewusst-bewusst jedoch solche Anzahldaten