DEMOKRATISCH – LINKS

                      KRITISCHE INTERNET-ZEITUNG

RENTENANGST

Archiv für die 'Bildung' Kategorie

Folgen Schulschließungen

Erstellt von DL-Redaktion am 28. März 2020

Corona macht Bildung ungleicher

File:Rückkehr vom Schulausflug.jpg

Von Ralf Pauli

Viele Lehrer:innen stellen jetzt auf E-Learning um. Doch der digitale Unterricht bevorzugt die ohnehin Privilegierten.

Die erste Schulwoche zu Hause ist rum. Und auch wenn die Erfahrungen der knapp 11 Millionen Schüler:innen im Land beim Home­schooling stark auseinandergehen dürften, lässt sich eines schon jetzt mit Bestimmtheit sagen: Das Coronavirus wird die deutsche Bildungslandschaft stärker prägen als alles, was Bund und Länder in den letzten Jahren in Sachen E-Learning beschlossen haben. Und das hat vor allem mit den Versäumnissen der Politik zu tun – und einer unmöglichen Schulbürokratie.

Jahrelang haben Bund und Länder um den Digitalpakt Schule gestritten, weil dafür das Grundgesetz geändert werden musste. Vor gut einem Jahr einigten sich beide Seiten – doch von den 5 Mil­liar­den Euro vom Bund ist noch fast nichts an die Schulen geflossen. In manchen Bundesländern ist noch nicht mal ein Prozent der Mittel bewilligt worden. Entsprechend desaströs ist es um die IT-Ausstattung an deutschen Schulen bestellt.

Nach einer aktuellen Umfrage unter Schulleiter:innen, die die Lehrergewerkschaft VBE am Freitag vorgestellt hat, gibt es nur bei rund einem Drittel der Schulen WLAN und eine Breitbandverbindung in allen Klassenzimmern. Schuleigene Tablets und Smart­phones besitzt auch nur gut ein Drittel der Schulen, und dann nicht einmal für alle Klassen. Wie sie Gelder des Digitalpakts abrufen können, darüber fühlen sich nur jede zweite Schulleiterin und jeder zweite Schulleiter gut informiert.

Tatsächlich können sie das gar nicht selbst, sondern nur die Schulträger, also meist die Kommunen. Und die scheinen es nicht sonderlich eilig zu haben mit den Anträgen. Was aber noch schlimmer ist: Die Schulen können nicht frei entscheiden, wofür sie das Geld ausgeben. Liegt der beschlossene Förderschwerpunkt auf IT-Infrastruktur, darf die Schule Kabel verlegen lassen, aber keine iPads kaufen. Kein Wunder, dass es unter Schulleiter:innen hinter vorgehaltener Hand heißt: Nur wer kreativ ist, kann Geld in die digitale Infrastruktur stecken.

Latein per E-Learning

Und doch: Plötzlich geht alles wegen Corona ganz schnell. Natürlich nicht mit einer unkomplizierten Auszahlung der Digitalpakt-Gelder – dem haben die Länder vergangene Woche schon eine Absage erteilt. Dafür aber mit dem digitalen Unterricht. Nach den Schulschließungen haben sich die Anmeldezahlen bei Lernplattformen vervielfacht. Auf den Bildungsservern der Republik finden sich plötzlich so viele digitale Lernangebote wie nie. Da gibt es E-Latein-Programme, Erklärvideos auf YouTube und Links zum Schulfernsehen.

Und auch wenn viele Leh­re­r:in­nen schnell über zusätzliche Arbeit stöhnen – ein wunder Punkt in den Lehrerzimmern –, sehr viele Lehrer:innen machen beim Experiment E-Learning mit. Der Unterricht wird digitaler – und das ist leider ein Problem. Schon jetzt hängt der Bildungserfolg in Deutschland stark von der sozialen Herkunft der Schüler:innen ab. Wer aus einer armen Familie kommt, hat deutlich geringere Chancen, auf ein Gymnasium zu kommen. Und noch geringere, es auf die Uni zu schaffen. Daran erinnert uns alle drei Jahre die Pisa-Studie. Das E-Learning wird die soziale Ungleichheit aber noch verstärken. Denn es gibt diesen Teufelskreislauf: Kinder, deren Eltern einen einfachen Bildungsabschluss haben, sind besonders stark armutsgefährdet. Den sozialen Aufstieg schaffen sie oft aber nicht, weil sie in diesem System früh ausgesiebt werden.

Quelle           :         TAZ           >>>>>         weiterlesen

——————————————————————–

Grafikquellen       :

Oben     —         Ausflüge in die nähere Umgebung gehörten bereits im 19. Jahrhundert zum Lehrprogramm der „Volksschulen“.

Author D. Fuchsberger

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

————————————-

Unten         —      Whiteboardeinsatz an einem Medientag (2011)

Abgelegt unter Bildung, Kultur, Mensch, Überregional | Keine Kommentare »

KOLUMNE MACHT

Erstellt von DL-Redaktion am 28. März 2020

Que sera, sera

File:Maischberger - 2016-12-14-7439.jpg

Von Bettina Gaus

Es gibt Ereignisse, die alles verändern. Das ist ganz sicher auch bei Corona so, auch wenn außer Christian Lindner niemand weiß, wie genau anders. Doch es gibt auch Dinge, die bleiben. Rassismus zum Beispiel

schernobyl. Der Fall der Mauer. Der 11. September. „Bis ans Ende unseres Lebens werden wir von Corona hören“, stöhnt die Tochter entnervt. Ja, so wird das sein. Komm klar. Keiner Generation sind Ereignisse erspart geblieben, die alle Sicherheiten in Frage stellten. Und die Gesellschaften von Grund auf veränderten. Zum Guten und zum Schlechten.

Über die Frage, welches die einschneidenden, äußeren Geschehnisse in den jeweiligen Biografien waren, können sich Tischrunden zerstreiten – wenn es wieder Tischrunden gibt. Allen Zäsuren ist gemeinsam: Als sie passierten, konnte sich niemand vorstellen, wie die Welt nach dem ersten Schock aussehen würde.

Das gilt auch für Corona. Was steht uns bevor, wenn die akute Krise vorbei ist? Das Ende der Globalisierung. Deren Anfang. Die Verödung der Innenstädte. Die Solidarisierung mit kleinen Geschäften. Der Siegeszug des Nationalen. Die Erkenntnis, dass kein Staat alleine überleben kann. Die Rückkehr der Religion in den Alltag. Die massenhafte Abkehr von Religionen. Die Stigmatisierung der Schwächsten. Der Kampf um und für alte Mütter.

In wenigstens einer Frage herrscht weitgehend Einigkeit: Es wird einen Quantensprung im Bereich der Digitalisierung geben. Konkret? Der FDP-Vorsitzende Christian Lindner hat im Fernsehen angekündigt, dass Präsidiumssitzungen seiner Partei auch nach Corona per Video stattfinden sollen. Keine überflüssigen Dienstreisen mehr.

FDP-Wahlkampfkundgebung in der Wolkenburg Köln-2209.jpg

Ja – wenn der Hochstapelnde DR. nicht anwesend ist stehen doch immerhin die großherrlichen Grafen auf ihren Maulwurfshügeln „Gewehr bei Fuß“ ! Wie einst gezeigt !

Sehr gut, Christian, du bekommst ein Fleißkärtchen. Zumal du mit den anderen in deiner Klasse – also den übrigen Mitgliedern des Präsidiums – darüber nicht gesprochen hast, bevor du es in die Kamera getrötet hast. Ganz brav.

Aber für Leute, die nicht nur Fleißkärtchen sammeln, fängt das Problem hier doch erst an. Homeoffice über Wochen hinweg macht vielen erst deutlich, dass persönliche Begegnungen unerlässlich sind. Gerade, wenn die Beteiligten viele Kilometer voneinander entfernt arbeiten.

Quelle      :        TAZ        >>>>>       weiterlesen

—————————————————————————

Grafikquellen       :

Oben      —  

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: © Raimond Spekking / CC BY-SA 4.0 (via Wikimedia Commons)

——————————-

Unten     —   FDP-Wahlkampfkundgebung in der Wolkenburg Köln. Im Bild: Spitzenkandidat Christian Lindner

Abgelegt unter Bildung, Deutschland, Gesundheitspolitik, P.FDP | Keine Kommentare »

KI oder KI oder was?

Erstellt von DL-Redaktion am 19. März 2020

 „Digitalisierung im Saarland“

Quelle         :          Scharf  —  Links

Ein Kommentar von Georg Korfmacher, München

Neulich wurde der Dozent für Computer- und Maschinenethik der Saar Uni als Experte in die Enquête-Kommission „Digitalisierung im Saarland“ berufen. Dort ist das Thema „Ethik“ als ein zentrales Querschnittsthema identifiziert worden. Der Experte ist an der Saar Uni federführend mitverantwortlich für die Lehrveranstaltung „Ethics for Nerds“. Diese wurde im Januar 2020 vom Stifterverband für die deutsche Wissenschaft als „Hochschulperle des Jahres“ ausgezeichnet. Nerds, muss man wissen, sind Langweiler ebenso wie Schwachköpfe, Computerfreaks aber auch Fachidioten, hochintelligente, aber kontaktarme Menschen ebenso wie Sonderlinge? Und alle undifferenziert ausgezeichnet? Da bleiben wir doch lieber bei der Ethik.

Bei der Vielzahl der heute gängigen Kürzel und Akronyme kann man leicht die Orientierung verlieren, wenn man den Kontext nicht genau hinterfragt. Seit Kant beschäftigt das Kürzel KI für „kategorischer Imperativ“ die deutsche Philosophie und Ethikdiskussion. Seit dem Siegeszug der Computer beschäftigen sich Forschung, Industrie, Handel und die Finanzwelt mit künstlicher Intelligenz (KI), einem eigentlich noch nicht genau definierten Begriff.

Auf der Hand liegt eine Affinität beider Akronyme nicht. Und doch gibt es verblüffende Gemeinsamkeiten. Nach Kant soll man nur nach derjenigen Maxime (Leitsatz) handeln, durch die man zugleich wollen kann, dass sie ein allgemeines Gesetz werde. Dieser doch recht übertakelt formulierte Leitsatz ist nämlich so ziemlich exakt das, was ein Programmierer bei der Entwicklung eines Algorithmus zur Steuerung eines Verhaltens/Verfahrens tut. Beide KIs gehen von einer Regel in der Entscheidungsmacht des Handelnden aus, der natürlich will, dass sich möglichst viele an die von ihm gewollte Regel halten. Das gilt für einen Diktator wie Hitler ebenso wie für den Programmierer von KI. Ein Unterschied besteht allenfalls in der Moral hinter dem gewollten Leitsatz.

Und das ist das große Dilemma beider KIs. Beide unterliegen der Willkür oder dem Auftrag des Handelnden. Die Betroffenen sind passiv bzw. Opfer.

Der KI ist insofern eine Einbahnstraße und verdient nicht in die Nähe der „Goldenen Regel“ der Ethik gerückt zu werden. In der z.B. von Konfuzius überlieferten Version: “Was du nicht für dich selbst willst, tue anderen nicht an”, wird in schnörkelloser Einfachheit die Befindlichkeit der Betroffenen zur Grundlage für moralisches Handeln und für ethische Eigenverantwortung gemacht. Das ist radikal anders als beim KI als Ausdruck kantscher Überformungen. Ein Heilmittel dagegen wäre z.B. die „Ethik der Wertschätzung“ von Corine Pelluchon mit verblüffenden Anregungen für Humanität und zukunftsfähiges Miteinander.

Beide KIs versuchen, sich in unseren Köpfen einzunisten. Während der KI mit zunehmendem Wissen und Ethikverständnis seinem Ende entgegendümpelt, stößt die KI nach im Wesentlichen unkontrollierter und stürmischer Entwicklung an unerwartete Grenzen und bedarf dringend einer umfassenden Aufarbeitung.

Einerseits sind im Zeitalter künstlicher Intelligenz viele alte Strategien und herkömmlichen Techniken unzureichend. Die KI wird weitgehend aus unserer Bildung ausgeklammert und Spezialisten überlassen. Andererseits werden Algorithmen von eben diesen Spezialisten programmiert, trainiert und eingesetzt und spiegeln deren Werte und Vorstellungen wider. Algorithmen haben daher allenfalls die Moral ihrer Entwickler bzw. deren Auftraggeber. Die KI kennt also keine Verantwortung an sich, sondern eben nur programmierte Ausführung. Und das macht eine grundsätzliche, kritische Diskussion überfällig. Wir müssen dringend die Widersprüche zwischen unserem Wissen und unserem Tun klären.

Während Gewinn- und Eigennutzmaximierung eher zunehmend das oberste Gebot in unserer Gesellschaft werden, sind wir unversehens in eine gesellschaftliche Krise mit einer Verschiebung der Werte geraten. Die Bewegung FFF ist nur ein Beispiel dafür, dass und wie sich Widerstand formiert und artikuliert. Wir müssen unser Handeln mehr denn je auf gesamtgesellschaftliche Auswirkungen überprüfen. „Denn [nur] datengetriebenes Denken und datenbasiertes Management, wie wir es heute praktizieren, kennt bislang nur die eine Maxime, die wir ihr beigebracht haben: maximale Effizienz.“ (Baha Jamous).

A doctor who writes books of sexual advice talking Wellcome L0034920.jpg

In diesem Dilemma kann der KI die KI nicht weiterbringen. Auch die Goldene Regel könnte sich schnell als Hemmschuh für den technischen Fortschritt erweisen, weil viele Menschen Angst vor einem Fortschritt haben, den sie nicht verstehen oder nicht für sich wahrnehmen. Also muss endlich nachgeholt werden, was bisher sträflich vernachlässigt worden ist: Bildung und Aufklärung, damit jeder Mensch autonom und in Harmonie mit dem Universum seine eigene Meinung bilden und Entscheidungen treffen kann. Wir müssen zu einem gesellschaftlichen Konsens mit dem Wohl der Menschen als oberstes Ziel kommen. Und dies darf von keiner KI umgangen, unterminiert oder verfälscht werden. Sicherlich eine schwierige Aufgabe, aber wer sich kein Ziel setzt, kommt nie an. Akademisches Freiturnen für nerds aber ist ein zweifelhafter Ideengeber.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————

Grafikquellen       :

Oben         —     Scharf – Links      —       Bildmontage HF

————————————-

Unten       —       A doctor who writes books of sexual advice talking to his cynical publisher. Coloured lithograph, 1852. Iconographic Collections Keywords: Physicians; Ethics; Satire; Erotica

Abgelegt unter Bildung, International, Kultur, Mensch | Keine Kommentare »

Wir retten die Welt

Erstellt von DL-Redaktion am 13. März 2020

Glauben Sie wirklich noch an Corona?

File:院長接受防護衣捐贈.jpg

Von Bernhard Pötter

Liebe kritische Zeitgenossen! Sie googeln häufig „Der Klimawandel ist eine Erfindung der Illuminaten“ und telefonieren gern mit dem hellsichtigen brasilianischen Präsidenten Bolsonaro. Deshalb wollte ich Sie darauf hinweisen, dass gerade die nächste Gefahr durch linke Ideologen droht: die Aufregung rund um das Corona-Virus. Wer wie Sie Verschwörungen durchschaut, wird wie wir sagen: Ich glaube nicht an Corona.

Mal ehrlich: Haben Sie schon einmal ein Coronavirus gesehen? Sehen Sie! Nach dem Kohlendioxid wieder eine angebliche Gefahr, die unsichtbar ist. Ein winziges Virus soll die Kraft haben, Menschen zu töten? Das wäre ja genauso verrückt, als könne CO2 mit seinem Anteil von 0,04 Prozent die Erdatmosphäre verändern! Und wer erzählt uns das? Sogenannte „Experten“, die ihr Leben in Laboren vor Mikroskopen und Zellkulturen verbringen. Manche von ihnen sollen sogar Kontakte zur Pharmaindustrie haben – einer weltweit agierenden milliardenschweren Branche, die davon lebt, dass wir krank sind. Sie hören keinen Widerspruch unter Wissenschaftlern? Da sehen Sie mal, wie effektiv abweichende Meinungen unterdrückt werden.

Die Öffentlichkeit vertraut diesen „Experten“, die auf Forschungsgelder von Regierung und Industrie angewiesen sind. Wir aber haben unsere eigenen Quellen: Hier eine pensionierte Sprechstundenhilfe aus einer Hautarztpraxis, da der Bericht eines anonymen Raumpflegers, der in den Laboren von Pfizer die Böden gewischt hat. Diese Leute sind nah dran!

Quelle        :         TAZ          >>>>>        weiterlesen

—————————————————————-

Grafikquelle      :

Description
中文(繁體)‎: 立法院院長王金平等接受SARS防護衣捐贈
Date Taken on 
Source http://www.ly.gov.tw/12_gallery/galleryView.action?id=1361
Author 立法院網站資料開放宣告
The copyright holder of this file allows anyone to use it for any purpose, provided that the copyright holder is properly attributed. Redistribution, derivative work, commercial use, and all other use is permitted.

Abgelegt unter Bildung, Feuilleton, Gesundheitspolitik, International | Keine Kommentare »

Keine Emanzipation

Erstellt von DL-Redaktion am 11. März 2020

Care-Arbeit im Kapitalismus

 

File:Merkel Kohle fertig - Satire.jpg

Von Erica Zingher

Frauen, die Karriere machen wollen, beschäftigen oft Care-Arbeiterinnen, wie Putzfrauen oder Nannys. Doch ist das die Lösung für Gleichberechtigung?

Wenn die Hälfte aller Firmen von Frauen und die Hälfte aller Haushalte von Männern geführt würden, dann wäre die Welt eine bessere. Diesen Gedanken formulierte Facebook-Geschäftsführerin Sheryl Sandberg in ihrem 2013 erschienen Buch „Lean In“. Über die Jahre entwickelte sich auf Grundlage von Sandbergs Ideen eine feministische Bewegung: „Lean In“ soll Frauen dazu ermutigen, ihr Leben selbst in die Hand zu nehmen. Will eine Frau gleichberechtigt leben, braucht sie demnach nicht mehr als paritätisch besetzte Führungsebenen und eine Sandberg, die am Rande steht und ihr zuruft: „Stellen Sie sich vor, was Sie tun würden, wenn Sie keine Angst mehr hätten. Und dann machen Sie es!“

Sandbergs sogenannter liberaler Feminismus gibt vor, Antworten für alle Frauen bereitzuhalten. In Wirklichkeit hat er die aber nur für Weiße, Privilegierte. Migrantische und Schwarze Frauen sowie Arbeiterinnen bleiben außen vor. Denken wir Sandbergs Gedankenspiel einmal zu Ende: Würden erfolgreiche Frauen tatsächlich zuhauf in Aufsichtsräten und Vorständen sitzen, würden sie schnell merken, dass sie sich ihre Karrieren nur deshalb leisten könnten, weil sie sogenannte Care-Arbeit – also alles, was Kindererziehung, einkaufen, putzen oder Pflege betrifft – an andere auslagern. Im Beruf wären die Sandberg-Frauen gleichberechtigt, die Kosten dafür trügen Marginalisierte. Ist das die Antwort, die Feminismus heute bereithält?

Klar: Kinder, Karriere, Haushalt und Pflege unter einen Hut zu bekommen, ist für zwei voll Berufstätige schwer möglich. Deshalb beschäftigen viele Reinigungskräfte, die im Haushalt mithelfen, sie engagieren Nannys, die die Kinder betreuen. Laut einer Studie des Instituts für Deutsche Wirtschaft in Köln lassen sich über 3,3 Millionen deutsche Haushalte regelmäßig oder gelegentlich von einer Haushaltshilfe unterstützen. Fast 90 Prozent dieser Haushaltshilfen befinden sich in illegalen Arbeitsverhältnissen und der Großteil von ihnen ist weiblich. In Deutschland gibt es laut Pflegestatistik rund 3,4 Millionen Pflegebedürftige. Gepflegt werden sie oft von Frauen aus Polen oder anderen osteuropäischen Ländern. Manche dieser Frauen berichten von fehlender Privatsphäre, langen Arbeitszeiten, Übermüdung und auch Gewalterfahrungen.

Migrantische Frauen und illegalisierte Arbeiterinnen verlassen ihr Zuhause, um im Ausland in fragwürdigen Verhältnissen Geld zu verdienen. An welchen Feminismus sollen sie glauben?

Faire Bezahlung reicht nicht aus

Viele Feminist*innen fordern faire Bezahlung und legale Beschäftigungsverhältnisse für Care-Arbeiterinnen. Aber die Forderung geht nicht weit genug. Denn eine fair bezahlte Reinigungskraft bleibt noch immer eine marginalisierte Arbeiterin, die in der Regel nicht das Privileg hat, sich ihre Beschäftigung auszusuchen.

Neben den Sandberg-Frauen, die sich Arbeitsmigrantinnen leisten, weil sie es können, sind da noch die, die ihre Arbeit auslagern, weil sie es müssen. Wie alleinerziehende oder chronisch kranke Frauen. Sollten sie sich schlecht fühlen, weil sie Care-Arbeiterinnen engagieren? Für Frauen, die es sich nicht leisten können, eine Reinigungskraft einzustellen oder es nicht wollen, heißt es auch weiterhin nach acht Stunden Lohnarbeit: Ihr Arbeitstag wird zu Hause fortgesetzt, Care-Arbeit leisten sie selbst und unbezahlt.

Catrinas - Day of the Dead Ladies.jpg

Die Vereinbarkeit von Beruf und Kindern wird noch immer zu einem Thema gemacht, das lediglich Frauen betrifft. Wo bleiben die Männer in dem Gedankenspiel? Frauen können fordern, dass Männer gleichermaßen Haushalts- und Fürsorgearbeit übernehmen. Oder dass sie Verbündete im Kampf gegen die Ungleichbehandlung werden. Aber das wäre nur ein kleiner Gewinn, wenn Frauen an anderer Stelle immer noch benachteiligt blieben. Denn Frauen würden ja weiterhin im Beruf schlechter bezahlt werden als Männer. Und durch diesen ökonomischen Zwang wären es auch viel mehr Frauen als Männer, die nach der Geburt eines Kindes zu Hause blieben, die später vielleicht in Teilzeit arbeiteten, die zurückstecken würden, damit Männer Karriere machen könnten.

Es gibt keine einfache Antwort darauf, ob es in Ordnung ist, Care-Arbeiterinnen zu engagieren. Denn das Problem liegt im System. Solange wir im Kapitalismus leben, werden unentwegt Ungleichheiten produziert. Wo eine Frau an einer Stelle privilegiert ist, nimmt sie an anderer Stelle einer anderen Frau das Privileg weg – und umgekehrt. Ist das ein Zustand, den man aushalten muss? Oder ist es möglich, eine radikale feministische Position zu entwickeln, die inklusiv ist?

Die Klassenfrage in den Blick nehmen

Quelle         :       TAZ        >>>>>        weiterlesen

——————————————————————–

Grafikquellen     :

Oben       —  

Deutsch: 2013/14 setzt das „Büro für ungewöhnliche Maßnahmen“ die Arbeit mit Realmontagen im öffentlichen Raum fort mit der Serie „Merkel goes to demo“ – hier mit den Chefs der 4 Energiemonopolisten bei einer Demonstration 2014 zur Energiewende Foto: Elke Hollmann
Date
Source Team Büro für ungewöhnliche Maßnahmen
Author Elke Hollmann

Berlin

Licensing

Creative Commons CC-Zero This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.
The person who associated a work with this deed has dedicated the work to the public domain by waiving all of his or her rights to the work worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law. You can copy, modify, distribute and perform the work, even for commercial purposes, all without asking permission.

———————————

Unten      —      Catrinas – Day of the Dead Ladies

Abgelegt unter Bildung, Gesundheitspolitik, Kultur, P.CDU / CSU | Keine Kommentare »

Neue feministische Welle

Erstellt von DL-Redaktion am 8. März 2020

Brücken bauen, Kämpfe verbinden

2018 New York City Women's March (28040480439).jpg

Von Christa Wichterich

Vor genau einem Vierteljahrhundert fand in Peking die inzwischen legendäre vierte Weltfrauenkonferenz statt. In dem dort verabschiedeten Forderungskatalog verpflichteten sich die 189 teilnehmenden Staaten unter anderem, die Gleichstellung der Geschlechter zu fördern, die Rechte der Frauen zu schützen, die Armut von Frauen zu bekämpfen und Gewalt gegen Frauen zu verfolgen. Heute, 25 Jahre später, geraten viele der damals erkämpften Rechte weltweit wieder in Bedrängnis. Weit über das konservativ-religiöse Lager hinaus breitet sich ein aggressiver Anti-Feminismus rechtspopulistischer Färbung aus, der prominent von einer wachsenden Zahl autoritär-rechter Regierungen vertreten wird. Mit nationalistischem und rassistischem Tenor hat er sich transnational als kulturelle Gegenrevolution formiert und will traditionelle Geschlechterrollen revitalisieren.[1]

Gleichzeitig erleben wir jedoch einen Neuaufbruch, ja möglicherweise sogar eine neue Welle transnationaler feministischer Bewegungen: Das zeigte sich jüngst in der global nachgespielten Performance gegen sexualisierte Gewalt des chilenischen feministischen Kollektivs „Las Tesis“, an den Frauenstreiks von Argentinien bis zur Schweiz, an neuen Anti-Gewalt-Kampagnen von #metoo bis „ni una más“/„ni una menos“ in Lateinamerika[2] und den Demokratie-Protesten des Global Women’s March in den USA bis hin zu den Revolten im Sudan, in Libanon, Iran, Chile und Indien, bei denen junge Frauen ihre Belange prominent repräsentieren, weil sie wissen, dass ihre erst vor Kurzem erlangten Rechte in Gefahr sind. Auch die Fridays-for-Future-Bewegung hat mit Greta Thunberg – und für den deutschen Kontext Luisa Neubauer oder Carla Reemtsma – ein weibliches, wenn auch kein dezidiert feministisches Profil. Neu ist vor allem der Doppelcharakter der Bewegungen, die sich einerseits online über die sozialen Medien verbreiten und mobilisieren und andererseits die Straße zurückerobern. Damit haben sie nicht nur eine große Sichtbarkeit gewonnen, sondern auch Impulse für die Internationalisierung von Kampagnen gesetzt. Themen wie sexualisierte Gewalt, die Liberalisierung von Abtreibung oder politische Partizipation tauchen in neuen Formaten zeitgleich in analogen und digitalen Handlungsräumen auf, sind aber auch inhaltlich weiterentwickelt worden. Eine solche neue Internationalisierung von Feminismen ist auch dringend nötig: Das Erstarken von gleichstellungsfeindlichen und homophoben Strömungen im vergangenen Jahrzehnt hat sogar zur Entscheidung geführt, keine 5. Weltfrauenkonferenz abzuhalten. Zu groß ist die Furcht, dass wegen des massiven Backlashs die Ergebnisse hinter die der Peking-Konferenz von 1995 zurückfallen könnten. Zuletzt hat der UN-„Bevölkerungsgipfel“, der im November 2019 in Nairobi 25 Jahre nach der Weltbevölkerungskonferenz von Kairo stattfand, diese Befürchtungen bestätigt. Elf Regierungen von den USA über Brasilien bis Polen meldeten vorab Vorbehalte an: Sie lehnen das 1994 in Kairo beschlossene Konzept sexueller und reproduktiver Rechte ab, weil es Abtreibung und Sexualaufklärung für Kinder fördere und LGBTIQ-Personen anerkenne. Aus ihrer Sicht zerstört das die patriarchale Familie als ordnungspolitische Keimzelle der Gesellschaft. Ultrakonservative Regierungen und der Vatikan kamen erst gar nicht nach Nairobi. Nach der Konferenz kündigte Brasiliens Präsident Jair Bolsonaro den „Konsens“ von Kairo auf, ganz so wie bereits zuvor US-Präsident Donald Trump das UN-Klimaschutzabkommen aufgekündigt hatte. Da liegt es nahe, dass einzelne Staaten aufgrund ihrer Ablehnung von Frauenrechten auch die Beschlüsse der Peking-Konferenz revidieren könnten. Damit zeigt sich einmal mehr: Im Kontext von wachsendem Autoritarismus und Nationalismus schrumpfen die Handlungsmöglichkeiten für kritische zivilgesellschaftliche Netzwerke und verliert der Multilateralismus an Bedeutung.

Dennoch betrachten Frauennetzwerke das Konferenz-Jubiläum als „einmalige Gelegenheit“, das Thema Geschlechtergerechtigkeit erneut auf die nationale und internationale politische Agenda zu hieven.[3] Mit einer strategischen Zukunftsorientierung sind im Jubiläumsjahr denn auch zwei internationale „Generation Equality“-Foren geplant, im Mai in Mexiko und im Juli in Paris. Dabei sieht sich die „Generation Equality“ in der Nachfolge der „Global Women’s Lobby“, der zentralen Triebkraft der Peking-Konferenz.

Erinnern wir uns: Die Global Women’s Lobby startete bei der Umwelt- und-Entwicklungskonferenz 1992 in Rio de Janeiro als ein Sammlungs- und Suchprojekt auf Grundlage der Formel: „Menschenrechte sind Frauenrechte.“ Zum einen wollte sie sondieren, ob und wie sich das Menschenrechtsparadigma für die Bewusstwerdung über und die Einlösung von Frauenrechten universell eignet, sprich: in verschiedensten Ländern und Kulturen und zudem auch für unterschiedliche Themenbereiche. Zum Zweiten setzte sie systematisch auf die Strategie, mit Hilfe von geschlechterpolitischen Normsetzungen auf UN-Ebene auf die nationale Ebene Druck auszuüben. 1995 feierte die Global Women’s Lobby die Konferenz in Peking als einen menschen- und frauenrechtlichen Quantensprung und sich selbst als ein nicht mehr zu ignorierendes politisches Subjekt in der multilateralen Politik.

Zwar gab es auch damals zahllose Differenzen und Kontroversen innerhalb der internationalen Frauenrechtsszene. Doch die UN-Konferenzen boten den Rahmen für strategische, zielgerichtete „Verschwisterung“ und ein nach außen geeintes Auftreten gegenüber politischen Institutionen. In diesem Prozess wurden Feministinnen und Gruppierungen aus dem globalen Süden zunehmend zu Protagonistinnen bei der Themensetzung und bei Verhandlungen mit Regierungen. Als zentrale Strategie formulierte das Netzwerk DAWN von Frauen aus dem globalen Süden „Transformation durch Partizipation“. Seitdem haben sich nicht nur die nationalen und die multilateralen Rahmenbedingungen für Geschlechterpolitiken grundlegend verändert, sondern auch die Frauenbewegungen selbst.

Die imaginierte Einheit der Weltfrauenkonferenzen

Nach ihrem starken Anwachsen rund um die Peking-Konferenz erodierten die transnationalen feministischen Vernetzungen wieder. Heute sind sie hochgradig fragmentiert, divers und voller Widersprüche. Eine zentrale Ursache war die Institutionalisierung von Frauenrechtspolitik. Dazu trat aber auch eine innere Differenzierung durch die Vervielfältigung von Identitätspolitiken, unter anderem durch die zunehmend separate Organisierung unterschiedlicher Interessengruppen wie Queer- und LGBTIQ-Personen oder Migrant*innen verschiedenster Herkunft, aber auch durch postkoloniale Kritik und die Kritik schwarzer Feministinnen an den Hegemonieansprüchen weißer Feministinnen. Heute wird die Geschichte von nationalen und internationalen Frauenbewegungen daher neu geschrieben. Das geschieht mit einer doppelten Differenzierungsperspektive: zum einen mit einem Dekolonisierungsansatz, der das Nord-Süd-Verhältnis als vielschichtig koloniales, eurozentristisches und rassifiziertes Herrschaftsverhältnis analysiert, und zum anderen mit einem intersektionalen Ansatz, der die unauflösbare Verschränkung der Diskriminierung von Geschlecht mit anderen Ungleichheitssystemen wie Klasse, Kaste, Hautfarbe, Herkunft, Alter usw. betrachtet.

Aus dieser Sicht waren die vielgerühmte Verschwisterung der Frauenrechtler*innen im Peking-Prozess und ihre Einheit in der Vielfalt nur imaginiert. „Ich bin nicht eure Schwester“, empörte sich die postkoloniale Theoretikerin Gayatri Spivak und bezeichnete die Pekinger Konferenz als ein „globales Theater“, das die „tiefe transnationale Uneinigkeit“ verschleiere und eine gigantische Arbeitszeit- und Geldverschwendung gewesen sei.[4]

3ª Marcha das Mulheres Negras no Centro do Mundo, no RJ - 35875130410.jpg

Ungeachtet dieser Kritik wandten sich frauenpolitische Organisationen nach der Peking-Konferenz verstärkt der nationalen Ebene zu, um die Umsetzung der in Peking verabschiedeten Aktionsplattform voranzutreiben, die durch den global gültigen Frauenrechtskatalog legitimiert war. Viele Staaten institutionalisierten in der Folgezeit die Gleichstellungspolitik, unterschieden sich dabei aber mit Blick auf ihren politischen Willen, die Akzentsetzungen, das Tempo und die Erfolge. Meist wurden dabei radikale feministische Forderungen weichgespült, Frauenorganisationen eingebunden und der Eindruck erweckt, zivilgesellschaftliches Engagement für eine geschlechtergerechte Politik sei damit überflüssig geworden. Frauenrechtsaktivistinnen kritisierten die politischen und legalen Gleichstellungsmaßnahmen meist als nicht ausreichend, zu langsam, nicht systematisch und zu symptomorientiert.

Quelle      :           Blätter           >>>>>       weiterlesen

—————————————————————

Grafikquellen      :

Oben      —           2018 New York City Women’s March (28040480439)

Abgelegt unter Bildung, International, Kultur, Mensch | Keine Kommentare »

» Wem zum Vorteil ?«

Erstellt von DL-Redaktion am 7. März 2020

Cui bono? Wem nützt die Corona-Seuche?

File:院長接受防護衣捐贈.jpg

Quelle      :      Scharf  —   Links

Ein Kommentar von Hermann Ploppa.

Wem nützt Covid-19? Ein öffentliches Nachdenken über Corona und ihre Freunde.

Ich bin ratlos. Denn der Tsunami an klugen Leuten, die uns Corona, oder eben genauer: Covid-19, in Talkshows, Vorträgen, youtube-Ergießungen oder Facebook erklären, macht mich von Tag zu Tag ratloser. Mir ergeht es wie dem Zuschauer eines packenden Tischtennisspiels. Das zarte weiße Bällchen federt von Spieler zu Gegenspieler und zurück, und ich drehe meinen Kopf, dem Bällchen mit den Augen folgend, immer von rechts nach links und zurück von links nach rechts. Bis zur perfekten Nackenstarre. Sieht nicht gerade intelligent aus.

Da sagen die Einen: die Gefahr einer Massenepidemie durch das garstige Covid-19-Virus kann man gar nicht ernst genug nehmen. Unsere Vorsorge muss zu Höchstform auflaufen. Das Fräulein Corona versteht keinen Spaß. Der Staat und dessen Behörden arbeiten indes noch immer viel zu langsam. Wenn das so weitergeht, werden wir eine furchtbare Pandemie auch in Deutschland haben. Alles Quatsch, sagen die anderen: Corona ist nicht gefährlicher als herkömmliche Grippe-Epidemien und Pandemien auch. Eigentlich ist Corona ein Witz. Eine schamlos aufgeplusterte Massenaufregung. Eine Generalprobe für den tiefen Sicherheitsstaat. Wem also nützt Covid-19? Dem Pentagon, der Pharmaindustrie, Freimaurern, Aliens oder Jesuiten?

Immerhin sind wir schon derart verunsichert, dass meine Frau und ich bei Aldi einige Packungen Nudeln und Reis mehr gekauft haben als wir in den nächsten Wochen verarbeiten können, sowie Weizen und Dinkel, um Brötchen selber backen zu können. Wir backen sowieso schon selbst, was soll‘s. Dies ist die große Stunde der Prepper-Szene, also jener Leute, die sich schon jetzt auf die Apokalypse vorbereiten und dann einige NATO-Brotdosen länger leben werden als wir uninformierten Normalidioten.

Wem nützt es? Bei den meisten Seuchen der letzten beiden Jahrzehnte ist das ganz klar. Vogel- und Schweinegrippe waren ein beispielloser Akt des organisierten Verbrechens. Eines gigantischen Diebstahls unseres gemeinsamen öffentlichen Vermögens durch Kleptokraten aus Politik, Wissenschaft, Medien und so genannter „freier“ Wirtschaft. Wir haben nämlich mittlerweile den Zustand erreicht, dass staatliche Stellen, Universitäten und sogar die UNO unterwandert sind von Maulwürfen der Pharmaindustrie. So konnte Laurent Kaiser in den frühen 2000er Jahren als Leiter des Zentralen Virologischen Labors Genf der dortigen Universitätsklinik zehn wissenschaftliche Aufsätze so zusammenstellen, dass sich für die Öffentlichkeit der Eindruck ergab, das Grippemittel Tamiflu, ein Produkt des Schweizer Pharmakonzerns Hoffman La Roche, sei zweifelsfrei das ideale Medikament gegen die Schweinegrippe (1).

Später kam heraus, dass acht von den zehn „wissenschaftlichen“ Aufsätzen von dem Schweizer Pharmakonzern Hoffman La Roche bezahlt und nie in wissenschaftlichen Zeitschriften veröffentlicht wurden. Nur zwei der zehn Aufsätze waren seriös veröffentlicht worden und wurden nicht von Hoffman La Roche gesponsert. Und diese beiden Studien besagten, dass es in der Wirksamkeit praktisch keinen Unterschied gibt zwischen Tamiflu und Placebo. Mit anderen Worten: Tamiflu hilft nicht gegen Grippe. Aber das kam erst heraus, als etliche Staaten bereits Milliarden von Euros oder Dollars für den Ankauf von Tamiflu ausgegeben und damit die dicken Taschen der Pharmakonzerne noch weiter aufgefüllt hatten. Es blieb nicht dabei, Tamiflu staatlich zu horten. Die Regierung von Großbritannien bereitete ihre Armeen auf das Szenario vor, erboste Mitbürger, die kein Tamiflu mehr bekommen hätten, zu disziplinieren. Als die Staaten allzu lange auf ihren Tamiflu-Halden festsaßen, wurde endlich ein Anlass erfunden, um jene Droge von Hoffman La Roche unter die Leute zu bringen.

In einer gigantischen Kampagne wurde der Ausbruch der schrecklichen Pandemie der Schweinegrippe ausgerufen. Doch die Masseninfektion blieb aus. Und nun mussten die blamierten Regierungen den wertlosen Schund irgendwo abwerfen. Der deutsche Virologe und SPD-Politiker Wolfgang Wodarg war damals Gesundheitsexperte in der Parlamentarischen Versammlung des Europarats und führte einen ebenso einsamen wie heroischen Feldzug gegen den Schweizer Pharma-Goliath Hoffman La Roche. Sein Resümee

„Sie [die verantwortlichen Politiker] haben knappe Gesundheitsmittel vergeudet für wirkungslose Impfstrategien und setzten unnötigerweise Millionen gesunder Menschen dem Risiko unbekannter Nebenwirkungen von nicht ausreichend getesteten Impfstoffen aus.“ (2)

Das sei hier noch einmal so ausführlich erwähnt, weil damals dieses himmelschreiende Verbrechen, dieser Akt schamloser Korruption, niemals strafrechtlich verfolgt worden ist. Gesundheitspolitiker Wodarg kämpfte allein auf weiter Flur und versuchte Führungskräfte der UNO-Gesundheitsbehörde WHO, die sich allzu ungeniert an diesem Komplott beteiligt hatten, vor Gericht zu zerren. Ohne Erfolg. Nichtsdestoweniger gab es Konsequenzen: Wolfgang Wodarg verschwand von der politischen Bühne. Bei der Bundestagswahl 2009 verlor er sein Mandat.

Cui Bono? Wem nützt es? Das war damals klar zu bestimmen: der Pharmaindustrie. Heute liegt der Fall gänzlich anders. Gegen Covid-19 hat kein Staat der Welt einen Impfstoff gehortet. Vielmehr hat ja erst das Aufkommen des neuartigen Virus dessen Definition notwendig gemacht. Zudem wurde Covid-19 zum ersten Mal in China entdeckt. China ist kein führendes Land der Pharmawirtschaft, so wie die USA, Deutschland oder die Schweiz. China produziert vornehmlich Generika, also Lizenzprodukte, die im Moment stark angefragt sind. Aber die chinesische Wirtschaft leidet bekanntlich furchtbar unter der Epidemie. Und im Gegensatz zur SARS-Epidemie anfangs der 2000er Jahre handelt China diesmal sehr transparent und informiert die Weltöffentlichkeit relativ früh über den Ausbruch der Seuche. Dass bei einem Versuch mit chinesischen Biowaffen ein Erreger aus den Labors ausgekniffen ist, kann getrost als westliche Propaganda entsorgt werden. China hat von der Seuche offenkundig keinen Vorteil.

Cui Bono? Nützt die Seuche den Interessen der USA? Haben die USA womöglich sogar eine Biowaffe in China eingeschleust, um ihrem gefährlichsten Herausforderer die Zähne zu ziehen? Ich muss gestehen, dass ich zuerst dieser Hypothese zuneigte. Denn es erscheint mir klar, dass die USA weder militärisch noch wirtschaftlich China niederringen können. Da liegt es doch nahe, auf die ganz subtile Weise des Biokrieges den Feind innerlich ausbrennen zu lassen? Dieser Frage geht Peter König nach (3). Zunächst einmal: nach allem was man über die Experimente des Pentagons weiß, ist ein Biokrieg gegen China eine beklemmend realistische Option. Allerdings verstört König in seinem Artikel schon mit dem Satz: „Die westlichen Medien schweigen auch darüber, dass das Virus anscheinend in hohem Maße ethnische Chinesen befällt, d.h. dass es speziell auf chinesische DNA abzielt. Fast alle Todesfälle und bestätigten Fälle in den 51 Ländern und Gebieten, in die das Virus sich ausgebreitet hat, sind chinesischen Ursprungs.“ Chinesisches Gen? Ethnische Chinesen? Doppelter Schluckauf. Denn nach dem Zweiten Weltkrieg, nach der Verdrängung der Eugenik von der großen globalen Bühne, ist man in der Wissenschaft zu dem Schluss gekommen, dass sich „Rassen“ nicht in ihrer Genstruktur unterscheiden. Phänotyp ist nicht gleich Genotyp.

Soll heißen: unterschiedliche Hautfarbe ist keine Folge unterschiedlicher genetischer Beschaffenheit. Und dass gar Völker, also z.B. Franzosen und Deutsche unterschiedliche Gene haben sollen, behauptet eigentlich niemand. Zudem sind ethnische Chinesen erst zu Zeiten der nationalistischen Bewegung von Sun Yat-Sen erfunden worden. Erst um die Wende zum Zwanzigsten Jahrhundert wurden völlig unterschiedliche Ethnien zum so genannten Han-Volk zusammengefasst, um dem ethnisch begründeten Nationalismus der europäischen und amerikanischen Eroberer etwas entgegenzusetzen. Weiterhin führt König an, dass im Herbst letzten Jahres in China eine Militär-Olympiade stattgefunden habe, an der auch 200 amerikanische Sportler teilgenommen hätten. Daraufhin sei in Wuhan das Coronavirus ausgebrochen. Solche Argumentationen lassen mich eher von der Hypothese eines amerikanischen Biokrieges gegen China durch Corona Abstand nehmen, alldieweil König seine Vermutungen vorsichtigerweise zu einem „Bauchgefühl“ herunterstuft. Das schadet der Aufklärung eher als dass es nützt. Leider.

File:Pegida Banner, Lügenpresse Banner.jpg

Also begeben wir uns auf festeres Eis und überlegen einmal, wem die Corona-Pandemie eher zufällig nützen könnte. Quasi als „Kollateralnutzen“. Seitdem die Leipziger Buchmesse mal eben knall auf fall abgesagt wurde, ist klar, dass das geistige Leben in Deutschland massiv heruntergefahren wird. Worüber wird nun nicht gesprochen? Richtig. Über das NATO-Großmanöver Defender 2020. Während die ersten Schiffe in Bremerhaven mit allerlei Kriegsgeschirr entladen werden, räumen wir die Regale bei Aldi leer. Passt. Da haben wir die Proviantierung für den Ernstfall zumindest schon einmal gedanklich in unser Hirn und unser Herz aufgenommen. Und schon mal praktisch eingeübt. Die erste Hürde der mentalen Kriegsvorbereitung ist genommen. War sicher nicht beabsichtigt, wird sich aber als ganz nützlich erweisen.

Und überhaupt. Was ist denn das mit dem Manöver? Heißt es nicht, man soll Menschenansammlungen meiden und am besten nur noch zuhause bleiben? Körperliche Berührungen unterlassen? Auf sicherer Distanz bleiben, um den sabbernden Sprühregen unserer Mitmenschen nicht abzubekommen? Ja, und dann toben hier sage und schreibe 38.000 uniformierte Männlein und Weiblein durch Deutschland, Polen und das Baltikum, um in enger Tuchfühlung den Krieg gegen Russland zu üben? Wenn die Pandemie wirklich so gefährlich ist, muss dann nicht sofort das Manöver Defender 2020 abgesagt werden? Müssen die SoldatInnen dann nicht in Quarantäne gesteckt werden? Lässt man hoch qualifizierte Kriegshandwerker mal eben ganz zivilistisch an Covid-19 verenden? Verbrennt man mutwillig „militärisches Humankapital“? Oder sind die SoldatInnen immun wie dereinst der wiedererweckte Protagonist Neo im Superfilm Matrix?

Nehmen wir jedoch einmal – rein hypothetisch – an, dass Covid-19 und seine Freunde uns in einer wirklich lebensgefährlichen Pandemie zu Boden schmeißen werden. Ist denn das deutsche Gesundheitswesen überhaupt darauf vorbereitet? Man muss gar kein Insider der deutschen Krankenhausszene sein um beurteilen zu können, dass deutsche Krankenhäuser in keiner Weise einen solchen Ansturm von Corona-Verdächtigen aufnehmen können. Ein Drittel aller Krankenhäuser in Deutschland ist der öffentlichen Hand mittlerweile durch Privatisierungen entrissen worden. Es gilt nicht mehr der Grundsatz, Kranken zu helfen, sondern es geht um Gewinne, Renditen und Dividenden. Krankenhausabteilungen, die Gewinn abwerfen, werden gefördert. Intensivstationen sind indes extrem kostenintensiv und nicht rentabel zu machen (4).

Aber genau jene Intensivmedizin würde im Fall des Falles von Corona massiv in Anspruch genommen. Die großen Krankenhauskonzerne machen massiv Druck, Kosten einzusparen. Und wo kann man Kosten einsparen? Beim Personal natürlich! Das hat zur Folge, dass die noch im Gesundheitsdienst verbliebenen Mitarbeiter ausgelaugt werden bis zum vorzeitigen Burnout. Gerade jetzt massieren sich die Proteste der Ärzte und des Pflegepersonals (5). Die Verhältnisse in den privatisierten Krankenhäusern spotten jeder Beschreibung. Wer in der neuen deutschen Zweiklassenmedizin „nur“ Kassenpatient ist, wird womöglich frisch nach der Operation auf dem Flur mit Zugluft zwischengeparkt und stirbt sodann an Lungenentzündung. Oder er wird schon zwei Tage nach einer schweren Operation ins Taxi geschubst und  nachhause gekarrt und verstirbt sodann nach wenigen Tagen. Keine Phantasie. So erging es meinem Bruder, der nur Mitglied in einer gesetzlichen Krankenkasse gewesen ist. Und dann der berühmte Krankenhauskeim. Wenn Sie Ihrem Leben ein rasches Ende bereiten wollen, stürzen Sie sich nicht filmreif vor den nächsten Pendlerzug. Lassen Sie sich ganz einfach im Krankenhaus behandeln. Im Krankenhaus versterben jedes Jahr sage und schreibe 40.000 Menschen an so genannten Krankenhauskeimen (6).

Nach Aussage des führenden deutschen Virologen Dr. Christian Drosten vom virologischen Institut der Berliner Charité werden achtzig Prozent der von Covid-19 Infizierten nur einen etwas stärkeren Schnupfen verspüren. Zwanzig Prozent werden eine schwere Grippe erleiden, und zwei Prozent werden an dieser Corona-Grippe sterben. Um diese zwei Prozent zu retten, sind die umfangreichen Sicherheitsmaßnahmen angedacht worden (7). Unsere Gesellschaft hat den Ehrgeiz, möglichst niemanden durch Seuchen versterben zu lassen. Das ist ehrenwert. Und es folgt auch einer wirtschaftlichen Kalkulation. Denn wenn sich eine Krankheit exponentiell ausbreitet, lähmt das die Wirtschaft. Wenn, wie bei Krebserkrankungen, hohe Mortalitätsraten erreicht werden, diese aber nicht spektakulär zunehmen, wird der Tod von Hunderttausenden von Menschen akzeptiert. Auch der Tod von schätzungsweise 35.000 Toten jedes Jahr durch ganz gewöhnliche Grippe-Pandemien wird achselzuckend in Kauf genommen. Warum wird das bei Covid-19 ganz anders gesehen?

Wieder nimmt der tapfere David gegen den übermächtigen Goliath der Pharmaindustrie, der Virologe und Politiker Wolfgang Wodarg, mit harten Worten Stellung. In einem Statement, das nur eine Tageszeitung mit regionaler Reichweite zu veröffentlichen wagte (8), schreibt Wodarg:

„Dem Corona-Hype liegt keine außergewöhnliche medizinische Gefahr zugrunde. Er verursacht aber eine erhebliche Schädigung unserer Freiheits- und Persönlichkeitsrechte durch leichtfertige und unberechtigte Quarantänemaßnahmen und Verbotsregeln.“

Wodarg legt die Hand genau auf die Wunde unserer Gesellschaft, nämlich auf die Unterwerfung aller Lebensbereiche unter das brutale Regiment der Marktlogik. Denn auch unsere Wissenschaft muss sich als rentabel und als attraktiv für die Einwerbung von Spenden aus der Wirtschaft bewähren. Wissenschaftliche Institute müssen gegeneinander wetteifern. Das macht einen Großteil jener Dynamik aus, die momentan in der Aufplusterung von Corona ihren Ausdruck findet. Wodarg polemisiert in diesem Zusammenhang, die Virologen lägen „auf der Lauer“ nach attraktivem Katastrophengeld:

„Ein Labor an der Charité gewann das Wettrennen der WHO [die UNO-Weltgesundheitsorganisation] und durfte seine Inhouse-Tests weltweit zu einem Mehrfachen des üblichen Preises vermarkten.“

Nämlich 200 Euro pro Test. Wodarg zielt offenbar auf jenen Professor Christian Drosten, der momentan in den Talkshows und Bundespressekonferenzen als Seuchen-Koryphäe herumgereicht wird. Und Wodarg resümiert: „Wissenschaftlich arbeiten heißt eben nicht, der Politik und der Wirtschaft nach dem Munde zu reden. Wissenschaft ist vertrauenswürdig, wenn sie mit transparenten Methoden professionell und konsequent angebliches Wissen immer und jederzeit in Frage stellt. Auch wenn das manchmal aufwendig ist, so kann es uns manchen teuren gesundheitlichen Irrweg ersparen, den uns interessegetriebene Grippewächter weismachen wollen.“

Cui Bono? Wem also nützt Corona? Vielleicht mal uns, dem gemeinen Volk? Sicher nur dann, wenn wir endlich aufwachen und unsere Potentiale realisieren. Corona zeigt uns doch, dass die Globalisierung ein Irrweg ist. Dass wir zurückkehren müssen zu einer Regionalisierung von Produktion und Konsumtion. Wenn wir den öffentlichen Raum wieder zurückerobern und uns bereits privatisierte (9) Einrichtungen wie z.B. Krankenhäuser und Universitäten in die öffentliche Hand zurückholen. Dann werden Virenepidemien auch wieder in verantwortungsvoller Weise gehandhabt.

Nicht als ein Geschäftsmodell, sondern als eine Herausforderung, die von der Gemeinschaft besonnen und sachlich angepackt wird. Holen wir uns zurück, was uns schon lange gehört!

Quellen:

Süddeutsche Zeitung, 17.12.2010, Die Tamiflu-Lüge: https://www.sueddeutsche.de/wissen/kampf-gegen-die-grippe-die-tamiflu-luege-1.1037400
Daily Mail, 18.1.2010, The ‚false‘ pandemic: Drug firms cashed in on scare over swine flu, claims Euro health chief: https://www.dailymail.co.uk/news/article-1242147/The-false-pandemic-Drug-firms-cashed-scare-swine-flu-claims-Euro-health-chief.html

Peter König Ein Akt der Bio-Kriegsführung? 2.3.2020: https://kenfm.de/standpunkte-%e2%80%a2-china-ist-mit-der-covid-19-epidemie-konfrontiert-war-sie-von-menschenhand-gemacht/
Zuerst auf Englisch erschienen auf Global Research am 29.2.20209: https://www.globalresearch.ca/china-is-confronting-the-covid19-epidemic-was-it-man-made-an-act-of-of-bio-warfare/5705067 Coronavirus und das kaputtgesparte Gesundheitssystem. Bessere Zeiten. Wagenknechts Wochenschau #04 https://www.youtube.com/watch?v=dUoskQc0Pto&feature=youtu.be&fbclid=IwAR1PMbhFLxAvvwqp28-mJv94SlN85WMcQU__EHpZcKUB6VGL0E7Rcn9mGlA

NDR, 4.2.2020, Uniklinik-Ärzte fordern bessere Arbeitsbedingungen: https://www.ndr.de/nachrichten/niedersachsen/Uniklinik-Aerzte-fordern-bessere-Arbeitsbedingungen,aerztestreik180.html

t-online 21.11.2014, Bis zu 40.000 Tote durch Krankenhauskeime: https://www.t-online.de/gesundheit/id_71855750/gesundheitsministerium-dementiert-tausende-tote-durch-multiresistente-keime.html

Prof. Dr. Christian Drosten: Coronavirus-Experte erwartet Rückgang der Todesrate | Talk aus Berlin: https://www.youtube.com/results?search_query=christian+drosten+zdf

Aktuelle Erklärung von Wolfgang Wodarg zum „Corona-Hype“: https://www.wodarg.com/vortr%C3%A4ge/

Das Wort „privat“ kommt übrigens vom lateinischen Verb „privare“, was so viel heißt wie „rauben“.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

Grafikquellen      :

Oben    —      

Description
中文(繁體)‎: 立法院院長王金平等接受SARS防護衣捐贈
Date Taken on 
Source http://www.ly.gov.tw/12_gallery/galleryView.action?id=1361
Author 立法院網站資料開放宣告
The copyright holder of this file allows anyone to use it for any purpose, provided that the copyright holder is properly attributed. Redistribution, derivative work, commercial use, and all other use is permitted.

—————————–

Unten      —                Teilnehmer einer Pegida-Demo in Frankfurt

Source https://www.flickr.com/photos/128406688@N07/17227025612
Author Opposition24.de

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Abgelegt unter Bildung, Feuilleton, Gesundheitspolitik, International, Positionen | Keine Kommentare »

Der große Geschichtsbrei

Erstellt von DL-Redaktion am 6. März 2020

Erinnerungspolitik in Europa

Hitler with Psychiatry Symbol.png

Von Stephan Lehnstaedt und Kamil Majchrzak

Der Totalitarismus ist zu einer Ideologie verkommen, die der Verharmlosung rechtsextremer Bewegungen dient. Schluss damit!

Im September 2019 hat das Europäische Parlament eine Resolution verabschiedet. Der Titel: „Die Bedeutung der europäischen Erinnerung für die Zukunft Europas“. Was zunächst harmlos und ehrenwert klingt, ist in Wirklichkeit hochproblematisch: Der Beschluss postuliert eine gemeinsame Leidensgeschichte des Kontinents unter nationalsozialistischer und kommunistischer Herrschaft, die mit dem Begriff des Totalitarismus gleichgesetzt werden. Eine Geschichtsgemeinschaft unter diesem Paradigma verzerrt jedoch die unterschiedlichen Erfahrungen der Verfolgung und Erinnerung an die deutsche Besatzungsherrschaft in Nord-, Ost-, Süd- und Westeuropa. Außerdem banalisiert sie die singulären deutschen Menschheitsverbrechen an den europäischen Juden sowie Sinti und Roma.

Dies gilt insbesondere für Gesellschaften, die den deutschen Antikommunismus teilten und mit dem deutschen Antisemitismus sympathisierten. Gerade das Ausblenden dieser unterschiedlichen Perspektiven zwischen Tätern und Opfern verhindert indes eine Erinnerung, die die historischen Gegebenheiten und deren heutige Relevanz differenziert beurteilt.

Das findet seine Entsprechung in der Gleichsetzung des Extremismus von rechts und von links, welcher die Mitte der Gesellschaft gleichermaßen von ihren Rändern bedrohe und womit zuletzt CDU und FDP in Thüringen ihr Wahlverhalten erklärten. Sie schreiben sich selbst eine erfolgreiche Aufarbeitung der Vergangenheit zu, die sie anderen Akteuren nicht zubilligen: Eine Zusammenarbeit mit der Linkspartei sei wegen der Verbrechen des Kommunismus unmöglich, nicht weil diese Partei aktuell extremistisch wäre. Die Geschichte – in vulgärpopulistischer Sicht – wird damit zum Maßstab heutiger politischer Redlichkeit.

Mit der doppelten Verdammung der Vergangenheit einher geht die Verharmlosung heutiger rechter Bewegungen sowie rassistischer und antisemitischer Straftaten: Die Statistik zählt allein für Deutschland 2018 annähernd 20.000 rechtsextremistisch motivierte Delikte, denen weniger als 5.000 aus dem linken Spektrum gegenüberstehen. Der Mord an Walter Lübcke, das Attentat von Halle, das Massaker von Hanau und die unvollständige Aufklärung des NSU-Komplexes zeigen die Qualität des seit Jahrzehnten verharmlosten rechten Gewaltpotenzials, das in ganz Europa eine Bedrohung für die Demokratie darstellt.

Die aktuelle Initiative für eine europäische Geschichtsgemeinschaft kommt zwar aus Ostmitteleuropa und war ursprünglich nicht vom Gedanken einer Relativierung des Nationalsozialismus getragen. Paradoxerweise knüpft sie jedoch nahtlos an bundesdeutsche Deutungsangebote an, die aus den Leerstellen der lange verweigerten Verantwortung für die deutschen Verbrechen erwachsen sind. Die Wurzeln dieses politischen Vorstoßes liegen in der Dissidentenbewegung des Kalten Kriegs, die mit den kommunistischen Machthabern auch einen Kampf um die Vergangenheit austrug. Indem sie die stalinistischen Verbrechen thematisierte, delegitimierte sie die realsozialistischen Regime des Ostblocks; zugleich wurde die eigene Stellung gestärkt, weil man die „Wahrheit“ aussprach und für sie stand.

Und so wie die osteuropäischen Regierungschefs in eine Linie mit Hitler rückten, erhöhte sich zugleich der eigene Opferstatus, weil er scheinbar in der Kontinuität der Judenverfolgung stand. Außerdem unterblieb eine differenzierte Betrachtung auch des eigenen Handelns unter deutscher Besatzung.

Damals war das auch ein Angebot an den Westen, ein Anknüpfen an den dortigen Holocaust-Diskurs – und wurde in konservativen Kreisen etwa der CDU unter Helmut Kohl bereitwillig als Argument gegen Kommunisten und Linke aufgegriffen. So konnte sich die Bundesrepublik diskursiv zum Meister der Geschichtsaufarbeitung wandeln, trotz einer Jahrzehnte andauernden Verweigerungshaltung gegenüber Entschädigungen, etwa für ZwangsarbeiterInnen, oder auch nur der Anerkenntnis von Unrecht, etwa bei der Verfolgung von Sinti und Roma, von Homosexuellen oder sogenannten Asozialen. Dank dieser brüchigen „Bewältigung“ war zuletzt in Thüringen ganz machtpragmatisch eine Wahl mit Stimmen der AfD möglich – schließlich stünde außer Frage, dass man selbst keinerlei Sympathien für den Nationalsozialismus habe.

Jenseits der aktuellen deutschen Perspektive schienen die großen Deutungsschlachten über die Vergangenheit mit dem Fall des Eisernen Vorhangs geschlagen. Aber im 21. Jahrhundert kommt es zur Rückkehr der Geschichte: Die Regierungen der östlichen EU-Mitgliedsländer legitimieren mit dem Totalitarismus ihre Politik, untermauern Forderungen durch den Hinweis auf die doppelte Opferrolle erst unter dem Na­tio­nal­sozia­lis­mus, dann unter dem Kommunismus.

Auch innenpolitisch funktioniert dieses Narrativ vom Aussprechen einer unbequemen Wahrheit, deren Aufarbeitung die Linken lange vernachlässigt habe, als nationalistische Mobilisierungsstrategie: weil es ein Aufstehen gegen den dominanten Westen und dessen angebliche Fixierung auf den Holocaust impliziert. Es ist eine Diskurstaktik, die auch rechtspopulistische Bewegungen pflegen: Man geriert sich als Kämpfer gegen eine vorgebliche politische Korrektheit und einen linken Mainstream. Und indem der Nationalsozialismus und die Geno­zide an den europäischen Juden und den Sinti und Roma zum Popanz erhoben werden, spricht man ihnen die Bedeutung ab.

Quelle     :            TAZ      >>>>>        weiterlesen 

———————————————————

Grafikquellen         :

Oben         —     Adolf Hitler with psychiatry symbol

Abgelegt unter Bildung, Bücher, International, Kultur | Keine Kommentare »

Gesundheitskarten Krampf

Erstellt von DL-Redaktion am 2. März 2020

Deutschlands Krankenversicherung ist eine Zweiklassenmedizin

Quelle     :    INFOsperber CH.

Von Bernd Hontschik – Chirurg und Publizist.

In Europa kennt allein Deutschland Privatversicherte in Arztpraxen. Die rund zwei Millionen Beamten zahlen praktisch keine Prämien.

Red. Deutschlands Krankenversicherung ist Europas unsozialste. Jeder zehnte Einwohner ist ausschliesslich privat versichert (auch ambulant) und trägt zur sozialen Grundversicherung nichts bei. Die rund zwei Millionen privatversicherten Beamten zahlen fast nichts, sondern lassen ihre Gesundheitsversorgung von den Steuerzahlenden finanzieren. Der deutsche Chirurg und Publizist Bernd Hontschik hat die Grundversicherung in verschiedenen Staaten Europas verglichen.

Allein unter Nachbarn

Laut einer Bertelsmann-Studie könnten die gesetzlichen Krankenkassen neun Milliarden Euro mehr einnehmen und den allgemeinen Beitragssatz um 0,7 Prozent senken, wenn alle Bundesbürgerinnen und Bundesbürger gesetzlich krankenversichert wären. In Deutschland sind aber etwa zehn Prozent ausschliesslich privat versichert. Diese 8,7 Millionen verdienen im Durchschnitt über fünfzig Prozent mehr als die 73 Millionen gesetzlich Versicherten und sind im Vergleich gesünder. Es heisst, sie würden eine privilegierte medizinische Behandlung erhalten, man spricht von einer Zwei-Klassen-Medizin.

Die Besserverdienenden, die ausserdem auch noch die Gesünderen sind, haben sich aus unserem Solidarsystem verabschiedet. Wie ist das eigentlich in unseren Nachbarländern geregelt? Die entscheidenden Fragen sind: Müssen dort alle an einem Solidarsystem teilnehmen? Wie wird es finanziert? Wie sind die Leistungen?

Österreich

In Österreich besteht für ausnahmslos alle Einwohnerinnen und Einwohner eine Krankenversicherungspflicht in regionalen Gebietskrankenkassen. Die Beiträge richten sich nach dem Einkommen und werden zur Hälfte von Arbeitnehmenden und Arbeitgebenden getragen. Familienmitglieder sind überwiegend kostenlos mitversichert. Die Leistungen aller Kassen sind gleich, Konkurrenz zwischen Krankenkassen gibt es nicht. Es existieren vielfältige Möglichkeiten der privaten Zusatzversicherung.

Schweiz

Auch in der Schweiz besteht Krankenversicherungspflicht für alle. Die Beiträge sind unabhängig vom Einkommen pro Kopf gleich hoch, eine kostenlose Mitversicherung von Familienmitgliedern gibt es nicht. [Red. Als Kompensation für die unsozialen Kopfprämien erhält ein gutes Viertel der Bevölkerung eine individuelle Verbilligung der Krankenkassenprämien. Bund und Kantone geben dafür jedes Jahr rund 4,5 Milliarden Franken aus.] Alle etwa fünfzig privaten Krankenkassen des Landes müssen identische Leistungen einer gesetzlich festgelegten Grundsicherung anbieten, konkurrieren aber um Mitglieder durch möglichst niedrige Tarife. Die acht grössten Kassen haben zusammen einen Marktanteil von über 80 Prozent. Alle diese Versicherer bieten Zusatzversicherungen an.

Frankreich

Auch in Frankreich ist die Krankenversicherung Pflicht für alle. Die Krankenkassenbeiträge werden von Arbeitnehmenden und Arbeitgebenden anteilig bezahlt, Defizite werden mit Steuermitteln ausgeglichen. Versicherte zahlen ihre Arztrechnungen zunächst selbst und reichen sie anschliessend bei ihrer Krankenkasse zur Erstattung ein. Dabei bestehen Eigenbeteiligungen bis zu 25 Prozent, weswegen die meisten Franzosen private Zusatzversicherungen abschliessen.

Niederlande

Auch in den Niederlanden besteht Krankenversicherungspflicht. Das System ist rein privatwirtschaftlich, aber die Leistungen der etwa 40 privaten Krankenkassen sind gesetzlich genau festgelegt, sodass darüber keine Konkurrenz aufkommen kann. Kinder sind kostenlos mitversichert, Partnerinnen und Partner hingegen nicht. Alle Versicherten zahlen einen gleich hohen Beitrag, der gesetzlich festgelegt ist. Wegen hoher Selbstbeteiligungen sind private Zusatzversicherungen weit verbreitet.

Universitäts-Klinikum…   Frankfort / Main

Dänemark

Auch in Dänemark ist das Gesundheitssystem für alle Einwohnerinnen und Einwohner verbindlich. Hier ist es rein staatlich, die Finanzierung geschieht aus Steuergeldern. Wer in Dänemark wohnt oder steuerpflichtig ist, ist automatisch krankenversichert. Medizinische Behandlungen und häusliche Pflege sind für alle Versicherten kostenlos. Private Vollversicherungen gibt es nicht, nur Zusatzversicherungen zur Abdeckung der Eigenbeteiligungen.

Italien

Auch in Italien ist das Gesundheitssystem für alle in staatlicher Hand. Es wird aus Steuermitteln und Arbeitgeberbeiträgen finanziert. Die medizinische Grundversorgung ist für alle kostenlos. Private Krankenversicherungen gibt es nicht, nur Zusatzversicherungen.

Deutschland

Deutschland ist also das einzige Land weit und breit, das einem Zehntel seiner Bevölkerung die Möglichkeit einräumt, sich mit der privaten Krankenversicherung aus dem Solidarsystem zu verabschieden. Dafür gibt es keinen vernünftigen Grund. Sämtliche unserer Nachbarländer machen das vor. Eine Überwindung unseres zweigeteilten Systems würde zwar einige Probleme aufwerfen, aber diese sind alle lösbar, dafür braucht es nur etwas Zeit und kluge Übergangslösungen. Ärztekammern, Kassenärztliche Vereinigungen und der Beamtenbund malen das grosse Arztpraxissterben an die Wand, wenn den Ärztinnen und Ärzten die privaten Einnahmen wegbrechen. Aber die ärztlichen Einkommen wären in keinerlei Gefahr, denn bislang Privatversicherte würden stattdessen sogleich entsprechende Zusatzversicherungen abschliessen.

Eine Illusion sollte man aber nicht haben: Mit der Abschaffung der Zwei-Klassen-Krankenversicherung wird man die Abschaffung der Zwei-Klassen-Medizin nicht erreichen. Dazu müsste man zuerst die Klassengesellschaft abschaffen.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Der Chirurg Bernd Hontschik ist u.a. Mitglied bei der Thure von Uexküll-Akademie für Integrierte Medizin AIM, bei MEZIS und bei Ärzte für eine Verhütung eines Atomkriegs IPPNW, ist im Beirat der Akademie Menschenmedizin AMM und im wissenschaftlichen Beirat der Fachzeitschrift «Chirurgische Praxis». Kolumnen von Hontschik erscheinen regelmässig in der Frankfurter Rundschau. Sein neuestes Buch: «Erkranken schadet Ihrer Gesundheit», 2019, Westend Verlag.

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

——————————————————————–

Grafikquellen        :

Oben      —        Bernd Hontschik fotografiert von Barbara Klemm (2009)

Abgelegt unter Bildung, Europa, Gesundheitspolitik, Hessen | Keine Kommentare »

Terror in Hanau

Erstellt von DL-Redaktion am 28. Februar 2020

Für immer in die Seele gebrannt

Stadtschreiberfest-2017-ahmad-mansour-ffm-3132.jpg

Von Ahmad Mansour

Eine Analyse der Täter ist für die Prävention unabdinglich. Damit der Terror nicht gewinnt, müssen wir aber vor allem die Opfer sichtbar machen.

Israel im Jahr 2004 war ein zerrissenes Land. Terror, Hass, Polarisierung bestimmten den Alltag. Es war ein regnerischer kalter Morgen, an dem der Terror in meine unmittelbare Nähe kam. Ich saß im Auto, der Verkehr bewegte sich nur sehr langsam. Ich wartete, dass die Ampel auf Grün schaltete, hörte Musik. Plötzlich kamen mir Menschen entgegengerannt und liefen an mir vorbei. Für ein paar Sekunden verstand ich nicht, was da passierte. Dann sah ich den Terroristen.

Er schoss mit seinem Maschinengewehr auf die umstehenden Wagen. Im nächsten Augenblick traf ihn der tödliche Schuss eines israelischen Soldaten. Es waren die schrecklichsten Minuten meines Lebens. An diesem Tag habe ich mir gesagt: Ich mache das nicht mehr mit. Hier und auf diese Weise will ich nicht leben. Auf der Stelle kündigte ich meine Arbeit und nahm Abschied von den Kollegen. Mit zwei Koffern und viel Hoffnung kam ich wenige Tage darauf in Berlin-Tegel an. Es war ein Neustart in neuer Umgebung.

Doch bis heute denke ich an den schrecklichen Moment der Todesgefahr zurück. Ich wurde nicht körperlich verletzt, aber in meiner Seele hat sich das Erlebnis für immer eingebrannt. In dieser Woche musste ich wieder an meine alte Heimat denken: die Unsicherheit, die Angst und die Zerrissenheit. Jetzt ist aber meine neue Heimat vom Terror betroffen.

Was ich hinter mir lassen wollte, begegnet mir nun hier wieder: in Gestalt dieses hasserfüllten, rechtsextremen und offensichtlich psychopathischen Terroristen Tobias R. aus Hanau. Ich glaube, dass in diesen Tagen viele Menschen ähnlich empfinden wie ich. Sie haben Angst um sich und ihre Familien, fühlen sich unsicher. Damit sind auch sie – in einem weiteren Sinne – zu Opfern des Anschlags von Hanau geworden.

Amri kennt jeder, von den Opfern wissen wir nichts

Ich wünsche mir, dass wir – als Gesellschaft und die Medien gleichermaßen – jetzt nach dem Anschlag in Hanau den Opfern mehr Aufmerksamkeit schenken. Wir dürfen die Fehler nach dem islamistischen Anschlag auf den Weihnachtsmarkt an der Berliner Gedächtniskirche im Dezember 2016 nicht wiederholen. Damals und bis heute werden die Familien der Opfer und die Verletzten stiefmütterlich behandelt.

Sie wurden nicht genug unterstützt und teilweise vom Staat in der Bewältigung der bürokratischen Hürden, beim Suchen und Finden von nötiger Unterstützung im Stich gelassen. Heute weiß jeder, wer der Attentäter Anis Amri war, aber von den Opfern wissen wir kaum etwas. In Neuseeland wurde es nach dem Anschlag in Christchurch genau umgekehrt gehandhabt: Nicht der Name des Attentäters wurde veröffentlicht, sondern ausschließlich die der Todesopfer.

Die Analyse des Täters und seiner Motive ist ohne Zweifel unerlässlich, um zu verstehen, woher die Gefahr droht, welche Ursachen dieser Terror hat und vor allem, um Ansätze zu finden, sich dagegen zu schützen – auf gesellschaftlicher Ebene, aber auch ganz individuell. Erst wenn man weiß, wie die Täter zu Tätern wurden, kann es gute und gezielte Prävention geben. Daher sind Erkenntnisse über Täterprofile und Tätergruppen zentral – sowohl aus psychologischer als auch politischer Perspektive.

Ohne klare Erkenntnisse bleibt uns nur hilflose Empörung und Trauer. Die Täteranalyse hilft auch dabei, Angst und Kontrollverlust zu verringern, rationaler und zielgerichteter zu handeln. Die Tränen der Opfer und Hinterbliebenen allein können keinen erneuten Terror verhindern. Doch die Angehörigen brauchen unsere Solidarität im Alltag. Ihr Leben wurde zerstört, sie werden nie wieder so leben wie vor dem Anschlag.

Ohne Erkenntniss über den Täter bleibt uns nur Hilflosigkeit

Sie verloren Menschen, die ihnen nahestanden, und werden die Trauer und das Trauma bis ans Ende ihres Lebens in sich tragen. Deshalb müssen diese Menschen sehr lang begleitet und unterstützt werden, nicht nur für die nächsten paar Tage, sondern lebenslang. Auch die Opfer sollten wir als solidarische Gesellschaft in unserer Erinnerung verewigen, denn sie dürfen nicht nur eine Zahl bleiben. Hinter jedem dieser Opfer steht ein Leben, eine Familie, ein Gesicht, ein Name.

Damit der Terror nicht gewinnt, müssen wir genau diese Opfer in unserer Gesellschaft sichtbar machen. Die Verletzten haben noch einen sehr langen Weg vor sich, bis sie, wenn überhaupt, wieder gesund werden. Egal wie schwer eine körperliche Verletzung ist, alle Betroffenen werden in den nächsten Wochen und Monaten mit Schmerzen, Operationen, Rehabilitation, Therapien zu tun haben. Noch viel länger bleiben die Verletzungen und Narben auf der Seele, die psychologischen Folgen spürbar.

Quelle       :         TAZ           >>>>>         weiterlesen

——————————————————————-

Grafikquelle         :         Ahmad Mansour, am 1. September 2017, während seiner Festrede zum Stadtschreiberfest in Frankfurt-Bergen-Enkheim.

Abgelegt unter Bildung, Innere Sicherheit, Kultur, Mensch | Keine Kommentare »

EU – Grenzpolizei Frontex

Erstellt von DL-Redaktion am 27. Februar 2020

schickt FragDenStaat Rechnung über 24.000 Euro

DOORSTEP 2016-07-07 Informal Meeting of Interior Ministers (27534762013).jpg

Die Dumme Arroganz öffentlicher Behörden stinkt Meilenweit. Das führt uns dann wieder zu diesem Sprichwort aus Kindertagen: „Aus einen Pisspott kannst du keinen Bräter machen – er stinkt immer“

Quelle     :       Netzpolitik ORG.

Von  

Abschreckung per Gebührenbescheid: Die EU-Grenzpolizei Frontex will sich nach einer Auskunftsklage seine Anwaltskosten durch die Zivilgesellschaft ersetzen lassen. Setzt sich die Behörde damit durch, werden Klagen vor EU-Gerichten praktisch unmöglich.

Eigene Flugzeuge, Schiffe und Autos, dazu Waffeneinsatz an den EU-Außengrenzen: Die europäische Grenzpolizei Frontex kann sich wahrlich nicht über einen Mangel an Ressourcen und Macht beschweren. Seit vergangenem Jahr verfügt die EU-Behörde über ein Milliardenbudget und einen großen Zuwachs an Befugnissen.

Das hält sie allerdings nicht davon ab, die Zivilgesellschaft zu gängeln. Im Gegenteil: Nachdem FragDenStaat im vergangenen Jahr Frontex erfolglos auf Auskunft zu Mittelmeereinsätzen verklagt hatte, schlägt die Behörde jetzt zurück.

23.700 Euro für private Anwälte

In einem Schreiben an die Kläger stellt Frontex seinen eigenen Aufwand im Verfahren in Höhe von 23.700 Euro in Rechnung, zahlbar bis kommenden Freitag. Eine Aufschlüsselung der Kosten gibt Frontex nicht heraus.

Das Vorgehen ist für eine EU-Behörde äußerst ungewöhnlich. In der Regel stellen diese gegenüber der Zivilgesellschaft ihre Kosten nicht in Rechnung. In diesem Fall will Frontex zudem Kosten für externe Privatanwälte in Rechnung stellen, die die Behörde gar nicht hätte engagieren müssen. Denn die eigene Rechtsabteilung von Frontex ist gut ausgestattet.

FragDenStaat befürchtet, dass Frontex mit dieser Taktik erreichen will, dass Akteure aus Zivilgesellschaft und Wissenschaft davon abgeschreckt werden, Auskünfte von der Agentur zu verlangen. Sollte sich Frontex damit durchsetzen, könnten sich künftig voraussichtlich nur noch zahlungskräftige Unternehmen Klagen gegen EU-Behörden leisten.

Kostenrisiko bei Klagen gegen EU-Behörden

Schon jetzt sind Auskunftsklagen gegen die Europäische Union mit einem besonderen Risiko verbunden. Anders als in Deutschland gibt es auf EU-Ebene keine klaren Gebührentabellen, durch die Anwaltskosten begrenzt wären. In einem vergleichbaren Verfahren vor einem deutschen Verwaltungsgericht müssten für Behördenanwälte gerade einmal 925 Euro erstattet werden. Klagen auf Auskunft gegen EU-Behörden sind dementsprechend rar.

Frontex wird schon lange vorgeworfen, besonders intransparent zu agieren. Auch Abgeordnete des Europaparlaments beschweren sich darüber, nur wenig Kontrolle über die EU-Agentur ausüben zu können. Angesichts der schweren Anschuldigungen, Frontex verfolge Menschenrechtsverletzungen an den EU-Außengrenzen wiederholt nur unzureichend, wiegt dies besonders schwer. Aktuell wird Frontex etwa vorgeworfen, mutmaßlich minderjährige Asylbewerber nach ihrer Ankunft in Griechenland willkürlich als Erwachsene registriert zu haben.

FragDenStaat wendet sich mit einer Petition an Frontex, damit die Grenzpolizei seine Rechnung zurückzieht.

Transparenzhinweis: Arne Semsrott betreut für die Open Knowledge Foundation Deutschland das Portal zur Informationsfreiheit FragDenStaat.de.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.

—————————————————————-

Grafikquelle     :         Frontex, Mr. Fabrice Leggeri, Executive Director, ph: halime sarrag

Abgelegt unter Bildung, Europa, Kriegspolitik, Kriminelles | Keine Kommentare »

Mit Corona-Fake rechts – ab

Erstellt von DL-Redaktion am 27. Februar 2020

In den rechtslibertären Sumpf von Scilogs und Eifrei

File:Pegida Banner, Lügenpresse Banner.jpg

Quelle         :       Scharf  —   Links 

Von Hannes Sies

Die Firefox-Presseschau war am frühen 26.2.2020 krurzfristig reingefallen auf rechtslibertäre Trickser, die zu Scilogs und Eifrei („eigentümlich frei“) lockten. Beim Start des Firefox-Browsers präsentiert die Website drei Artikel „empfohlen von pocket“ (Apps bei google play), normalerweise von „Spiegel“, „NZZ“, „Welt“ usw. doch manchmal auch von Wissenschaftsseiten, die mit populären Themen aufmachen. Diesmal war scheinbar Spektrum der Wissenschaft mit einem Corona-Artikel dabei. Aber es war ein anderes „Spektrum“, das von Scilog:

https://scilogs.spektrum.de/fischblog/was-tun-bei-einer-coronavirus-pandemie/

Täuschend echt der Website https://www.spektrum.de/ nachgemacht werden hier bei scilogs echte Wissenschaftsmeldungen mit rechtslibertärer Propaganda gemischt, etwa knapp unter dem (läppischen) Corona-Text etwas zum Reißer-Thema „Glück“ und seinem angeblichen Zusammenhang mit Parteienpräferenz.

https://scilogs.spektrum.de/natur-des-glaubens/weltanschauung-glueck-und-parteipraeferenz/

Vom harmlos scheinenden Locktext wird man nach drei Sätzen weitergeleitet zum rechtslibertären Magazin „Eigentümlich frei“ (Eigenbezeichnung: „Eifrei“), wo der läppische Artikel behauptet, am Glücklichsten seien Unionswähler, gefolgt von FDP, Grünen und FDP -abgeschlagen: Linke und AfD-Wähler.

https://ef-magazin.de/2015/06/12/7004-eigenverantwortung-schwierig-aber-notwendig

Überhaupt strengt sich „Eifrei“ mächtig an, Rechts- und Links-Extremisten in einen Topf zu werfen, ganz nach der alten reaktionären Theorie vom „politischen Kreis“. Dabei drehen sie sich in einem Kreis mit den Neorassisten, Neuen Rechten und „hippen Reaktionäre“ der „Alt Light“, die wir als Trump-Internet-Sumpf der USA kennenlernen mussten: Es geht um die Online-Kulturkämpfe der Neoreaktionären und Think-tank-Mandarine des Neoliberalismus.

https://www.rubikon.news/artikel/die-digitale-gegenrevolution

Rechtslibertäre bewegen sich in einem politischen Raum zwischen schwarz, gelb und braun, wobei sie sich vom Braunton der Rechtsextremen (meist vergeblich) abzugrenzen suchen. Abgeleugnet wird daher die Schnittmenge von Liberalismus und Faschismus: Gut, die einen sind für, die anderen gegen den starken Staat, aber beide treiben einen Kult um den „Sieger im Wettbewerb“, um Hierarchien, die angeblich auf Leistung beruhen, um Sozialdarwinismus, der die „Verlierer“ missachtet, weil sie angeblich zu schwach war, sich durchzusetzen. Natürlich nicht, weil die Sieger unfair spielten, gelogen, betrogen, gestohlen haben -oder schlicht geerbt, etwa das Eigentum, das ihre Vorfahren ergaunerten. Das rechtslibertäre Credo von Eifrei lautet:

Eigentum – das ist der Schlüssel zur Freiheit. Um Eigentum und Freiheit dreht sich in eigentümlich frei vieles… Erst mit seinem Eigentum kann jeder tun und lassen, was er für richtig hält, ganz eigentümlich und freisinnig… Der Massenmensch dagegen ist eine Nummer, austauschbar und gewöhnlich. Er muss andere um Erlaubnis bitten. Und er wird dabei zwangsläufig feige und verlogen. Es gibt immer zwei Wege: Sozialismus oder Eigentum, Politik oder Freiheit.“ https://ef-magazin.de/webwarum-ef/

Wer Eigentum besitzt, darf sich also für ganz was besonderes halten, je reicher umso besser. Alle anderen sind Massenmenschen, austauschbar, gewöhnlich und „zwangsläufig feige und verlogen“. Das ist das Motto psychopathischer Herrenmenschen, reicher Egomanen, die ihre Untergebenen zu devotem Anbiedern zwingen, sie zum Dank dafür als feige und verlogen betrachten, andernfalls feuern -ganz in feudalistischer Tradition. Aus dem Knechten der anderen beziehen sie ihr aufgeblasenes Ego, das Leid der anderen ist ihre Freud. Die Menschenwürde auch Besitzlosen zuzugestehen liegt diesen Egomanen ebenso fern, wie ihnen der Neid auf Solidarität und Lebensfreude der Sozialisten nahe liegt -und sich in antikommunistischem Hass manifestiert. Steuern zahlen und der Sozialstaat sind ihnen folglich ein Gräuel, Familie und Tradition finden die reichen Erben gut. Die weit überwiegend männlichen Eifrei-Autoren schwenken ihr publizistisches Gemächte denn auch ungeniert gegen Frauenemanzipation in Genderdiskursen, soziale Menschenrechte, Sozialisten, Sozialdemokraten, Gewerkschaften usw…

eigentümlich frei“ ist ein seltsames Pressemedium. Der saloppe Reaktionär mit flotten Sprüchen aus der zynischen Mottenkiste. Die Macher dieses Mediums leben in einer Welt, die kein Hartz-IV-Elend kennt. Der Sozialstaat ist für sie immer noch zu ausgebaut, sie wollen ihn reduzieren. Die Freiheit, die sie meinen, ist die Freiheit zur steuerfreien Ausbeutung, ihre Freiheit ist die eigentümliche Freiheit nur des Eigentümers…

Besonderen Hass hegen die vermutlich von Multimillionären alimentierten Schreiberlinge der rechtspopulistischen Agitprop-Front gegen den Sozialstaat. Er sei die Wurzel allen Übels, er wuchert und tötet die Freiheit (die eigentümliche des Eigentümers versteht sich). Wer nix hat, soll sich nicht so haben und den Gürtel enger schnallen. Dann können die Steuern sinken und die Reichen jubeln -hurra! Aber leider neidet der Ausgeraubte dem Räuber dessen Beute, will gar etwas zurück.“ Theodor Marloth JasminRevolution 18.1.2013

https://jasminrevolution.wordpress.com/2013/02/18/agitprop-neoliberal-wer-ist-eigentumlich-frei/

Eifrei: Zwischen Libertären, Neoliberalen und Reaktionären der AfD

Herausgeber und Chefredakteur von Eifrei ist André F. Lichtschlag, ein umtriebiger Publizist im Bereich der Konservativen, Neuen Rechten, Rechtslibertären bis hin zu Rechtsextremen (Junge Freiheit):

Lichtschlag publizierte zahlreiche Gastbeiträge in folgenden überregionalen Zeitungen und Zeitschriften: Börse am Sonntag, Criticón, Die Welt, Die Weltwoche, Direkte Aktion, Der Einzige, Espero, Focus, Junge Freiheit…“ https://eifrei.de/andre-lichtschlag/

Unter den Autoren finden sich berühmte Publikations-Patriarchen wie Thilo Sarrazin, den Nestor des „Kopftuchmädchen“-Rassismus

https://ef-magazin.de/2016/02/27/8481-fakt-ist-gute-und-schlechte-zuwanderung

und schillernde Querfront-Figuren (hier ist dieser antideutsche Kampfbegriff mal nicht diffamierend eingesetzt, sondern treffend) Jürgen Elsässer, der sich für Eifrei als „Linker“ beschreibt (was relativ zu deren anderen Gestalten auch stimmen könnte).

https://ef-magazin.de/2009/09/25/1505-piraten–bereit-zum-entern-stimmt-fuer-die-piratenpartei-solange-es-sie-noch-gibt

Verlinkt wird von Eifrei sogleich auf Elsässers Homepage woher sein Text stammen soll

https://juergenelsaesser.wordpress.com/

und wo Elsässer für seinen AfD-Kumpel Björn Höcke kämpft. Besser kann man die braun-gelb-schwarze Soße der rechtslibertären Debatten kaum repräsentieren. Scilogs versucht scheinbar mit Wissenschafts-Mimikry, gutgläubige Internet-Surfer in diesen Sumpf zu locken und war mit dem Corona-Artikel dabei erfolgreich. Der Pocket-Google-Artikeldienst korrigierte schnell seinen Irrtum und verlinkte auf einen echten Spektrum-Artikel zu Corona. Vermutlich war man dem Google-Lemminge-Prinzip eigener Webstatistiken aufgesessen.

Liberalismus ist, wenn der Arme wie der Reiche die Freiheit haben, unter einer Brücke zu schlafen. Neoliberalismus ist, wenn die Brücke privatisiert wird und der Arme selbst dafür noch an den Reichen zahlen soll. (Theodor Marloth)

https://jasminrevolution.wordpress.com/2013/02/18/agitprop-neoliberal-wer-ist-eigentumlich-frei/

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen       :

Oben          —     Teilnehmer einer Pegida-Demo in Frankfurt

Source https://www.flickr.com/photos/128406688@N07/17227025612
Author Opposition24.de

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

———————————-

Unten          —    Bildmontage Scharf – Links          / HF

Abgelegt unter Bildung, International, Kultur, Medien | Keine Kommentare »

Wer hat es verraten

Erstellt von DL-Redaktion am 24. Februar 2020

Ein Volk von Demokraten ?

Von Hauke Heidenreich

Thüringen zeigt, dass die Idee der Mitte auf der Romantisierung des NS-Regimes beruht. Dessen Unterstützung durch die Bevölkerung wird geleugnet.

Nach der vergangenen Landtagswahl in Thüringen war schnell die Rede davon, dass jetzt „Weimarer Verhältnisse“ herrschen. In den Badischen Neuesten Nachrichten beschwor Martin Ferber, unter Bezug auf die Weimarer Republik, das Bild einer sich zwischen den Extrempositionen zerreibenden Mitte herauf, während die „beiden Parteien am jeweils äußersten Rand des politischen Spektrums, AfD und Linke, zusammen eine Mehrheit der Stimmen“ erreicht hätten. Doch es bleibt die Frage, warum 23 Prozent der Wähler:innen der faschistischen AfD ihre Stimme gaben. Etwa weil sie Weimarer Verhältnisse heraufbeschwören wollten?

Dass ein Kandidat der FDP, die sich selbst als Partei der „Mitte“ bezeichnet, sich von Rechten wählen lässt, ist dabei vielleicht nicht einmal zentral. Eher ist die Frage zu stellen, wie ein offensichtlich rechtsextremes Wahlprogramm in weiten Teilen der Bevölkerung anscheinend auf Resonanz stößt. Wer dies untersuchen will, kommt an der Frage nach der Anschlussfähigkeit rechter Positionen in der politischen Mitte nicht vorbei.

Diese Anschlussfähigkeit ist weniger in der Auferstehung Weimarer Verhältnisse zu suchen, sondern im Umgang mit der NS-Vergangenheit nach dem Krieg. Wie in den Forschungen des Historikers Götz Aly zutage trat, waren hunderttausende Deutsche direkt am Mord an den europäischen Juden beteiligt, während Millionen, ruhig gehalten durch Umverteilung geraubten jüdischen Eigentums auf Deutsche, aktiv wegschauten. Diese Nutznießerschaft großer Bevölkerungsteile an den antisemitischen Verbrechen wurde nach dem Krieg systematisch totgeschwiegen. Eines der ersten Gesetze, das den neu etablierten Bundestag passierte, war ein Amnestiegesetz für Minderbelastete. Nach den Forschungen des Historikers Norbert Frei wurden auf Grundlage dieses Gesetzes bis 31. Januar 1951 fast 800.000 Personen rehabilitiert.

Liest man zudem Reden oder Texte vieler Politiker, Philosophen, Theologen oder Historiker der Nachkriegszeit, würde man nicht auf den Gedanken kommen, dass die Deutschen gerade 6 Millionen Juden umgebracht haben. Von einer „Tragödie des deutschen Volkes“ ist die Rede. Und wenn der Historiker Friedrich Meinecke bereits Ende 1945 wieder die Stärkung des deutschen „Wehrgeistes“ forderte, so war er damit ganz auf der Linie Thomas Manns, der in seinen Radioansprachen während des Krieges darauf beharrte, dass der NS niemals mit der „Geschichte des deutschen Geistes“ verwechselt werden dürfe. Dass Meinecke zur sittlichen Erziehung der Deutschen die Entnazifizierung ablehnte und stattdessen die Gründung von „Goethegemeinden“ vorschlug, spielt in diesem vergangenheitspolitischen Schauspiel eine zentrale Rolle. Wie Max Czollek auf den Punkt bringt: Die Deutschen empfanden den Sieg der Alliierten nicht als Befreiung vom NS, sondern als Niederlage. Meinecke sprach noch Ende 1945 fast andächtig von „unserem ungeahnt großen Siege über Frankreich“ oder „unser[em] Abwehrkampf gegen Westen und Osten“.

File:Konrad Adenauer - Im Gespräch mit Ludwig Erhard-kasf0104.JPG

Statt einer Aufarbeitung der Verwicklung großer Teile der Bevölkerung in den NS, wurde die deutsche Vergangenheit romantisiert. In dieser „allgemeinen Tragödie des deutschen Volkes“ – die Juden kamen da übrigens, wenn überhaupt, nur äußerst marginal vor – wurde das „satanische“ Wirken Hitlers (Meinecke) in eine Geschichte eingesetzt, die mit der mythischen „Goethezeit“ anfing und, abgesehen von kleineren oder größeren antisemitischen und nationalistischen Fehltritten, liberal und geordnet verlief.

Quelle      :         TAZ       >>>>>        weiterlesen

——————————————————————————

Grafikquellen      :

Oben      —         NS-Marschkolonne mit Hakenkreuzfahnen auf dem Rückweg vom Reichsparteitag (vermutlich 1938) an der Stadtgrenze Fürth/Nürnberg, antijüdische Propaganda am Ortsschild und Kinder mit dem (zu jener Zeit vor NS-Fahnen vorgeschriebenen) Hitlergruß.[1] Im Hintergrund ein Fabrikgebäude der „arisierten“, zuvor jüdischen Firma J.W. Spear.

Ich, Superikonoskop, bin im Besitz eines Orginalabzuges vom Glasnegativ. Der Urheber Ferdinand Vitzethum starb 1968 ohne direkte Erben. Vom Gericht wurde die einzige bekannte, weitläufige Verwandte Marie Weisel, Fürth, zum Alleinerben bestimmt. Marie Weisel übergab die Fotosammlung verschiedenen Interessenten mit der ausdrücklichen Freigabe für Nutzungen in Veröffentlichungen. Das Foto wurde seitdem von Superikonoskop und anderen mehrfach in Druckerzeugnissen und im Internet veröffentlicht.
© The copyright holder of this file allows anyone to use it for any purpose, provided that the copyright holder is properly attributed. Redistribution, derivative work, commercial use, and all other use is permitted.

—————————————–

Unten     —        Adenauer, Konrad Im Gespräch mit Ludwig Erhard,

Author CDU, Fotograf: Peter Bouserath

Archiv für Christlich-Demokratische Politik (ACDP)
Credit line: KAS-ACDP/Peter Bouserath, CC-BY-SA 3.0 DE

Abgelegt unter Bildung, Deutschland, Kultur, Regierung | Keine Kommentare »

Von Palme-Barschel zu Colby

Erstellt von DL-Redaktion am 21. Februar 2020

Politische Morde in der alten und neuen Bundesrepublik Deutschland

File:Kieler Woche 1984 (Kiel 39.681).jpg

Quelle      :        untergrund-blättle   CH. 

Wilma Ruth Albrecht

Politische Morde erklären sich nicht einfach aus Motiven von Tätern. Sondern aus deren unbewusstem und bewusstem Wirken innerhalb von politischen und kriminellen Strukturen, die sowohl Öffentlich wie auch verborgen wirkten und nachwirken.

„Ein politischer Mord ist die vorsätzliche, ungesetzliche oder illegale Tötung einer Person aus politischen Motiven. Das Opfer hat in der Regel einen aus Sicht des Urhebers der Tat unerwünschten politischen Einfluss, oder der Urheber erwartet sich von der Ermordung eine für ihn vorteilhafte politische Entwicklung“. Soweit und personalistisch arg verengt das deutschsprachige Netzlexikon Wikipedia.

Täter und Nutzniesser eines politischen Mordes müssen nicht identische Ziele verfolgen und auch nicht einzelne Individuen sein. Vielmehr ist es gerade ein Kennzeichen des politischen Mordes der Neuzeit, dass Täter (als Auftragsmörder) sich nicht aus sozialen und/oder ökonomischen Interessengruppen, die Profiteure der Tat sind, rekrutieren. Auch sind politische Morde nicht an ein bestimmtes formales Herrschaftssystem gebunden. Sie ziehen sich vom Alterum bis zur Gegenwart, so der Untertitel des 2005 vom Althistoriker Michael Sommer herausgegebenen Sammelbands Politische Morde, in dem an Klassiker wie den Mord an Julius Caesar 44 vor Christus, Thomas Becket 1170 nach Christus oder Wallenstein 1634 nach Christus erinnert werden. Auch können politische Morde als Anzeichen für bevorstehende oder unterdrückte Bürgerkriege gedeutet werden – weshalb sie zu Beginn der Weimarer Republik so einseitig juristisch geahndet wurden, wie von Emil Julius Gumbel: Vier Jahre politischer Mord (1922) eindrucksvoll nachgewisen.

Im bürgerlichen Deutschland der neusten Zeit blieben politische Morde nicht auf die Weimarer Republik (mit den an Morden Kurt Eisner [1867-1919], Matthias Erzberger [1875-1921] und Walter Rathenau [1867-1922]) oder den Nationalsozialismus beschränkt. Auch in der alten und neuen Bundesrepublik Deutchland (BRD) gab und gibt es politische Morde – wenn auch offiziell nicht als solche öffentlich zugegeben oder/und als Selbstmorde oder Suizide bezeichnet (wie etwa in den Fällen Barschel 1987, Kelly/Bastian 1992, Möllemann 2003). Seit einigen Jahren freilich wird die Selbstmordthese immer stärker in Zweifel gezogen, besonders die des Uwe Barschel.

Barschel

Dass der Tod des am 11. 10. 1987 im Genfer Hotel „Beau Rivage“ aufgefundenen ehemaligen Ministerpräsidenten von Schleswig-Holstein, des CDU-Spitzenpolitikers Dr. Uwe Barschel, ein Selbstmord gewesen sein sollte, hatte schon zu dieser Zeit kaum ein politisch interessierter Bundesbürger geglaubt. Die obzöne Präsentation eines völlig bekleideten, sogar noch Kravatte tragenden Leichnams, in der Hotelbadewanne erhöhte auch nicht die Glaubewürdigkeit der Selbstmordthese. Sie wirkte wie die damit zusammenhängende „Barschel-Pfeiffer-Engholm-Schmierenkomödie“ politiköffentlich und politikmoralisch so abstossend wie ekelig und beschädigte nicht nur das Ansehen der Herrschaftsform Demokratie sondern auch das der Justiz. Und nicht nur der schweizerischen.

Vielleicht könnte darin der Grund gelegen haben, dass und warum sich Heinrich Wille ab 1992 als Leiter der Lübecker Staatsanwaltschaft mehrere Jahre bis 1998 trotzig engagiert der Aufklärung des Barschel-Todes widmete, die Ergebnisse seiner Tätigkeit publizistisch aufarbeitete und 2011 nach seiner Pensionierung als subjektiven Kommentar auf Dokumentenbasis 2011 vorlegte:

Heinrich Wille

Ein Mord, der keiner sein durfte. Der Fall Barschel und die Grenzen des Rechtsstaates. Vorwort Stefan Aust. Zürich (Rotepunktverlag) 2011 (3. Auflage), 382 Seiten, 18 €

Bevor Wille über eigene Ermittlungstätigkeit im Fall Barschel und die damit einhergehenden Unstimmigkeiten mit Vorgesetzten berichtet, stellt er erstmals die Ausgangslage am Fundort der Leiche Barschels am 10./11. 10. 1987, die Ergebnisse der vorgenommenen Befragungen und Bewertungen durch die Genfer Behörden vor (17-58). Danach erinnert er seine und Barschels politische Sozialisation im Nachkriegsdeutschland der BRD (59-80). Beide, Barschel, Jahrgang 1944, und Wille, Jahrgang 1945, sind in bescheidenen Verhältnissen aufgewachsen, waren aber strebsam und ehrgeizig, weshalb sie auch das Gymnasium besuchen durften, Abitur ablegen und das Jurastudium in Kiel beginnen konnten. Politisch engagierten sie sich jedoch in gegensätzlichen Lagern: Barschel seit 1960 in der Jungen Union (JU), dann 1962 in RCDS (Ring christlich-demokratischer Studenten) und CDU. Dort macht er bald Karrriere. Und wird 1967-1971 Landesvorsitzender der JU Schleswig-Holstein, 1971 Landtagsabgeordneter, 1973 Fraktionsvoritzender der CDU im Landtag, 1979 Finanzminister und 1982 Ministerpräsident.

Wille erwähnt, dass er selbst 1971 in die SPD eingetreten sei, sich im Ortsverein in Luik engagierte habe und 1977 als Landesvorsitzender des Arbeitskreises sozialdemokratischer Juristen gewählt wurde. Seit 1975 arbeitete er als Staatsanwalt zuerst in Itzehoe, dann in Kiel. Nach einer Episode als Referent in der Rechtsabteilung im Justizministerium unter der Regierung Engholm (ab 1988) wechselte er im Mai 1992 als Oberstaatsanwalt zur Staatsanwaltschaft in Kiel, wo er sich seitdem auch und vor allem um den „Barschelfall“ kümmerte. Dabei verfolgte er hinsichtlich des Ermittlungsverdachtes Mord an Barschel verschiedene Spuren, die vor allem ins Geheimdienstmilieu von BND, Bundesamt für Verfassungsschutz, Bundeskriminalamt, DDR-Staatssicherheit, US-Central Intelligence Agency CIA sowie zu ihren tatsächlichen oder vermeintlichen Informanten und Geheimnisträgern und auch in die spätere sogenannte Gauck-Behörde für die Unterlagen des Staatssicherheitsdienstes der ehemaligen Deutschen Demokratichen Republik führten.

Es ergibt sich: Barschel sei jahrelang direkt und indirekt in sogenannte „Embargo-Geschäfte“ der BRD mit der DDR, Südafrika und dem Iran verwickelt und dafür tätig gewesen.

Oft werden dubiose Zeugnisse angeführt, etwa von der Agentin und Journalistin Frau Wilkening. So hätten „die Firma Wild-Leitz Vertrieb Deutschland GmbH in Frankfurt/Main (ehemaliges Vorstandsmitglied unter anderem Dr. Eike Barschel) und die Firma Telemit Elektronik GmbH in München geschäftliche Kontakte zu der AHS IMES Import/Export GmbH“ (97) der DDR unterhalten. Beide Firmen hätten im Zusammenhang mit optischer Elektronik für militärische Zwecke eng zusammen gearbeitet und Verbindungen mit dem VEB Carl Zeiss Jena gehabt. Auch US-Firmen seien in Dreiecks-Geschäfte involviert gewesen wie die US-Firma DEC [Digital Equiment Company], die zusammen mit TELEMIT „Hochleistungsrechner Typ VAX 8600 für den Militäreinsatz an die NVA nach Ludwigsfelde geliefert haben“ (97). Diese und ähnliche Geschäfte seien im „Warnemünder Kreis“ abgewickelt worden, an denen auch Uwe Barschel mitwirkte und dafür seinen in Jena wohnenden Cousin Bernd Barschel ge- oder benutzte (98).

Deshalb sei Uwe Barschel auch mehrmals nach Warnemünde ins Hotel Neptun gefahren und habe Kontakte eines Kuraufenthaltes in der CSSR für Geheimdienst- und Geschäftsverbindungen genutzt. Bei Willes Versuch, diese Angaben anhand von Archivmaterial der Gauck-Behörde zu verifizieren, zeigte sich diese Behörde wie auch der BND wenig kooperativ: mögliche Unterlagen konnten nicht eigenständig ausgewertet werden. Und auch die Jornalistin Wilkering soll eine Spur Barschel zum UdSSR-Verteidigungsministerium und damit zusammenhängende Rüstungsgeschäfte über die DDR aufgefunden haben (wie die ARD-Sendung „Monitor“ berichtete: 137f.).

Ferner habe – nach Angaben des Waffenhändlers Josef Messerer – am 10./11. Oktober 1987 in Genf ein Treffen von Waffenhändlern stattgefunden. (Am Tag zuvor, den 9.10.1987 habe sich auch der Waffenhändler Werner Mauss in Genf aufgehalten.) Nach Vermerken in Messerers Terminkalender habe sich dort auch der Name Barschel gefunden. Im „Schubladenuntersuchungsbericht“ vom 25. 9. 1995 wird daraus gefolgert: „Es gibt Erkenntnisse, dass am 9.10.1987 in Genf eine Gesprächsrunde zusammengetreten sei, bei der es um Waffenhandel gegangen sei; es hätten fünf oder sechs Personen teilgenommen, darunter der Sohn Khomeini und Dr. Barschel. Barschel habe sich mit irgendeiner Sache nicht einverstanden erklärt. Daraufhin sei erklärt worden, er müsse ausgeschaltet werden.“ (170) Der BND freilich demientierte solche Erkenntnisse.

Zum guten Schluss geht Wille auch noch einer Spur im Falle Barschel nach, die zum US-amerikanischen Geheimdienst Central Intelligence Agency (CIA) führt, nämlich zum und über den südafrikanischen Waffenhändler Dirk Stoffberg. Im Gesamtbericht der Lübecker Staatsanwaltschaft, also von Wille, wird 1998 ausgeführt, dass Stoffberg erklärt habe, „dass Barschel von Robert Gates, dem späteren CIA-Direktor, nach Genf bestellt worden sei. Barschel hätte mit Enthüllungen gedroht, durch die Regierungen und an Waffengeschäften beteiligte Geschäftsleute in grosse Verlegenheit gebracht worden wären. Von J. sei auch die Person genannt worden, die mit der Ermordung von Dr. Uwe Barschel beauftragt worden sei.“ (188)

Weiter habe der öffentlich nur als Informant J. Genannte mitgeteilt, dass Barschel „als Vermittler von Nukleartechnologien für den Iran und den Irak tätig war“ (188f.) und gedroht habe, die Verwicklungen von Regierungen offen zu legen. Diese Informationen habe Stoffberg 1992 auch dem Journalisten Peter F. Müller gegeben (189f.). Weiterhin habe er ausgeführt, dass es Robert Gates gewesen sei, der Barschel nach Genf beordert habe, denn Barschel „wollte umfangreiche Fälle von Korrumption in der deutschen Regierung aufdecken, die von den Amerikanern kontrolliert wurden … Barschel war in verschiedene Waffengeschäfte verwickelt, sogar in unserem Land [gemeint: Südafrika, WRA] hier.“ (190)

Wille resumiert, dass „das Motiv für einen Mord an Uwe Barschel im Bereich des internationalen Waffenhandels, konkret im „Handel mit Embargogütern“ (199) lag.

Diese These oder Feststellung wird in den nachfolgenden Kapiteln „Barschels Reisen in die DDR“ (201-224) und zur „Iran-Contra-Affaire“ (225-238) weiter begründet. Hinsichtlich der Barschel-Reisen in die DDR gelten die Zeugnisse der Fahrer Barschels – Rissmann und Posch – sowie Aufzeichnungen der DDR-Staatssicherheit in der Gauck-Behörde. Demnach habe Barschel nachweislich zwischen 18.10.-1.12.1982 eine Reise nach Rostock und von 8.9.-9.9.1983 nach Rostock, Schwerin, Potsdam und (Ost-) Berlin unternommen. Diese Fahrten gingen über die Grenze Schlutup, die vormals auch der damalige Ministerpräsident Schlesdwig-Holteins, Gerhard Stoltenberg, benutzt habe. Auf einer dieser Reisen seien auch militärische Einrichtungen der damaligen DDR in der Nähe von Bad Doberan besucht worden. Ausser Zeugenaussagen und Unterlagen der Gauck-Behörde gebe es keine weiteren Dokumente darüber.

Auch in die „Iran-Contra-Affaire“, einem Dreiecksgeschäft mit israelischen Lieferungen von Waffen (über verschiedene europäische Länder) an den Iran, der Geld an die USA zahlte, die dieses an die Gegner der Revolutionsregierung in Nicaragua zu deren Sturz übergaben, sei Barschel verwickelt gewesen, zumal er schon 1976 als Notar gute Kontakte in den Nahen Osten gehabt hätte. Zeugen wollen Barschel mit Oliver North, US-Marineoffizier, CIA-Agent und militärischer Berater der US-Sicherheitsbehörde National Security Agency (NSA) im September 1987 in Hamburg im Hotel Atlantik gesehen haben; auch hätten sich beide gleichzeitig in Frankfurt/Main aufgehalten.

Dass diese Spuren nicht weiter verfolgt wurden, lag daran, dass Wille erheblichen Repressionen von Seiten seiner Vorgesetzen ausgesetzt war und der Weisung, dass das gesamte Ermittlungsverfahren 1977 einzustellen sei, was wiederum angefochten und zurück genommen wurde.

Erfolgreicher war die Wiederaufnahme toxikologischer Spuren, die zu Barschels Tod führen sollten. Durch eine erneute Untersuchung konnten Spuren von Diphenhydramin sowie auf der Badematte das chemische Lösungsmittel, das hochflüchtige Dimethylsulfoxid und das letztlich tödlich wirkende Cyclobarbital, nachgewiesen werden.

Zuletzt verfolgte Wille noch Spuren im Zusammenhang mit Barschels Tod, die zur Mafia, ja selbst noch zum Kanzler Kohl führten (269-272). Auch Dokumente des Blaupausen-Skandal um technische Zeichnungen für den U-Bootbau durch die HDW-Werft für Südafrika wollte die Lübecker Staatsanwaltschaft einsehen. Doch Gerhard Stoltenberg (Bundesfinanzminister von 1982-1989) lehnte das Ansinnen ab. Und die Landesregierung von Schleswig-Holstein drängte auf eine Einstellung des Verfahrens.

Schlussendlich wurden am 13. Oktober 1997 das Ermittlungsverfahren zum Tode Barschels eingestellt und am 15. Juni 1998 die Akten geschlossen. Die Staatsanwaltschaft Lübeck mit Oberstaatsanwalt Wille jedoch blieb der Überzeugung, „dass Uwe Barschel durch einen professionellen Mörder zu Tode gekommen sein musste“ (341).

Kritisch zu Willes Ausführungen: Mit den individualisierenden Methoden einer Strafjustiz lässt sich der Fall Barschel nicht klären. Hinzu kommt, dass zu viele dubiose Zeugen aus den Geheimdiensten BND, STASI, Verfassungsschutz, CIA, dem israelischen Mossad und aus Waffenhändlermilieus mit geringen Glaubhaftig- und Glaubwürdigkeiten auftreten. Und dünn ist auch die Indizienkette mit vielen Schwachstellen, vor allem verursacht durch gravierende Mängel bei der zeitnahen Spurensicherung des tatsächlichen oder angeblichen Tatortes in der Schweiz. Hinzu kommen willkürliche Interpretationen von Spuren, besonders von schriftlichen Aufzeichnungen, nebst Rivalitäten und Eifersüchteleien unter Sachverständigen wie Platzhirschgebaren beteiligter Juristen und Behördenleiter.

Alle bekanntgewordenen wirtschaftlichen und politischen Erkenntnisse verweisen darauf: Uwe Barschels Tod war ein politischer Mord mit politischen Hintergründen. Es ging um durch internationales Recht verbotene oder politisch nicht zu rechtfertigende Waffengeschäfte mit Südafrika (U-Boote), der Islamischen Republik Iran und Nicaragua unter Beteiligung der USA, Israel, der BRD und der DDR (darüber auch vermittelt mit der UdSSR). An diesen Geschäften beteiligt waren Firmen für das U-Boot-Geschäft, vor allem die HDW (Howaltswerke-Deutsche Werft AG), die zur Salzgitter AG gehörte, und das IKL (Ingenieurkonto Lübeck) sowie die Bundesregierung und Landesregierung Schleswig-Holsteins als Miteigentümer dieser schwerindustriellen Unternehmen.

Über das U-Boot-Geschäft unterrichtet waren nachweislich auch die damaligen Spitzenpolitiker Bundeskanzler Kohl, Bundesaussenminister Genscher, der bayerische Ministerpräident Strauss, Bundeswirtschaftsminister Bangemann, Bundesfinanzminister Stoltenberg (bis 1982 Ministerpräsident von Schleswig-Holstein), Finanzstaatssekretär von Schleswig-Holstein Carl-Hermann Schleifer (später in der Versicherungswirtschaft tätig) (66-69). Auch die DDR-Industrie war in Embargo-Geschäft, speziell mit dem Iran, vor allem über das DDR-Unternehmen Motoren- und Turbinenunion (MTU) einbezogen: der Staat benötigte westliche Devisen. Ferner mischten im Embargo-Handel unter anderem auch Schweden, Dänemark, Israel und die USA mit. Inwieweit Uwe Barschel als Ministerpräsident in Kiel in diese Geschäfte direkt einbezogen war, ob er sie förderte oder ablehnte (und möglicherweise, wie von Wolfram Baentsch in seinem Buch: Der Doppelmord an Uwe Barschel. Die Fakten und Hintergründe. München 2006, argumentiert) Opfer von Intrigen des internationalen Waffenhandels um BND und Verfassungsschutz wurde, lässt sich mit vorwiegend dubiosen Zeugen und den benutzten Quellen und Methoden nicht aufklären.

Von Palme über Barschel zu Colby

Damit stellt sich erneut die nun erweiterte Frage: Warum und vom wem wurden Olof Palme, Uwe Barschel und William Colby ermordet? Gibt es einen Zusammenhang zwischen diesen politischen Morden?

Dies untersuchen im 2017 in erster Auflage erschienen Buch:

Parik Baab, Robert E. Harkavy Im Spinnennetz der Geheimdienste. Warum wurden Olof Palme, Uwe Barschel und William Colby ermordet? Frankfurt/Main (Westend-Verlag) 2019, 413 Seiten, 20.00 €

Im Vorwort findet sich als klare Antwort: „Nicht nur im Fall Palme, sondern auch beim Tod von Uwe Barschel und William Colby handelt es sich um Mord. In allen drei Fällen waren keine Einzeltäter unterwegs, sondern Killerteams. Es handelt sich also um organisierte Kriminalität. In alle drei Fällen sind Geheimdienste verwickelt. Die Befehlsketten enden jeweils in der Politik. Es handelt sich also nicht nur um organisierte Kriminalität, sondern um politische Verbrechen – um Staatskriminalität. Alle drei Fälle hängen miteinander zusammen, sind eingebettet in denselben historischen Kontext – die Iran-Contra-Affaire. In allen drei Fällen haben wir es mit der Folge weniger mit einer Ermittlung als vielmehr mit einer Vertuschung zu tun.“ (7f.)

Der Fall Palme bezieht sich auf die am 28. 2. 1986 erfolgte Ermordung von Sven Olof Joachim Palme (1927-1986), der nach einer ersten Amtszeit (1969-1976) 1982 erneut zum schwedischen Ministerpräsidenten gewählt worden war und damals durch seine Initiativen für Abrüstungspolitik in Europa bekannt wurde. Uwe Barschel (1944-1987), der junge erfolgversprechende CDU-Politiker aus Schleswig-Holstein, seit 1979 Landesminister und 1982 Ministerpräsident, am 2. 10. 1987 wegen einer dubiosen Verleumdungskampagne gegen Björn Engholm im Wahlkampf zurückgetreten, wurde am 11. 10. 1987 im Hotel Beau Rivage in Genf tot aufgefunden. Der dritte Tote, William Colby (1920-1996), war ein hoher US-amerikanischer Regierungsbeamter, 1973-1976 CIA-Direktor, zuvor aktiv beim Aufbau des NATO-Stay-behind-Netzwerkes und dessen diverser subversiver politischer und militärischer Einsätze, wurde am 27. 4. 1996 angeblich infolge eines Bootsunfalls am Strand tot aufgefunden.

Bei der „Iran-Contra-Affaire“ handelt es sich um einen politischen Skandal während der Amtszeit des republiknischen US-Präsidenten Ronald Reagan 1981-1989; hier ging es um geheime internationale Waffengeschäfte mit dem boykottierten Iran zur Finanzierung von von Rauschgiftgeschäften der rechtsgerichteten Untergrundkämpfer der Contras in Nicaragua. In dieses Waffengeschäftnetzwerk waren auch europäische Staaten, diverse Behörden, Persönlichkeiten, Unternehmen, Geheimdienste, Waffenhändler etc. beteiligt.

In Kapitel 1: Olaf Palme (23-110) wird versucht nachzuweisen, dass der chilenisch-amerikanische Auftragsmörder Michael Townley oder der Kurde Hamid Dadashnijad (des damaligen iranischen Geheimdienstes SAVAK) im Auftrag von Leitungsgremien der NATO-Geheimarmee SOPS (Secret Operations Planning Staff) den Auftrag zur Erordung Olof Palmes erhalten habe. Dies sei im SOPS-Abstimmungsprotokoll vom 15. 12. 1985 (abgedruckt 396-401) verdeckt unter einem Code festgehalten, wie der ehemalige CIA-Agent Oswald LeWinter offenbart habe (87f.): „Das SOPS-Protokoll nennt zwei Motive für die Tat. Zum einen … hatte ein schwedisches Schiff angereichertes Uran 235 via Kiel nach Neu-Delhi transport. Palme hatte … bei seinem Besuch in Indien Rajiv Gandhi Plutonium für den Bau einer indischen Atombombe im Gegenzug für den Kauf von Bofors-Geschützen versprochen – ein Milliardendeal.“ Zweitens „ging es um den geplanten Besuch Olof Palmes in Moskau und seine Idee einer atomwaffenfreien Zone in Mitteleuropa sowie eines neutralen Skandinavien.“(88)

Ein weiterer Grund für den Palme-Mord läge in der Iran-Contra-Affaire und Palmes Ablehnung von Waffen-Transitlieferungen über Schweden. Dabei ist Informant LeWinter eine zwielichtige Figur und das NATO-Dokument nicht eindeutig autentifiziert. Insofern heisst es spekulativ: „Wenn das Abstimmungsprotokoll vom 15. Dezember 1985 aber echt ist, dann ist dies der Beleg, dass der Mord an Olof Palme von westlichen Geheimdiensten unter der Führung der CIA und des MIG über die Gladio-Kommandozentrale ACC/SOPS von ´Stay-behind´ geplant und organisiert wurde. Führt man die Angaben in diesem Dokument zusammen mit jenem von Gene Tatum und den Recherchen von Ole Dammegard, dann ergibt sich eine Befehlskette, die von George H. W. Bush über die Enterprise-Gruppe zu ACC und SOPS auf NATO-Ebene führte und von dort zu einem Team professsioneller Hitmen, bestehend aus Logistikern des südafrikanischen Geheimdienstes und einer Gruppe rechtsextremer schwedischer Polizisten bis hin zum ausführenden Täter im juristischen Sinne. Ein Auftragsmörder mit nahöstlichem Hintergrund macht vor diesem Hintergrund durchaus Sinn.“(101)

Mit der Interpretation von Zeugenaussagen, Täterspuren und Ereignisse der Tatnacht nach dem vorgegebenen Schema endet das erste Kapitel des Buches.

Das mehr als 200 Seiten umfassende Kapitel 2: Uwe Barschel (111-303) zeichnet die Vorgänge des bis heute immer noch offiziell als Selbstmord deklarierten Todes des ehemaligen CDU-Ministerpräsidenten sowie die Hintergründe nach. Bei der Beurteilung des Tatortes und der gefundenen Spuren und Indizien schliessen sich die Autoren Baab/Harkavy der Meinung Willes an, nämlich dass diese „mehr auf Mord“ (139) hindeuten. Dabei müssten der oder die Täter im Zusammenhang mit den Machenschaften, die Uwe Barschels „Doppelleben“ betreffen, zu suchen sein. Dieses Doppelleben führe „ins Zentrum eines Netzwerks von Waffenschiebern und Embargohändlern“, das unter anderem „die Bundesrepublik Deutschland und die DDR, Schweden, verschiedene arabische Staaten, Iran und Südafrika umfasste und das ein grosses Munitionskartell aus Rüstungsschmieden, zahlreichen diskreten Bankkonten in der Schweiz sowie die mysteriöse Nugan Hand Bank in Australien einschloss.“(176) Dabei mischten auch diverse östliche, westliche, nahöstliche Geheimdienste wie MfS, MIG, CIA, BND, Mossad mit. Barschel habe in seiner Eigenschaft als Notar und Politiker in diesem Netzwerk als Vermittler von Waffengeschäften zwischen BRD, DDR, Südafrika und dem Iran gewirkt. Für wahrscheinlich halten die Buchautoren, dass sowohl Barschel als auch Palme Opfer einer verordneten Operation der Geheimdienstarmee Stay-behind geworden seien: „Vieles spricht dafür, dass [die NATO-Geheimarmee] SOPS den Mord an Barschel organisiert hat, um die konzentrierte Staatskriminalität des illegalen Waffenhandels zu kaschieren. Als ausführende Subunternehmer kommen dann die CIA-Tarnfirma Adler Research in Boston – oder ein anderer Geheimdienst in Frage.“(300) Der Tatort sei auch nicht das Hotel Beau-Rivage gewesen, sondern das angrenzende Hotel Noga-Hilton in Genf (301f.) – und so erkläre sich auch die gesamte Tatortinszenierung.

In Kapitel 3: William Colby (303-324) wird eine Verbindung zu den Morden an Palme und Barschel gezogen. Colby leitete nicht nur während des Zweiten Weltkrieges paramilitärische Einsätze des OSS (Office of Strategic Services), sondern baute in den 50er Jahren in Schweden und Italien für die NATO Stay-behind-Organisationen auf. Ausserdem war er führendes CIA-Mitglied, wirkte von 1959 bis 1962 in der CIA-Centrale in Saigon als stellvertretender Leiter, war ab 1962 in der CIA-Planungsabteilung in Washington verantwortlich für Indonesien, Japan und Vietnam, stieg 1971 zum geschäftsführenden Direktor der CIA auf und wurde 1973-1975 ihr Leiter. Danach trat Colby aus dem Staatsdienst aus und wirkte als Rechtsberater in der Privatwirtschaft, unter anderem für die australische Nygan Hand Bank (wahrscheinlich eine Tarnorganisation der CIA). Im April 1996 wurde Colby tot aufgefunden.

Die Autoren vermuten, dass Colby nach seinem Ausscheiden aus dem Staatsdienst, als Ruheständler getarnt, verdeckte Aktionen der CIA steuerte. Darüber hinaus hätte er Kenntnisse über ein pädophiles Netzwerk, das in höchste Regierungskreise reichte, und über den Kokainhandel im Zusammenhang mit der Iran-Contra-Affaire gehabt, die er einem Untersuchungsausschuss des Kongresses hätte preisgeben können. Ausserdem kannte Colby die verdeckten Operationen und ihre Befehlskette. „Deshalb liegt es nahe, dass die CIA … hinter dem Mord an William Colby steht.“(324)

Im „Ausblick: Ein amerikanischer Schattenkrieg“ (325-335) werden alle drei Morde gekennzeichnet „als gezielte Tötungen, deren Motiv aus den verdeckten Operationen der CIA in der Endphase des Kalten Krieges erwächst“(326), wobei es auch und gerade um Millionen schwere Geschäfte im Waffenhandel ging.

Auch für die Ausführungen von Baab/Harkavy gilt, was quellenkritisch zu Wille angemerkt wurde: Geheimdienste wirken im Geheimen, verwirren, fälschen, lügen, vertuschen, morden und vieles andere mehr. Das führte den ehemalig prominenten SPD-Politiker Andreas von Bülow sogar dazu, in seinem 1998 veröffentlichten Buch „Im Namen des Staaates. CIA, BND und die kriminelen Machenschaften der Geheimdienste“, ein „erschreckendes Gemälde der systematischen operativen Verschränkung geheimdienstlicher verdeckter Operationen mit der weltweiten organisierten Kriminalität, dem Drogenhandel, aber auch dem Terrorismus“(12) zu zeichnen, in dem auch der Mord an Barschel und Palme (135-141) aquftacht. Deshalb sind schriftliche und mündliche Zeugnisse von Geheimdiensten nicht besonders aussagekräftig. Damit wird nicht bezweifelt, dass hier politische Morde vorlagen, zumal diese in neuster Zeit auch von Regierungskreisen der USA nicht mehr vertuscht, sondern offen zugegeben und auch moralisch gerechtfertigt werden wie die Ermordung von Osama bin Laden im Mai 2001, Muammar al-Gaddafi im Oktober 2011 und Qasem Soleimani im Januar 2020.

Schliesslich veranschaulichen Ausführungen von Wille, dass offizielle Erklärungen deutscher Staatsanwaltschaften (wie im Fall Uwe Barschel) nicht notwendigerweise Ergebnis von Wahrheitssuche sind. Sondern oft politischen Vorgaben folgen.

Anis Amri

Die Dreistigkeit, mit der die Öffentlichkeit in Deutschland belogen und hinters Licht geführt wird, zeigt der Terroranschlag vom 19. 12. 2016 durch den sogenannten Islamisten Anis Amri auf den Weihnachtsmarkt am Breitscheidplatz in Berlin-Mitte mit zwölf Toten und siebzig Verletzten. Denn dies war keineswegs die Tat eines kleinkriminellen Einzeltäters, wie offizielle Verlautbarungen und Medien verkündeten. Sondern dieser terroristische Anschlag wurde orchestriert als „eine internationale Geheimdienstaktion“, um mit den Erkenntnissen aus und um den Anschlag die lybischen IS-Camps militärisch durch die USA auszuschalten. Diese begründete These breitet der Journalist und ehemalige Polizist Stefan Schubert aus in zehn Kapiteln seines Buches:

Stefan Schubert: Anis Amri und die Bundesregierung. Was Insider über den Terroranschlag auf den Breitscheidplatz wissen. Rottenburg (Kopp-Verlag) 2019, 240 Seiten, 19.99 €

Das 1. Kapitel „Der Anschlag“ (14-23) erinnert an die tragischen Ereignisse am 19. 12. 2016. Bevor Anis Amri den Schwerlaster um 20.02 Uhr in den Weihnachtsmarkt steuerte, hatte er den polnischen Fahrer Lukacs Urban ermordet, um das Fahrzeug stehlen zu können, stand in telefonischem Kontakt mit seinem islamistischen Instrukteur Mahir D., versandte Nachrichten an IS-Gesinnungsgenossen in Berlin und ins Ruhrgebiet, besuchte die Fussilet-Moschee [vielleicht um sich den Segen für sein Vorhaben abzuholen], und hielt sich Tage zuvor in islamistischen Kreisen in Berlin auf.

Im 2. Kapitel geht es um „Die Flucht“ des terroristischen Attentäters (24-50). Obwohl Anis Amri sogleich – spätestens mit dem Fund der Geldbörse am nächsten Tag – als Täter identifiziert worden war, erfolgte erst 52 Stunden später am 22. 12. 2016 die bundesweite Fahndung. So dass der Täter leicht entkommen konnte. Dabei hatten schon vor dem Terroranschlag alle Voraussetzungen zur polizeilichen Ermittlung bestanden, den 2015 illegal eingereisten Tunesier aus Deutschland abzuschieben. Und sogar noch nach dem Anschlag selbst gab es vielfältige geheimdienstliche Möglichkeiten, Anis Amri gefangen zu nehmen.

In Kapitel 3 „Die `falschen´ Toten vom Breitscheidplatz“ (52-72) gedenkt Stefan Schubert der Opfer: der zwölf namentlich genannten Toten und der siebzig Verletzten, die würdelos von der Bundesregierung und weiteren Behörden behandelt wurden und werden. Dies wird auch deutlich mit dem sog. Denkmal, des 17 Meter langen Bronze-Risses, erdacht von Pablo von Frankenberg aus dem alerten Berliner Architektenbüro Merz Merz (mm+).

Die These „Anis Amri war ein Teil einer CIA-Geheimdienstoperation“ wird im Kapitel 4 des Buches ausgebreitet (74-95). Materialgrundlage sind Berichte von „Geheimnisträgern in den Sicherheitsbehörden, die den Mut hatten, sich dem Autor anzuvertrauen“(76). Demnach war Amri vor seiner illegalen Einreise nach Deutschland in Italien wegen krimineller Delikte inhaftiert (2011-2015), reiste nach seiner Entlassung über die Schweiz am 6. 7. 2015 in Freiburg nach Deutschland ein, geriet in NRW ins Visier polizeilicher Ermittlungen, die angesichts der Beurteilung seiner Gefährlichkeit (unter anderem Kontakt zum Islamischen Staat [IS bzw. ISS] in Lybien, Anschluss an den Kreis um den „Hassprediger“ Abu Walaa) im Juni 2016 dazu führten, beim Generalbundesanwalt einen Haftbefehl zu beantragen. Doch Anis Amri muss schützenden Hände gehabt haben: so wurde er aus der Abschiebehaft in Regensburg entlassen und auch nicht bei der Aushebung der IS-Zelle um Walaa im November 2016 festgenommen. Dabei waren relevante Regierungsvertreter wie die Bundesminister Dr. Thomas de Maiziere, Heiko Maas, Peter Altmeier und auch der damalige nordrhein -westfälische Innenminister Ralf Jäger über Anis Amri informiert: „Bei all diesen Ministern und ihren untergeordneten Behörden fiel auf, dass sie alles daransetzten, dass Anis Amri weder festgenommen noch abgeschoben wurde, damit die CIA und das Bundesamt für Verfassungsschutz ihre Abschöpfungsaktion beim IS-Lockvogel Amri in Deutschland fortführen konnten.“(86)

In Kapitel 5 setzt sich der Autor mit der regierungsamtlichen Version der Einzeltäterschaft unter der Überschrift „Das deutsche und internationale IS-Netzwerk um Anis Amri“(96-130) auseinander. Er verweist dabei speziell auf die IS-Zelle um Abu Walaa und seine Stützpunkte in Hildesheim, Duisburg, Berlin. Aus diesen islamistischen Kreisen solle sich auch die Unterstützerszene für Amri (bestehend aus Abed El-Rahman, Walid S., Sadik I, Hasan Celenk, Ahmet Y. und anderen) zusammengesetzt haben. Personelle Verbindungen gab es auch nach Marsaille in Südfrankreich, nach Norditalien und nach Tunesien (Fouchana und Queslatia). Ferner gab es einen engen Austausch übers Internet (Chatprogramm Telegram) besonders mit dem Instrukteur Mahir D. bzw. Moadh (120).

Die Terrorzelle um Anis Amri dürfte jedoch nur eine von vielen (gewesen) sein, die sich nach der Grenzöffnung von 2015 bildeten. Dafür spreche auch die zunehmende Zahl an islamistischen Ermittlungsverfahren mit etwa tausend im Jahr 2017.

In dem Zusammenhang kommen nun auch Staatsschutzbehörden, vor allem Bundesnachrichtendienst (BND) und Verfassungsschutzämter (des Bundes und der Länder), ins Spiel. Das wird in Kapitel 6 „Die V-Männer“(132-155) angesprochen. Nachweislich stand der deutsch-türkische V-Mann aus NRW Murat (Akronym VPO1) in Kontakt mit der IS-Zelle um Abu Walhaa und mit Anis Amri, der ihn in seine Terrorpläne einweihte. Dieser Murat könnte aber auch als Agent Provokateur aufgetreten sein und Amri gezielt zu Terrorplänen angetrieben haben. Hinzu kam, dass mindestens ein weiterer V-Mann im IS-Hauptquartier, der Fussilet-Moschee, die übrigens mit Überwachungskameras beobachtet wurde, zur Zeit der Vorbereitung des Anschlags aktiv war. Damit reicht die Mitverantwortung für den Terroranschlag von den diversen deutschen Geheimdiensten bis in die Bundesregierung und die NRW-Landesregierung.

Dieser Zusammenhang ergibt sich aus dem öffentlich zugänglichen Abschlussbericht des Parlamentarischen Kontrollgemiums des Bundes zum Komplex Anis Amri vom 31. 5. 2017 (BT-Drucksache 18/12585). Auf diesen geht Schubert kommentierend und interpretierend in Kapitel 7 „Anis Amri und die deutschen Geheimdienste“(156-175) ausführlich ein. Demnach kannten die Behörden unter anderem durch Spiegelung der SIM-Karte Amris Handys bei seiner kurzfristigen Festnahme am 18. 2. 2016 sowie durch dringliche Warnungen der tunesischen und marokkanischen Geheimdienste an den BND dessen terroristische Vorhaben. Doch das Bundesamt für Verfassungsschutz zentralisierte alle Erkenntnisse in ihrer obersten Leitungszentrale in Berlin (H. G. Maassen) und entschied, „Anis Amri auf freiem Fuss zu belassen, um die Netzwerke und Daten von Amris IS-Kontaktleuten und IS-Hintermänner weiterhin abschöpfen zu können – und zwar für die CIA“(162), damit die USA libysche IS-Camps – wie am 19.1.2017 geschehen – bombardieren konnten.

In den nachfolgenden drei Kapiteln: „Kapitel 8: Vertuschungsmanöver der Bundesregierung“(176-198), „Kapitel 9: Das Parlament wird belogen“(200-209) und „Kapitel 10: Die internationale Geheimdienstoperation um Anis Amri“(210-227) sind hauptsächlich folgende Fakten interessant: erstens, dass der 26jährige Tunesier Bilal Ben Ammar am 1. 2. 2017 – trotz schwerwiegender Hinweise, vorbereitend und direkt am Terroranschlag Breitscheidplatz beteiligt gewesen zu sein – heimlich nach Tunesien abgeschoben wurde (wo er untertauchte); zweitens; dass durch Verschweigen, Lügen und „Maulkorberlasse“ parlamentarische Aufklärung verhindert wurde (und wird); und drittens dass es im Fall Amri um eine „von der Bundesregierung unterstützte CIA-Aktion“ ging – nämlich mittels der abgehörten Handy- und Chatkommunikation von Anis Amri Megadaten zu erhalten, um die libyschen IS-Camps zu orten und zu zerstören. Diese vom damaligen US-Präsidenten Obama autorisierte Aktion erfolgte am 19. 10. 2017 mit zwei Tarnkappenbombern vom Typ B2, die ausgerüstet mit satellitengelenkten Präzisionsbomben waren(213).

Stefan Schubert argumentiert weitgehend überprüfbar, sachlich und überzeugend. Der Autor weist nach, dass die Toten und Verletzten des meist Attentat am Breitscheidplatz genannten politischen Mordes vom 19. 12. 2016 Opfer bewusster politischer Entscheidungen höchster Entscheidungsträger der deutschen Geheim.

Facit

Die hier ausführlich vorgestellten Veröffentlichungen zu politischen Morden zeigen: (1) nicht selten verbergen sich hinter offiziell verkündeten Selbstmorden von unter seltsamen Umständen verstorbenen Politikern oder öffentlich einflussreichen Persönlichkeiten politische Morde;

(2) politische Morde erklären sich nicht einfach aus Motiven von Tätern. Sondern aus deren unbewusstem und bewusstem Wirken innerhalb von politischen (insbesondere geheimen) und kriminellen Strukturen, die sowohl öffentlich wie auch verborgen wirkten und nachwirken.

Und das bedeutet: Es besteht nach wie vor und immer noch erheblicher Aufklärungsbedarf.

Dr. Wilma Ruth Albrecht ist Sprach- und Sozialwissenschaftlerin mit Arbeitschwerpunkten aus dem 19. und 20. Jahrhundert. Sie veröffentlichte die Bücher Bildungsgeschichte/n (Shaker Verlag, 2006), Harry Heine (Shaker 2007), Nachkriegsgeschichte(n) (Shaker 2008), Max Slevogt 1868-1932 (Hintergrund Verlag 2014), PFALZ & PFÄLZER. LeseBuch Pfälzer Volksaufstand 1849 (Verlag freiheitsbaum 2014) sowie zuletzt ihr vierbändiges Werk ÜBER LEBEN. Roman des Kurzen Jahrhunderts (Verlag freiheitsbaum: Edition Spinoza 2016-2019). © Autorin (2020)

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC). dienste und der deutschen Regierung waren

——————————————————————–

Grafikquelle       :            Besuch von Bundespräsident Karl Carstens (Bildmitte) und seiner Ehefrau Veronika. Im Vordergrund links Ministerpräsident Uwe Barschel.

Source
Author Gasch, Georg (1928-)
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.

Abgelegt unter Bildung, Deutschland, Kultur, Regierung | Keine Kommentare »

Streit ums Jüdische Museum

Erstellt von DL-Redaktion am 17. Februar 2020

Solidarität aus falschen Motiven

File:Berlin, Denkmal für die ermordeten Juden Europas -- 2011 -- 2415.jpg

Muss ein Jeder, welcher als Kind mit Förmchen im Sandkaste spielte, später auch als großer Künstler verstanden werden? Als Zeichen einer konturlosen Politik ? Kalte Steine lassen die Herzen vieler Deutschen höher schlagen !

Von Meron Mendel

Kritik an der Bewegung BDS ist gut und richtig. Gleichzeitig muss es möglich sein, antimuslimischen Rassismus zu kritisieren.

Viele meiner Berliner Freund*innen glauben, dass sich das gesamte Universum um Berlin dreht. Hingegen fällt es mir immer schwerer, meinen israelischen Freund*innen zu erklären, was gerade die Gemüter in Berlin bewegt. Etwa, dass ausgerechnet das dortige Jüdische Museum gerade verdächtig wird, das neue Zentrum des politischen Islams zu sein. Von der breiten Öffentlichkeit eher unbemerkt, tobt derzeit ein lebhafter publizistischer Kampf um das Museum.

Aktueller Kulminationspunkt ist ein Artikel von Thomas Thiel in der FAZ. Thiel, der sonst eher als Generalist auftritt, erzählt einen aufregenden Agententhriller aus dem behäbig auftretenden Museum: Unter der Leitung der Historikerin Yasemin Shooman sei die Akademie des Museums letztlich zu einer Außenstelle der ­Israelboykott-Bewegung BDS geworden.

Thiel suggeriert überdies einen Zusammenhang mit anderen, durchaus unschönen Vorgängen, die sich in den letzten Jahren unter wechselnder Verantwortung im Jüdischen Museum abspielten. Eine missglückte Ausstellung zu Jerusalem, fragwürdige Einladungen iranischer Politiker und ein eigenartiger Tweet.

Nimmt man Thiels Darstellung ernst, ist all dies kein Zufall oder das Ergebnis einer auch bewusst die Kontroverse zulassenden Veranstaltungspolitik, sondern letztlich auf das Handeln einer einzelnen Frau zurückzuführen. Sie wird dargestellt als eine islamistische Geheimagentin, deren Ziel die Diskreditierung Israels und das Vorantreiben islamischer Themen gewesen sei. Ihren Manipulationskünsten sei der inzwischen ausgeschiedene Direktor Peter Schäfer machtlos erlegen.

BDS funktioniert als billiges Ventil für Judenhass

Die betroffene Wissenschaftlerin Yasemin Shooman hat sich selbst Ende Januar im Tagesspiegel zu Wort gemeldet. Unterstützung erhielt sie zudem von Wissenschaftlern wie Micha Brumlik und dem Schriftsteller Max Czollek. Thiels Artikel hingegen fand breite Zustimmung bei einer Reihe recht boulevardesker Autoren, an deren Ende sich auch noch Thilo Sarrazin zu Wort meldete.

Dass die Kritik an der im Kern antisemitisch motivierten BDS-Bewegung nötig ist, darüber besteht inzwischen erfreuliche Übereinstimmung. Die Dämonisierung Israels und das Messen seiner Politik an Doppelstandards, das Verantwortlichmachen von Jüdinnnen und Juden in aller Welt an der Politik Jerusalems, nicht zuletzt der Abbruch aller Friedensprojekte unter Inkaufnahme gravierender Nachteile für die Palästinenser*innen, für die man sich vorgeblich einsetzt:

All das zeigt, dass die BDS-Bewegung im Wesentlichen nur als billiges Ventil für Judenhass funktioniert. Ich selbst habe das immer wieder, gerade auch und ausgerechnet im Rahmen von Friedensprojekten, erlebt. In Israel habe ich mich in mehreren israelisch-palästinensischen Dialogforen engagiert. Allesamt wurden sie letztendlich von BDS-Aktivist*innen sabotiert und verunmöglicht.

Die an den Projekten beteiligten palästinensischen Freund*innen mussten den höchsten Preis für ihr Engagement bezahlen: Sie waren anschließend nicht nur Repressionen ausgesetzt, sondern mussten bisweilen buchstäblich um ihr Leben fürchten. Von einer substanziellen Kritik der BDS-Bewegung ist Thomas Thiels Beitrag in der FAZ jedoch weit entfernt.

Stattdessen operiert er mit Kontaktschuld-Hypothesen („ihr habt X eingeladen, also denkt ihr wie X“), mit freien Assoziationen und der Suggestion, allein die Auseinandersetzung mit antimuslimischem Rassismus führe zwangsläufig in die Nähe von BDS und Antisemitismus.

An der Tatsache, dass Yasemin Shooman „durch eine Veranstaltungsreihe zum interreligiösen Dia­log dem Thema antimuslimischer Rassismus breite Resonanz im Jüdischen Museum“ gegeben hat, ist jedoch in meinen Augen überhaupt nichts auszusetzen, das Raunen kann man sich sparen. Nicht nur, weil Shooman ausdrücklich dafür eingestellt wurde, ebendieses Thema zu behandeln; und nicht nur, weil Initiativen dieser Art ausdrücklich auch zum Gründungsgedanken des Jüdischen Museums gehören.

Islamfeindlichkeit gehört als Thema ins Jüdische Museum

Gerade weil Antisemitismus unter Muslimen nicht kleingeredet werden darf, sind solche Dialogveranstaltungen wichtig. Dass im Dialog sowohl über Diskriminierungserfahrungen der Jud*innen als auch von Muslim*innen geredet werden muss, kann ich aus meiner eigenen pädagogischen Arbeit berichten – und feststellen, dass solche Dialoge der beste und leider oft einzige Weg sind, an latenten und verfestigten antisemitischen Einstellungen einen Hebelpunkt zu finden.

Quelle       :      TAZ         >>>>>       weiterlesen

————————————————————————-

Grafikquellen      :

Oben       —        Denkmal für die ermordeten Juden Europas, Berlin, Deutschland

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: Dietmar Rabich

————————————–

Unten      —     Kollegienhaus, the baroque part of the Jewish Museum

Abgelegt unter Bildung, Regierung, Regierungs - Werte, Religionen | Keine Kommentare »

Politik statt Flugscham

Erstellt von DL-Redaktion am 15. Februar 2020

Den Fußabdruck politisieren

File:Footprint in Snow.JPG

Quelle     :         untergrund-blättle CH.

Von  Andrea Strübe  kritisch-lesen.de

Der Alltag steckt voller Appelle, das Richtige zu tun. Was für ein besseres Leben für alle wirklich notwendig wäre, ist leider nur selten Gegenstand von Debatten.

Samstagabend. Ich sitze zusammen mit Freund*innen beim Bier. Es kommt eine allzu gewohnte Diskussion auf. Die These meiner Gegenüber: Wenn der Porschefahrer zum Biomarkt fährt und sich dort mit veganer Ernährung versorgt, ist das immer noch besser, als wenn er nur Porsche fährt. Ich frage: Was macht das für einen Unterschied? Mal abgesehen davon, dass er sich an Bio dumm und dusselig essen kann, bis er den Porsche amortisiert hat, ändern wird er damit nichts. Ein solches Verhalten ist vielleicht chic, aber ganz sicher nicht politisch. Es fällt der viel zu oft gehörte Satz: Wenn es aber alle so machen würden! Wir reden uns heiss, Argumente werden ausgetauscht, manche einfach immer wieder wiederholt. Am Ende sind wir alle aus der Puste, die Stimmung ist gekillt und keine*r schlauer.

Warum hält sie sich so wacker in den hoffnungsvollen konsum- und lifestylebewussten Köpfen der Menschen, diese Formel „wenn es alle so machen würden“? Wenn wir alle ein bisschen verzichten, dafür alle ein bisschen mehr Gutes tun und verantwortungsvoll mit den Ressourcen umgehen würden, dann könnten wir viel bewegen. Dann würden sich Konsumgewohnheiten nachhaltig verändern, menschliches wie tierisches Leid könnten gemindert werden. Die Industrie würde die Macht der Verbraucher*innen ernst nehmen müssen und die Klimakatastrophe könnte abgewendet werden. Keine Diskussion über Veganismus, Bio, Verzicht auf Flugreisen et cetera kommt ohne diesen Satz aus. Stellt man die politische Dimension bewussten Verhaltens in Frage, dann wird er einem garantiert entgegengehalten. Warum? Ist das der letzte Strohhalm, an den sich alle klammern?

Na klar, die Formel klingt ja auch erstmal logisch. Aber ist das Problem einfach nur, dass nicht alle mitmachen? Zyniker*innen könnten sagen, das wird eh nix – wie willst du alle Menschen davon überzeugen, diesen Lebenswandel mitzumachen? Wo beginnt eigentlich die kritische Masse? Wieviel Macht haben die Verbraucher*innen? Wieviel Verzicht ist dafür notwendig? Wieviel impact hat der vegane Porschefahrer auf das Klima? Wieviel Verantwortung trägt die*der Einzelne?

Aber das Problem mit der Formel ist offensichtlich: Sie geht nicht auf. In ihr ist das Grundsätzliche nicht enthalten: Produktionsbedingungen, Ausbeutung, Überproduktion. Der Kapitalismus eben. Wenn möglichst viele mitmachen – dieses Konzept verharrt auf der Ebene der Verantwortung einzelner Subjekte und klammert grössere Zusammenhänge aus. Trotzdem begegne ich – auch (oder gerade?) in meinem bewussten, bio-affinen Umfeld – immer wieder individuellen Verzichtsneurosen statt politischer Debatte. Vegan/vegetarische Ernährung, Biosupermarkt, Lebensmittelkooperative, Fairtrade, Verzicht auf Flugreisen, Autos, Plastik. Und ein ständiges Hadern mit den Widersprüchen. Du sagst mir, fliegen ist schlecht und hast schon wieder ein neues Smartphone? Keine*r möchte Teil sein von der ekelhaften, schmutzigen, alles verschlingenden Industrie, von der Rücksichtslosigkeit, mit der im profitgetriebenen Kapitalismus der Planet vor die Hunde geht. Aber wie gehen Alternativen?

Diese ständige Suchbewegung in einer undurchsichtigen Materie zeichnet die Hilflosigkeit aus, mit der wir nach Verbesserung suchen. Mir geht es auch so. Mein Gewissen ist mein ständiger Konsumbegleiter, mein ökologischer und sozialer Fussabdruck verfolgt mich. Mir wurde das als Kind schon eingebläut: Bio-Essen, kein Wasserlaufenlassen beim Zähneputzen, alles wird alle gemacht, Licht wird immer ausgemacht, Pulli statt Heizung, Fahrrad statt Auto. Ich kann mich nicht freimachen von meiner gefühlten Verantwortung. Obwohl ich weiss, dass mein Verhalten an vielen Stellen überhaupt nichts nützt, wenn nicht gar Verhältnisse stützt. Oder ich eben nicht weiss, wie effektiv das jetzt ist. Ach, die Achtsamkeit

Diese Überforderung hat sicherlich viele Gründe. Die Folgen meines Handelns sind so undurchsichtig, Informationen so konträr, Angebote so zahlreich. Verantwortung übernehmen zu wollen, heisst nicht gleich, die ganze Komplexität und damit auch Lösungen zu erfassen. Was aber erschwerend hinzu kommt, ist der moralische Druck. Fast könnte man meinen, wir befinden uns im Zeitalter des Hyper-Bewusstseins. Der Buchmarkt ist überschwemmt mit Achtsamkeits-Ratgebern: Achte auf dich selbst, achte auf deine Gesundheit, achte auf die Umwelt, achte auf dein Gegenüber, achte auf deinen Fussabdruck. Schön und gut, kann man so machen. Aber das Problematische daran ist, dass in diesen zig Appellen, die uns tagtäglich begegnen, nur eines angesprochen wird: das einzelne Subjekt. Die Verantwortung liegt beim Individuum, sowohl als Verursacher als auch als Verbesserer.

Das ist im neoliberalen Kapitalismus nicht weiter verwunderlich. Für unser Glück und unseren Erfolg selbst verantwortlich zu sein, das lernen wir mittlerweile von klein auf in allen Institutionen, die uns umgeben – Familie, Schule, Beruf, Gesellschaft, Medien et cetera. Natürlich überträgt sich diese Ideologie auch in Debatten um Nachhaltigkeit. Und so wird die Rettung des Planeten zum unternehmerischen Lifestyle. Hier wieder eine neue Plastikvermeidungsstrategie entdeckt, dort ein neues Rezept für veganen Käse, noch ein Unverpackt-Laden im Viertel eröffnet. Mit der ständigen Optimierung der eigenen Gewissenspflege lässt sich darüber auch noch eines ganz wunderbar praktizieren: Konkurrenz. In einem moralisch so aufgeladenen Feld die eigene Leistung zur Schau zu stellen und dann mit dem Finger auf andere zu zeigen: welch erhabenes Gefühl! So kontrollieren wir uns alle gegenseitig und können auf die verächtlich blicken, die diesen Trend nicht mittragen. So wird aus dem Projekt achtsames Leben vor allem eins: ein Projekt zur Herstellung des Klassenhabitus.

„Wenn es alle so machen würden“ – ein donnergrollender Schuldspruch an jene, die sich das Öko-Image schlicht nicht leisten können. Verzicht ist teuer. Was dabei ausgeblendet bleibt: Es sind die reicheren Menschen auf diesem Planeten, deren Lebensweise die schmutzigste ist. Wenn es alle so machen würden – die Aussage ist nicht wegen ihrer Realisierbarkeit absurd, sondern weil die meisten Menschen gar keine Möglichkeit haben, den Planeten so zuzumüllen, wie es nur relativer Reichtum erlaubt. Nur ein kleiner Teil der Menschheit fliegt beispielsweise – den Luxus schier unbegrenzter Mobilität geniessen nur wenige. Richtiger müsste der Satz also heissen: Wenn die Wenigen es so machen würden wie die meisten.

Ein praktischer Nebeneffekt ergibt sich aus der individualisierten Moralkeule ausserdem für Politik und Wirtschaft. Es ist wie das Tafelprinzip. Durch das ehrenamtliche Engagement zur Unterstützung sozial benachteiligter Menschen hat sich eine Hilfsinstitution etabliert, die den Staat aus seiner sozialen Verantwortung nimmt. Mit der stets aufs Individuum übertragenen Verantwortung bleibt unbeachtet, welche Verantwortung marktkonforme Politik und kapitalistische Wirtschaftsprinzipien haben.

Politik statt Flugscham

Wer von tiefgreifenden Veränderungen unserer vernichtenden Lebensweise spricht, darf vom Kapitalismus nicht schweigen. Konsum ist eines der tragenden Prinzipien in einer Ökonomie, die nach stetem Profit und Akkumulation strebt. Dieses Streben ist es, das die Ressourcen ausbeutet, immer neue Produkte entwickelt und auf den Markt schwemmt. Konsumanreize bestimmen unser aller Leben. Davon auszugehen, Konsument*innen hätten den Markt in der Hand und die Macht, den Markt entsprechend zu steuern, spricht für eine falsche Analyse davon, wie Angebot und Nachfrage im Kapitalismus funktionieren. Mit immer neuen Angeboten und Trends wird Konsumverhalten animiert. Das gilt auch für den Markt der Nachhaltigkeit. E-Autos, Bioware, Ökostrom. Auch damit wird Profit gemacht, auch damit wird das kapitalistische Prinzip der Konkurrenz befeuert.

Eines haben Konsum und Konsumverzicht gemeinsam: Sie lassen das Prinzip Kapitalismus unangetastet. Die Bemühungen, diesen nach grüneren Prinzipien zu reformieren, stehen in krassem Widerspruch zu seiner Grundlage: der Ausbeutung von Mensch und Natur. Auch wenn es dabei fairer und gesünder zugehen soll, ein wirklich grüner Kapitalismus ist schlicht nicht möglich.

Das soll kein Plädoyer für ein Weiter-so sein, bis wir den Kapitalismus abgeschafft haben. Natürlich ist ein achtsames Handeln wichtig. Natürlich ergibt es Sinn, sich Gedanken zu machen, auf wessen Kosten man lebt. Aber wir sollten anfangen, uns Gedanken zu machen über den Unterschied zwischen Lifestyle und Lebensstil. Mein Gewissen freikaufen und mich damit auf die Seite der moralischen Gewinner schlagen und dabei noch möglichst hip rüberkommen, bringt vielleicht dem eigenen Ego was, aber da hört‘s auch schon auf. Wenn wir uns ernsthaft Gedanken machen, wie wir unseren Lebensstil politisieren können und über individuelles Verhalten hinaus wachsen, dann brauchen wir gelebte Gegenmodelle. Wenn Linke über ein anderes politisches Projekt nachdenken, das den Kapitalismus überwinden soll, dann müssen wir auch jetzt schon ein Verhalten erproben, dass zu den Ressourcen des Planeten und deren gerechten Verteilung passt.

Dazu ist es unbedingt notwendig, unsere Diskurse über Verzicht, über Konsum, über Flugscham zu politisieren. Der erste Schritt muss sein, Debatten über Verantwortung zu entindividualisieren. Wir brauchen eine tiefgreifende und greifbare Analyse der Bedingungen, unter denen die Vernichtung von Lebensgrundlagen stattfindet. Wir müssen uns genau anschauen, welche die politischen und ökonomischen Konstellationen sind, die es ermöglichen, den Planeten zu Grunde zu richten. Die Einrichtung von Klimazielen auf staatlicher Ebene, wie sie hierzulande höchstens halbherzig verfolgt wird, ist nicht viel wert, wenn deutsche Konzerne einen Grossteil ihrer Emissionen in anderen Weltregionen fröhlich in die Atmosphäre blasen. Der Kapitalismus ist ein weltumspannendes System, als solcher muss er auch verstanden und angegriffen werden. Wenn es alle so machen würden…

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-ND 3.0) Lizenz.

Abgelegt unter Bildung, Bundestag, Kultur, Regierung | Keine Kommentare »

Tabubruch in Thüringen

Erstellt von DL-Redaktion am 13. Februar 2020

Babylon Erfurt

KINO BABYLON-100x100-2017-HST.jpg

Essay von Robert Misik

Gefährlich wird es, wenn das bürgerliche Zentrum Richtung extremer Rechter kippt. Ein erster Versuch in Thüringen ist aber gescheitert.

Es ist ein bisschen gespenstisch, aber auch ein bisschen skurril: Da schauen Millionen Serien-Afficionados gerade die neuen Staffeln von „Babylon Berlin“, die die Zuseher an die Wende der zwanziger zu den dreißiger Jahren zurückversetzen. Nationalkonservative Pseudo-Eliten bedienen sich der Nazipartei und ihrer Straßenbanden im Kampf gegen Sozialisten und Kommunisten. Mögen sie sich konservativ, natio­nal­liberal oder monarchistisch nennen: Im Zweifel opfern sie die pluralistische Demokratie, um sich der verhassten Sozis und der Republik zu entledigen. Derweil, nicht im Fernsehen und nicht in der History-Soap, sondern ganz in Echtzeit im Landtag in Erfurt: Es entfaltet sich ein Drama, dessen psychopolitische Hintergründe nicht sehr viel anders sind.

Doch der „Tabubruch“ von Thüringen brauchte keine 24 Stunden, um von der Farce zum Fiasko für die zu werden, die ihn sich ausgedacht haben. Ist das nun ein Skandal und eine Schande? Oder vielleicht doch eher ein Grund zum Feiern?

Beides natürlich, wenngleich mit Schlagseite zu Letzterem. Einerseits haben erstmals Parteien des sogenannten bürgerlichen Zentrums, die sich selbst so gerne als „Mitte“ sehen, einen zynischen Pakt mit den Rechtsextremisten geschlossen, andererseits sind die klaren Reaktionen darauf eher ein Hinweis darauf, dass mit dem Einreißen einer Brandmauer vor der extremen Rechten so bald nicht zu rechnen ist: schnell schon zeigten sich hohe FDP-Leute ebenso empört wie die Spitzen der Bundes-CDU. Von Angela Merkel abwärts machten alle klar, dass die gerissene Mauschelei der Landes-Union nicht toleriert werden würde; auch der CSU-Chef und Bayern-Ministerpräsident Markus Söder sagte in schnörkelloser Klarheit, dass man sich von Nazis nicht wählen lässt.

Nicht die hellsten Kerzen

Sollten die Gambler Thomas Kemmerich, Mike Mohring, Christian Lindner, aber auch Sozi-Hasser wie Wolfgang Kubicki und andere, die von „bürgerlichen Mehrheiten“ unter Einschluss der AfD träumen, gedacht haben, sie wären Cleverles, die mit ihrer Trickserei durchkommen, so haben sie sich offensichtlich heftig getäuscht. Der harte Wind blies ihnen derart ins Gesicht, dass sie schnell umkippten.

Ganz offensichtlich sind sie alle nicht die hellsten Kerzen auf der Torte und haben vergessen, ein paar Züge vorauszudenken, und hatten keinen Plan, wie sie mit der von ihnen geschaffenen Situation umgehen sollten. Kubicki freute sich zunächst, dann ruderte er zurück. Christian Lindner, in einer ersten Stellungnahme noch verschwurbelt, musste dann verzweifelt versuchen, aus der Nummer herauszukommen.

Die Landes-FDP stellte 24 Stunden lang den Ministerpräsidenten, und sollte es tatsächlich zu Neuwahlen kommen, würde sie mit hoher Wahrscheinlichkeit schnurstracks aus dem Landtag ­fliegen.

Ganz smarter Deal.

Kernschmelze des Rechts-Pakts

Die chaotische Kernschmelze des ersten deutschen Rechtspakts ist so gesehen natürlich eine gute Nachricht. Nicht nur für den Augenblick, sondern auch über diesen hinaus: Die Möchtegerntrickser haben sich allesamt dermaßen selbst geschadet, dass Nachahmer in der nächsten Zeit eher nicht ermutigt sein werden. Man vergleiche das nur mit jenen Ländern, in denen das bürgerliche Zentrum – mal schnell, mal allmählich – nach rechts gerückt ist, die Agenda des rechten Extremismus übernahm und mit den radikalen Nationalisten regierte, ob das jetzt Österreich ist, Italien, oder, auf wieder andere Weise, Ungarn oder Polen.

In Österreich beispielsweise hat ÖVP-Bundeskanzler Wolfgang Schüssel schon im Jahr 2000 mit der ultrarechten FPÖ eine Regierung gebildet. Damals gab es einen Aufschrei, europaweite Sanktionen und Massenproteste, aber die Konservativen hielten dem Sturm stand. Sie normalisierten die Allianz mit jenen Ultrarechten, die sie kurz davor noch als „außerhalb des Verfassungsbogens“ sahen.

File:Bundesarchiv Bild 183-56030-0001, Berlin, Luxemburgplatz, Kino "Babylon".jpg

Nach 2015 nahm Sebastian Kurz Kurs darauf, es ihm gleichzutun. Er übernahm weite Teile der Programmatik der extremen Rechten, kopierte ihre Rhetorik, etablierte eine Herrschaft der Niedertracht mitsamt rhetorischem Überbietungswettbewerb mit den Rechten – und am Ende bildete er mit ihnen eine Regierung. Regierungsallianzen mit extremen Rechten wurden zur Normalität umdefiniert, und all jene, die darin einen demokratiepolitischen Skandal sahen, zu „Hysterikern“. Nur durch Glück – Stichwort „Ibiza“ – flog die Koalition aus der Kurve.

Kurzum: Die radikale Rechte kann mit populistischen Kampagnen, mit ihrer Hasspolitik und indem sie die Wut und Entfremdungsgefühle des „einfachen Volkes“ gegen „die abgehobenen Eliten“ instrumentalisiert, Wahlerfolge einfahren und auch die politische Debattenlage vergiften. Ja, sie kann auch einen so starken Block in Parlamenten stellen, dass Regierungsbildungen gegen sie schwierig werden. Aber für sich allein kann sie nicht gefährlich werden. Gefährlich wird es erst, wenn die (neo)konservative Rechte zu wackeln beginnt und ihr den Weg in Ämter und Staatsfunktionen ebnet.

Starke Immunabwehr

In Thüringen wurde der erste Schritt in diese Richtung versucht – und hat zu so starken Immunabwehrreaktionen geführt, dass das Experiment gescheitert ist.

Quelle     :         TAZ         >>>>>        weiterlesen

——————————————————————-

Grafikquellen      :

Oben       —       Kino Babylon, 100×100 cm Huile sur toile, Claude-Max Lochu

 ————————————-

Unten        —         Berlin, Luxemburgplatz, Kino „Babylon“ Zentralbild Mihatsch So-Ho 6.6.1958 Die Kraniche ziehen. Der in Cannes mit der Goldenen Palme ausgezeichtnete sowjetische Film erlebte am 6.6.1958 im Berliner Filmtheater Babylon seine deutsche Erstaufführung. UBz: Vor Beginn der Premiere vor dem Babylon.

Allgemeiner Deutscher Nachrichtendienst – Zentralbild (Bild 183)
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-56030-0001 / CC-BY-SA 3.0

 

Abgelegt unter Bildung, Kultur, L. Thüringen, Regierung | Keine Kommentare »

Die Linke Thüringen

Erstellt von DL-Redaktion am 6. Februar 2020

Nichts aus der Geschichte gelernt?

Eingangstor des KZ Auschwitz, Arbeit macht frei (2007).jpg

POLITIK MACHT FREIER

Quelle       :        Scharf  Links

Zum Ausgang der heutigen Ministerpräsidentenwahl im Thüringer Landtag und die Auswirkungen auf die Bundesrepublik erklärt der Landesgeschäftsführer der Partei DIE LINKE, Sascha H. Wagner:

Der 5. Februar wird im schlechtesten Sinne als historischer Tag in die Geschichte eingehen. Im 75. Jahr nach der Befreiung vom Faschismus haben CDU und FDP gemeinsam mit der faschistischen AfD des Björn Höcke in Thüringen gemeinsamen einen Ministerpräsidenten gewählt.

Bei allen politischen Unterschieden der LINKEN zu CDU und FDP gab es bislang den Konsens, weder direkt noch in direkt mit der AfD, die sich zunehmend zu einer offen faschistisch agierenden Kraft entwickelt, zusammenzuarbeiten. Dieser selbstverständliche antifaschistische Konsens wurde heute in Thüringen gebrochen, trotz vorheriger Aussagen von CDU und FDP, nicht mit der AfD zusammenzuarbeiten.

Auch in NRW droht nach diesem Dammbruch eine Zusammenarbeit von CDU und FDP mit der AfD nach den Kommunalwahlen. Allen gegenteiligen Erklärungen ist nach Thüringen überhaupt kein Vertrauen mehr zu schenken. So haben sich schon verschiedene Gruppierungen der Jungen Union in NRW in ähnlicher Weise gegen eine linke Regierungsbildung geäußert.

Schon in der Weimarer Republik war es die DNVP, eine „liberale“ Vorgängerpartei der FDP, die als erstes mit der NSDAP kooperiert hat.  Offenbar hat die FDP aus der Geschichte nichts gelernt, sondern wiederholt sie auf schlimmste Weise.

Für Menschen jüdischen Glaubens, für von Diskriminierung und von Rassismus Betroffene ist heute ein besonders schlimmer Tag. Wir stehen als LINKE an ihrer Seite.

Gestärkt werden müssen nun diejenigen, die gegen Antisemitismus und Rassismus vorgehen.

Ich bitte die Menschen in Nordrhein-Westfalen zudem, der „Vereinigung der Verfolgten des Naziregimes – Bund der Antifaschistinnen und Antifaschisten“ beizutreten. Dort sind unter anderem die wenigen noch lebenden Widerstandskämpfer*innen gegen den Faschismus und viele ihrer Angehörigen organisiert.  Auch andere Bündnisse gegen rechts im einwohnerreichsten Bundesland müssen nun verstärkt aktiv werden. Wir dürfen eine Zusammenarbeit mit faschistischen Kräften nicht akzeptieren, wir dürfen nicht wegsehen, wir müssen gemeinsam nun noch entschiedener handeln als bisher.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquelle     :         Eingangstor des KZ Auschwitz, Arbeit macht frei (2007)

Abgelegt unter Bildung, Deutschland, Kultur, Positionen | Keine Kommentare »

Expedition „Mosaic“ : Arktis

Erstellt von DL-Redaktion am 31. Januar 2020

„Die Arktis ist schon in einem neuen Modus“

Hans-Insel

Das was Politik nicht weiß oder wirtschaftlich nicht wissen darf, erklärt  hier die Physikerin Dorothea Bauch.

Das Interview führte Fruederike Grabitz

Die Physikerin Dorothea Bauch war mit „Mosaic“, der größten Polarexpedition unserer Zeit, in der Arktis. Im taz-Interview erzählt sie von der Forschung und dem Alltag auf dem Expeditionsschiff.

taz: Du* kommst gerade von der Mosaic-For­schungs­expe­di­ti­on im Polarmeer. Was hat dich motiviert, über drei Monate in Dunkelheit und bei Kälte bis minus 45 Grad zu arbeiten?

Dorothea Bauch: Für mich als Wissenschaftlerin war das wahnsinnig faszinierend, im Polarwinter wissenschaftlich zu arbeiten. Das war bisher, wenn überhaupt, nur im Sommer möglich.

Euer Schiff, die „Polarstern“, driftet auf den Spuren von Fridtjof Nansen, der sich 1893 mit seinem hölzernen Forschungsschiff „Fram“ in der Eisdrift einfrieren ließ. Warum ist die Forschung im arktischen Winter auch heute noch so schwierig?

Die „Polarstern“ hat sich ja ins Eis gesetzt und bewegt sich mit ihm. Allein schon dorthin zu kommen ist eine Herausforderung. Wenn ein Eisbrecher bei seiner Fahrt Gegenwind hat, kann es sein, dass er sich zwar innerhalb des Eises bewegt, sich aber aufgrund der Eisdrift als Nettobewegung rückwärts bewegt. Als ich mit den Forschern des ersten Expeditions-Abschnitts abgeholt wurde, haben wir von 86° Nord bis Tromsø in Norwegen drei Wochen gebraucht, es hätte aber auch nur eine sein können.

Warum ist es denn wichtig, die Arktis im Winter zu erforschen?

Bisher haben wir für den Polwinter Schätzwerte aus Sommerdaten verwendet. Aber das funktioniert nicht wirklich, denn es gibt dort Mechanismen oder Prozesse, die es anderswo nicht gibt. Wir kennen zum Beispiel Wolken, die sich vor dem Mund bilden, wenn wir bei frostigem Wetter ausatmen. Diese Kondensation gibt es in der Arktis oft nicht. Wolkenbildung funktioniert dadurch grundlegend anders. Und die Prozesse am Pol beeinflussen das Klima hier – so gesehen, ist die Arktis nicht weit weg.

Was ist noch besonders an der Expedition?

Vor allem die Größe: es sind ja sechs Expeditionen hintereinander, die sich von September 2019 bis September 2020 über ein ganzes Jahr erstrecken. Das Ziel von „Mosaic“ ist, die Prozesse im Polarmeer, Eis und Atmosphäre zu verstehen. Dadurch, dass so viele Wissenschaftler aus unterschiedlichen Fachrichtungen dabei sind und wir vernetzte Geräte auf dem Eis installiert betreiben, haben wir die Möglichkeit zur Vernetzung von Fragen wie: In welcher Wechselwirkung stehen der Wind, das Eis, Schneedicke und Gasfluss? Ich selbst habe mit Kollegen Eis-Bohrkerne in Hinblick auf Gasflüsse und Eisbildungsprozesse untersucht. Das Meereis spielt ja eine Rolle für den Transport von Methan.

Methan ist als Gas 34-mal so klimaschädlich wies CO2. Welche Bedeutung hat eure Forschung für das Verständnis des Klimawandels?

Es geht um ein grundlegendes Verständnis für das Erstellen von Prognosen. Wir wollen nicht untersuchen, ob es den Klimawandel gibt. Das ist wissenschaftlicher Konsens, so wie man einen Mediziner nicht fragen würde, ob es Krebs gibt. Es geht darum, zu beobachten, wie sich die Arktis durch ihn verändert. Weil jetzt die Eisdecke im Sommer zusammenbricht, gehen wir davon aus, dass die Arktis sich schon in einem neuen Modus befindet.

Du warst im Sommer 2015 schon einmal mit der „Polarstern“ am Nordpol. Hast du dort eine Klimaveränderung wahrgenommen?

Vier Jahre sind zu kurz, um das in Bezug auf Klimaveränderungen zu vergleichen. Aber insgesamt ist das Eis weniger dick. Als wir jetzt ankamen und unser Forschungscamp aufbauen wollten, war es nicht einfach, dafür überhaupt eine geeignete Scholle zu finden.

Welche praktischen Folgen hat es, wenn das Polareis dünner wird?

Es gibt Feedback-Mechanismen, die das System entweder eine Weile stabil halten oder es komplett aus dem Gleichgewicht bringen. Das hat großen Einfluss auf den Wärmehaushalt der Erde. Dann haben wir zum Beispiel Auswirkungen auf die Schifffahrtswege. Und durch ein Steigen des Meeresspiegels werden soziale Konflikte und große Flüchtlingsströme von Menschen, die ihre Heimat verlieren, wahrscheinlicher.

In der Vorbereitung auf die Expedition hast du unter anderem Schießen gelernt.

Quelle      :       TAZ        >>>>>          weiterlesen

——————————————————————-

Grafikquellen         :

Oben        —          Hans-Insel

Abgelegt unter APO, Bildung, International, Umwelt | Keine Kommentare »

Der etwas andere Aufschrei

Erstellt von DL-Redaktion am 30. Januar 2020

„Male Bashing“ und die Folgen

File:SCAF took one sniff of freedom of speech and HATED it.gif

Quelle        :          untergrund-blättle CH.

Von Walter Hollstein

„Male bashing“ – das Beschimpfen von allem, was männlich ist – hat Hochkonjunktur. Aktueller Auslöser ist Donald Trump; Bernie Sanders hat ihn als „Mr. Macho“ etikettiert.

Trump gilt als Symbol der „angry white men“, die derzeit für alles Schlechte in der Welt verantwortlich gemacht werden: Klimakatastrophe, Terrorismus oder Wirtschaftskrise. Nachdem er diese und noch ein paar andere Übel aufgezählt hat, jammert Daniel-Dylan Böhmer in der „Welt“: „Eine Männerkrise bedroht den Planeten“. Und weil Männer gar nichts können, jedenfalls nichts Gutes, fleht der Autor: „Frauen der Welt, rettet uns vor diesen Männern!“

Der amerikanische Präsident Barack Obama hat im Spätsommer 2016 im Magazin Glamour den Essai publiziert „So sieht ein Feminist aus“. Der Vater zweier Töchter notiert: „Michelle und ich haben unsere Töchter dazu erzogen, das Wort zu ergreifen, wenn sie Doppelmoral sehen oder denken, dass sie wegen ihres Geschlechts oder ihrer Rasse unfair behandelt werden (…) Und ja, es ist wichtig, dass ihr Papa ein Feminist ist, denn jetzt erwarten sie das von allen Männern.“ Männer nimmt Obama dabei nur als Unterstützer des Feminismus wahr. Und da schliesst sich der Kreis zwischen den Präsidenten.

Während „Clinton und Obama die Frauenkarte gespielt haben“, so der Rechtsgelehrte Glenn Reynolds, seien Jungen und Männer sozial immer weiter zurückgefallen. Er ist nicht der einzige Kritiker. Die Politologin Katherine J. Cramer hat in ihrem Buch „The Politcs of Resentment“ eindrücklich beschrieben, wie viel Wut und Groll es in der Arbeiterklasse in Wisconsin gibt– einem Bundesstaat, der die Wahl Trumps mitentschieden hatte. Rechtsprofessorin Joan C. Williams erklärt in der Harvard Business Review den Erfolg Trumps mit den lange ignorierten Bedürfnissen arbeitender Männer.

Die Emanzipationsverlierer sind heute Jungen und Männer. Die Entwicklung der Wirtschaft tendiert seit geraumer Zeit in Richtung des „weiblichen“ Dienstleistungsgewerbes und zur sukzessiven Schrumpfung der „männlichen“ Industriearbeit. Dementsprechend steigt die weibliche Erwerbstätigkeit, während die männliche ebenso kontinuierlich abnimmt. Seit einigen Jahren ist die männliche Arbeitslosenquote höher als die weibliche. Das alimentiert nicht gerade die Zukunftsperspektive der nachwachsenden männlichen Generation, ebenso wenig wie der immer wieder kolportierte Slogan „Die Zukunft ist weiblich“. In den USA ist die Botschaft bereits angekommen. Dort spricht man mittlerweile nicht mehr von Rezession, sondern von „Hecession“.

Der Wirtschaftswissenschaftler Nicholas Eberstadt belegt in seiner Untersuchung „Men without Work: America´s Invisible Crisis“, wie sehr den amerikanischen Männern die Arbeit ausgeht und sie damit immer mehr zum sozialen Problem werden. In ihrem Buch mit dem bezeichnenden Titel „Das Ende der Männer und der Aufstieg der Frauen“, das auch bei uns ein Bestseller war, analysiert Hannah Rosin den epochalen Niedergang amerikanischer Männlichkeit. Während der grossen Rezession ab 2007 waren drei Viertel der 7,5 Millionen Entlassenen Männer, 2009 zum ersten Mal mehr Frauen erwerbstätig als Männer. Bereits mehr als ein Drittel der amerikanischen Mütter sind die Haupternährer ihrer Familien – Tendenz steigend. Die Konsequenz: ein drastischer Rollenwechsel. „Überall, wo ich hinkam, passten sich Paare an die neue häusliche Realität an: Die Frau zahlt die Hypothek ab. Die Frau fährt jeden Tag zur Arbeit und gibt dem Mann vorher noch schnell Anweisungen, wie er die Wäsche machen muss“.

Auch in Deutschland gibt es viele junge „Abgehängte“. Die Jugendstudie „Generation What“ weist soeben auf eine grosse Gruppe junger Männer hin, „die sich extrem benachteiligt und orientierungslos fühlt“ und so zunehmend „anfällig für Populismus“ ist. Davor haben weitsichtige Soziologen wie Ralf Dahrendorf schon vor rund dreissig Jahren gewarnt, ohne gehört worden zu sein. Hatte Dahrendorf noch überschaubare Gruppierungen von „angry young men“ in Grossbritannien beschrieben, gibt es inzwischen ganze Stadtviertel, die von diesen „Aussteigern“ geprägt werden, wie z.B. das „Berlin-Institut für Bevölkerung und Entwicklung“ in seiner Studie „Not am Mann“ festgestellt hat.

Männer sind aber nicht nur die Verlierer auf dem Arbeitsmarkt, sondern bereits dort, wo in Schulen und Ausbildung für die späteren Berufsqualifikationen vorbereitet wird. Ihre Bedürfnisse werden zunehmend ignoriert, ihre Leistungen bei gleicher Qualität wie die der Mädchen schlechter benotet, ihre Versetzungen in höhere Schulstufen oder Klassen erschwert. Schulversager, Schulabbrecher, Schulschwänzer sind heute fast ausschliesslich männlich.

Die amerikanische Philosophien Christina Hoff-Sommers, selber Feministin, spricht in ihrem gleichnamigen Buch vom „Krieg gegen die Jungen“. Das mag übertrieben sein, aber Tatbestand ist, dass Jungen in Kindergärten, Horten, Ganztagseinrichtungen, Schulen und Beratungsinstanzen ständig an weibliche Verhaltensmuster und Grenzsetzungen stossen. In ihrer Motorik und Renitenz drücken sie dann häufig ihren Widerstand gegen die Erziehungseinrichtungen als weibliche Bastionen aus. Sarkastisch notiert Hoff-Sommers, dass Tom Sawyer und Huckleberry Finn heute in der Frauenschule Ritalin verordnet bekämen, um ruhiggestellt zu werden.

Jungen sind zum Problemgeschlecht geworden. Gewalt und Ausschreitungen haben signifikant zugenommen. Psychische und psychosomatische Störungen treten bei Jungen sehr viel häufiger auf als bei Mädchen. Der Anteil von Jungen in Förderschulen beträgt zwei Drittel; dreimal so viele Jungen wie Mädchen sind heute Klienten von Erziehungsberatungsstellen. Alkohol- und Drogenprobleme von Jungen nehmen zu; die zweithäufigste Todesursache von Jungen ist der Suizid, wobei sich Jungen mindestens sechsmal häufiger selber umbringen als Mädchen im gleichen Alter. William Pollack, Psychologieprofessor an der Harvard Medical School merkt dazu an, dass die Gesellschaft schon längst Massnahmen ergriffen hätte, wenn die Suizidrate bei Mädchen vergleichbar gross wäre.

Die dramatisch verschlechterten Bedingungen haben ihre Folgen für Beziehung und Familie. In ihrem Buch „Men on Strike“ bemerkt Helen Smith, dass die Heiratsrate in den USA auf den niedrigsten Stand aller Zeiten gefallen ist. Kay Hymowitz interpretiert diese Entwicklung in ihrer Untersuchung „Manning Up: How the Rise of Women Has Turned Men into Boys“ als permanente Adoleszenz-Krise unreifer Männer. Das kann man auch anders sehen. „Warum sollte ein Mann eine Familie gründen wollen?‘ fragte ein junger Mann vor einer Weile im Berliner Stadtmagazin Zitty.

Männer können ohne Familie „wunderbar leben“. Nachdem Männern über Jahrzehnte erzählt worden ist, „sie seien überflüssig, gewalttätig, dumpf und sowieso ein Irrtum der Natur“, sei es doch „kein Wunder, dass sie keine Stützen der Gesellschaft werden wollen. Warum sollten sie denn?“ Das ist nun kein abwegiges Statement aus der Hauptstadt; es ist ein Trend. Das Statistische Bundesamt konstatiert in seinen Report ‚Alleinlebende in Deutschland‘, dass 27 Prozent der 18- bis 34-Jährigen Männer ohne Bindung leben. 60 Prozent der alleinlebenden Männer im Alter von 35 bis 64 Jahren waren noch nie verheiratet. Das sind – in absoluten Zahlen – cirka 7 Millionen Männer.

Es hat in Deutschland die feministische Aufschrei-Debatte gegeben. Der Aufschrei der Männer ist wohl anders: Verweigerung. Das attestiert auch eine Sinus-Studie über „Lebensentwürfe, Rollenbilder und Haltungen zur Gleichstellung 2o-jähriger Frauen und Männer. Tatsächlich fehlen seit langem Männerbilder, an denen sich Heranwachsende konstruktiv abarbeiten könnten. Das fällt schwer. Im Internet kursiert zum Beispiel ein Video, in dem eine Kriminologin die Forderung erhebt, die männliche Bevölkerung auf einen Anteil von 10 Prozent zu reduzieren. Männer störten nur das Gleichgewicht der Welt. Dagegen haben amerikanische Mütter das Manifest formuliert: „How Male Bashing is Killing Our Sons“. Sie beschreiben eindringlich, wie die „ständige Herabsetzung von Männlichkeit“ die Entwicklung ihrer Söhne lähme.

Mario Sixtus

Kulturhistorisch waren Männer früher der Speicher für Avantgarden; heute sind Männer – wie alle empirischen Untersuchungen ausweisen – überwiegend retrograd. Sie orientieren sich am Gestern, weil ihnen die Zukunft abhandengekommen ist. So sind sie inzwischen auch das Arsenal rechter Politik – ob „Front National“, FPÖ, AfD oder SVP. Es gäbe also genug der Gründe, sich an ein Umdenken über die reale Wertigkeit des Männlichen zu wagen.

Ganz simpel betrachtet ist die tägliche Funktionsfähigkeit unserer Gesellschaft von Arbeiten abhängig, die Männer machen und Frauen gar nicht machen wollen: Müllabfuhr, Entsorgung, Tiefbau, Gummiverarbeiter, Strassenfeger oder Abwasserreiniger. Männer gehen auch den gefährlichsten Tätigkeiten nach, im Hochbau zum Beispiel, bei der Gefahrengüter-Beseitigung, als Dachdecker oder Gleisbauer, im Sicherheitswesen, bei der Feuerwehr, im Katastrophenschutz. Das Verhältnis von männlichen zu weiblichen Opfern bei den Einsätzen von Polizei, Feuerwehr, Notärzten, Sanität, Katastrophendiensten oder technischem Hilfswerk beträgt 98:2. Bei den Rettungsaktionen in Tschernobyl und am 11. September in New York sind ausschliesslich männliche Helfer gestorben.

Es sei höchste Zeit, notiert Elisabeth Badinter, Philosophin und Feministin, männliche Tugenden wieder zu loben. Ihre Namen lauten Selbstbeherrschung, der Wille, über sich selbst hinauszuwachsen, die Bereitschaft, Risiken einzugehen, sich Herausforderungen zu stellen und der Unterdrückung Widerstand zu leisten. Sie sind die Voraussetzungen von Kreativität, aber auch von Würde». Das hat nichts mit Androzentrismus zu tun.

Auszug aus dem Buch „Das Gären im Volksbauch. Warum die Rechte immer stärker wird“. NZZ Libro, Basel 2019. 208 S. ca. 25.00 SFr. ISBN: 978-3-03810-477-3

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————–

Grafikquellen        :

Oben       —    SCAF took one sniff of freedom of speech and HATED it!

Source http://twitpic.com/6669a2
Author Carlos Latuff

This work has been released into the public domain by its author, Carlos Latuff. This applies worldwide.

——————————

Unten        —             Mario Sixtus (CC BY-NC-SA 2.0 cropped)

Abgelegt unter Bildung, Bücher, International, Politik und Netz | Keine Kommentare »

Gedanken-Industrieumbau!

Erstellt von DL-Redaktion am 25. Januar 2020

Den Umbau der Industriegesellschaft angehen: Teil 1

Quelle       :       Scharf  —  Links

Von Edith Bartelmus-Scholich und Dr. Nikolaus Götz

Und auf vorgeschriebenen Bahnen

Zieht die Menge durch die Flur;

Den entrollten Lügenfahnen

Folgen alle. –Schafsnatur!

Johann Wolfgang von Goethe, Faust II

Seit mehr als 40 Jahren reden die Verantwortlichen unserer Industriegesellschaft über den ökologischen Umbau der Industriegesellschaft zur Verbesserung der tagtäglichen Produktion auf dem ’Raumschiff Erde’. Doch anstatt wie von Forschung und Wissenschaft gefordert auf ’Wiederverwendung’, ’Recycling’ oder auf ’Nachhaltigkeit’ zu setzen, zieht es überwiegend die produzierende ’Industrie’ immer noch vor, ’kostengünstigere’ Wegwerfprodukte zu produzieren. Auch die Mehrzahl der politisch Verantwortlichen wendet sich ignorant von dem Problem ab.

So sind in der Konsumindustrie die Präsentationsregale in den Geschäften auch heute noch zu 99% mit Produkten in Wegwerfverpackungen gefüllt und falsch angewendete Hygienevorschriften bei Fleisch- oder anderen Frischartikeln verhindern oftmals den geringsten Käuferwillen auf beispielsweise mitgebrachte wiederverwendbare Einkaufsdosen oder Tragetaschen. In der modernen Massengesellschaft kauft der Konsument zwangsläufig die im ’Discounter’ angebotene Produktpalette ohne weiter darüber nachzudenken, dass er sich durch den Kauf des industriellen ’Mülls’ als Mensch selbst vernichtet. Nach 40 Jahren (fast) industrieller Untätigkeit fordert nun eine neue Generation mit Greta Thunberg und ihren „Fridays For Future“ endlich den „ökologischen Umbau der Industriegesellschaft“ nachdringlich ein, nachdem es heute nachweislich in den Weltmeeren mehr Plastikreste als Fische gibt.

Doch zu einem solchen nun erneut lautstark geforderten ökologischen Umbau haben die mehrheitlich rein ’kapitalistisch’ organisierten Industrieunternehmen, die finanzielle Vorleistungen zu leisten hätten, keine Lust. Und wie die langjährigen ’Erpressungsstrategien’ in der Atomindustrie, der Autoindustrie wie in der gerade betroffenen ’Kohleindustrie’ zeigen, knicken fast alle politisch Verantwortlichen ein, wenn sie den Industriemanagern Produktionsauflagen mit einer „realen“ Kostenrechnung unter Einbezug der gesundheitlichen wie der ökologischen Schäden, der echten Energiekosten wie dem verursachten Ressourcenverschleiß für deren Produktion auferlegen wollten. Das Totschlagsargument dieser ’Herren wie Damen’ ist stets das Argument der „Sicherung von Arbeitsplätzen“!

Zur Erinnerung: Die kritisierte ’Atomindustrie’ und deren Manager haben jahrzehntelang staatliche Forschungsgelder abgegriffen, dann in einer relativ kurzen Laufzeit der AKWs die individuelle Profitmaximierung gepredigt und so ihren Managern Millionen zugeschustert, um endlich die ’Wiederaufbereitung’ wie die ’Endlagerung’ des Atommülls „dem Volk“ aufzuerlegen. Seit 2019 sind so nun aufgrund des ’gelungenen Staatsdeals’ die Bürger „strahlender“ Besitzer des angereicherten hochgiftigen Atommülls! Prima gemacht CDU/SPD/FDP/usw.!

Und wie wird gerade der Kohle- der Braunkohleausstieg abgewickelt? Auch hier verlagert die ’Industrie’ die letztendliche Verantwortungskompetenz von ihren ’unwissenden’ aber streng ’kapitalistisch’ argumentierenden Managern nun auf die Politiker, oftmals vorab bestochen durch den gesetzlich gestatteten Lobbyismus. Und jetzt muss „die Allgemeinheit“ erneut für die „armen Industriellen“ zahlen! Auch diese Hypothek einer ausufernden Schreckensbilanz der anti-ökologischen Wirtschaftsproduktion unseres Wirtschaftssystems wird von den zukünftigen Generationen getragen werden müssen.

Geely assembly line in Beilun, Ningbo.JPG

Die heutigen FFF’s kennen jedoch aufgrund ihres jugendlichen Alterns wahrscheinlich nicht den deutschen Denker Erich Fromm, der 1976 in seinem Werk ’Haben oder Sein’ schon treffend in seiner Einführung „Gibt es eine Alternative zur Katastrophe“ der bevorstehenden ökologischen Krise formulierte: „Alle zitierten Daten sind der Öffentlichkeit zugänglich und weithin bekannt. Die nahezu unglaubliche Tatsache ist jedoch, dass bisher keine ernsthaften Anstrengungen unternommen wurden, um das uns verkündete Schicksal abzuwenden. Während im Privatleben nur ein Wahnsinniger bei der Bedrohung seiner gesamten Existenz untätig bleiben würde, unternehmen die für das öffentliche Wohl Verantwortlichen praktisch nichts, und diejenigen, die sich ihnen anvertraut haben, lassen sie gewähren“ (Fromm, Erich: Haben oder Sein, München 1979, S. 24).

Die Zeit ist überreif für eine neue Aufbereitung und Ausarbeitung konkreter kleiner Schritte hin zu einem ökologischen Umbau der Industriegesellschaft. Deshalb ruft die Internet-Zeitung scharf-links.de ihre Leserschaft auf, sich als Autor, sich als Multiplikator zu betätigen und konkrete Verbesserungsschritte für die vielen Einzelbereiche eines zukünftig zu bewältigenden Umbaues der Wirtschaft vorzustellen.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————–

Grafikquellen       :

Oben         —          Bilmontör vid Fords Kansas City Assembly Plant (2008).

———————————-

Unten      —       Car assembly line of Geely in Beilun District, Ningbo

Abgelegt unter Arbeitspolitik, Bildung, Deutschland, Umwelt | Keine Kommentare »

Neubauer vs. Siemens

Erstellt von DL-Redaktion am 18. Januar 2020

In welchen Arsch wir treten müssen

Mauricio Macri & Joe Kaeser Davos 2018.jpg

Seht nach Davos – dann wird jeder Käse zum Klos.

Von Peter Unfried

Luisa Neubauer geht auf Siemens los, weil der Konzern ein umweltschädliches Projekt in Australien beliefert. Worum es dabei wirklich geht.

Es war ein beklemmender und zugleich aufklärerischer Moment, als ­Luisa Neubauer und Hans-Christian Ströbele bei der gemütlichen Geburtstagsfeier zum 40./30. von Grünen bzw. Bündnis 90 aneinander vorbeiredeten. Der letzte 68er Cowboy der universalen Dagegenkultur erzählte noch mal, wie schwer sie es 1968 ff. gehabt („Alle waren gegen uns“) und wie toll sie das hingekriegt hätten. Wie leicht dagegen habe es Fridays for Future heute („Fast alle sind für euch“).

Na ja. Klimapolitikaktivistin Neubauer gratulierte höflich, erklärte vorsichtshalber noch mal, dass FFF die liberale Demokratie und ihre Institutionen verteidige, und merkte nur in einem Nebensatz an, dass sie selbst eben „keine 30, 40 Jahre“ Zeit hätten. Was sie nicht sagte: für das, was die tollen Grünen liegen gelassen haben. Eine politische Bewältigung der Klimakrise.

Gut, Feiern sind Feiern, aber die Festrede von Bundespräsident Steinmeier war von einer fröhlichen Problemferne. „Ökologie und Nachhaltigkeit sind zum Maßstab der Politik geworden“, sagte er. Der Satz ist in etwa so zutreffend, als hätte er gesagt: In Deutschland gibt es keine Nazis mehr, hurra. Nur dass er dann erledigt gewesen wäre.

FFF Berlin 2019-03-29 246.jpg

Neubauer, 23, wird mittlerweile auch dafür kritisiert, dass sie den Erfolg von Fridays knallhart mit der klimapolitischen Realität vergleicht und nicht nur in den Denkmustern von Symbolpolitik oder medialer Aufmerksamkeit misst. Ja, es hätte kein Klimapaket gegeben ohne Fridays. Das ändert nichts daran, dass dieses zusammengehudelte Dingsbums der Bundesregierung so viel hilft wie ein Pflaster gegen Lungenkrebs.

Dick dabei: Kohle und Öl

Es tut sich etwas, ja. Vielleicht auch in großen Unternehmen. Aber Tempo machen jetzt diejenigen, deren Geschäftsmodelle durch ernsthafte Klimapolitik enden. Für sie geht es darum, möglichst schnell noch möglichst viel CO2-Ausstoß zu verursachen. Ganz dick dabei: Kohle und Öl.

Quelle        :          TAZ         >>>>>           weiterlesen

———————————————————————-

Grafikquellen          :

Oben         —       Mauricio Macri alongside Joe Kaeser in Davos, January 2018

———————-

Unten      —          Fridays for future, Berlin, 2019-03-29

Abgelegt unter APO, Bildung, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Frag nie, wo du herkommst

Erstellt von DL-Redaktion am 16. Januar 2020

Kontertext: Sage mir, woher du kommst …

File:Moschee Wangen bei Olten.jpg

Quelle         :        INFOsperber CH.

Von  Alfred Schlienger

Wie wird in unseren Medien über Ausländer berichtet? Und wo beginnt Diskriminierung? Medienforscher schenken klaren Wein ein.

«Früher war ich wegen meines Nachnamens ein Jugo;
heute bin ich wegen meines Vornamens ein Muslim.»

Es sollte inzwischen ein Gemeinplatz sein: Medien bilden nicht einfach die Wirklichkeit ab; sie folgen vielmehr eigenen Medienlogiken, geben ihren Geschichten einen spezifischen Spin, prägen durch Auswahl, Intensität, Gewichtung und Tonalität unsere Wahrnehmung der Welt massgeblich mit. Die Problematisierung des Fremden ist dabei seit langem ein beliebter Topos.

Auf Einladung von Fairmedia, der Beratungsstelle für fairen Journalismus, stellte der Zürcher Medienforscher Patrik Ettinger kürzlich in Basel seine Studie zur «Qualität der Berichterstattung über Muslime in der Schweiz» vor. Anhand repräsentativer Stichproben, erhoben von 2009 bis 2017 aus 1488 Artikeln in 18 Printmedientiteln (und den zugehörigen Newssites) in allen Landesteilen, kommt er zu so trockenen wie erhellenden Einordnungen und Befunden, an die man sich als Medienschaffender und auch als kritischer Medienkonsument halten kann – oder könnte, wenn man wollte. Hier eine Auswahl:

Gefordert sind Vielfalt und Rationalität

  • Die Qualität der Berichterstattung bemisst sich an ihrer Vielfalt (bezüglich thematischer Aspekte, Akteuren und Argumenten sowie der Vermeidung von Pauschalisierungen) und an ihrer Rationalität (sachlicher Stil und Vermittlung von Hintergrundinformationen).
  • Die Intensität der Berichterstattung wird einerseits durch Terroranschläge im europäischen Ausland beeinflusst; nach solchen Anschlägen wird mehr als doppelt so häufig über Muslime in der Schweiz berichtet. Wenn in den untersuchten Schweizer Printmedien über Muslime berichtet wird, so betrifft das zu rund vier Fünftel Muslime im Ausland. Andererseits können politische Akteure durch Kampagnen im Vorfeld von Volksinitiativen regelmässig eine Intensivierung der Berichterstattung herbeiführen.
  • Seit 2015 zeigt sich eine zunehmende Konzentration auf die Themen «Radikalisierung» und «Terror» (2014: 37 Prozent; 2017: bereits 54 Prozent). Dagegen bleiben die Themen «gelingende Integration» (2 Prozent) und «Alltag» (2 Prozent), die die Lebenswelt der Mehrheit der Musliminnen und Muslime in der Schweiz spiegeln, in der Berichterstattung marginal.
  • Der Anteil der Beiträge, deren Tonalität Distanz gegenüber muslimischen Akteuren in der Schweiz erzeugt, wächst kontinuierlich zwischen 2009 und 2017 von 22 Prozent auf 69 Prozent. Dies erklärt sich teilweise mit der erwähnten Verschiebung der Aufmerksamkeit auf Themen wie «Radikalisierung», «Terror» und «gefährdete Integration». Allerdings zeigen sich im Vergleich der Medientitel deutliche Unterschiede, die auf unterschiedliche redaktionelle Strategien zurückzuführen sind und Handlungsspielräume im Umgang mit dem Thema aufzeigen: In der «Weltwoche» weisen – so erschreckend wie wenig überraschend – satte 84 Prozent der Beiträge einen Distanz erzeugenden Tenor auf; in Boulevardzeitungen wie «SonntagsBlick» und «Blick» 63 Prozent resp. 59 Prozent und in Abonnementszeitungen wie «NZZ» und «Le Temps» 31 Prozent.

Die giftige Mischung: Distanz erzeugend und pauschalisierend

  • Eine Distanz erzeugende Berichterstattung ist dort problematisch, wo sie mit Pauschalisierungen verknüpft wird. Denn Pauschalisierungen negieren die Pluralität der muslimischen Minderheit in der Schweiz und konstruieren stattdessen eine homogene Gruppe. Damit werden alle Muslime in der Schweiz für das Verhalten Einzelner verantwortlich gemacht. Solche pauschalisierenden Verknüpfungen finden sich in 8 Prozent der Beiträge – und auch hier weisen «Weltwoche» (48 Prozent) und die Boulevardzeitungen «SonntagsBlick» (24 Prozent) und «Blick» (11 Prozent) überdurchschnittlich hohe Werte auf.
  • Die Vielfalt der Akteure und Argumente wurde anhand der drei Fallstudien «Verhüllungsverbot im Tessin», «Handschlagaffäre Therwil» und «An’Nur-Moschee» untersucht. Insgesamt ist die Verteilung der Akteurskategorien relativ vielfältig. Neben den Medien (27,5 Prozent der erfassten Argumente) kommen muslimische Akteure (24 Prozent) sowie politische Akteure der Exekutive (12,1 Prozent) und der Legislative resp. Parteien (14,9 Prozent) prominent zu Wort. Und auch Vertreter der Zivilgesellschaft (9 Prozent) und Experten (9,5 Prozent) können ihren Argumenten in der Berichterstattung Gehör verschaffen.
  • In der Berichterstattung über Muslime in der Schweiz bleiben die Betroffenen, d.h. muslimische Akteure, überwiegend Berichterstattungsobjekte. In 55 Prozent der Beiträge wird über sie geschrieben, ohne dass sie selbst zu Wort kommen, in weiteren 25 Prozent kommen sie nur am Rande des Beitrags zu Wort. In nur gerade 7 Prozent der Artikel in den drei Kommunikationsereignissen sind Muslime ausschliesslich oder mehrheitlich Subjekt, d.h. können ihre Deutung der Ereignisse dominant vertreten.
  • Dort wo Muslime zu Wort kommen, geschieht dies häufig in einem polarisierenden Setting. Hohe Resonanz erzielen wenige Exponenten der An’Nur-Moschee und des IZRS einerseits und anderseits Saïda Keller-Messahli, die sich als Kritikerin der muslimischen Dachverbände in der Schweiz etabliert. Vertreter dieser Dachverbände kommen dagegen eher selten zu Wort.

Episodisch oder in Hintergründe einordnend?

  • Die Berichterstattung über Muslime in der Schweiz ist überwiegend durch ein episodisches Framing gekennzeichnet (84 Prozent); eine Einordnung, die im Sinne eines thematischen Framings Hintergründe vermittelt und Ursachen-Wirkungs-zusammenhänge diskutiert, findet sich nur in 16 Prozent der Beiträge.

  • Differenziert man die Anteile einer Hintergründe vermittelnden Berichterstattung nach der Tonalität (Distanz vs. Empathie), so zeigt sich, dass die Beiträge mit einer Distanz erzeugenden Tonalität unterdurchschnittlich häufig auch ein thematisches Framing aufweisen (13 Prozent), während die Beiträge mit einer Empathie erzeugenden Tonalität deutlich überdurchschnittlich einordnend sind (29 Prozent). Vor dem Hintergrund der Erwartung, dass Kritik an Minderheiten begründet werden soll, ist dieser Befund bedenklich.
  • Die Vermittlung von Hintergrundinformationen bedeutet jedoch noch nicht, dass damit auch die Vielfalt der durch einen Medientitel vermittelten Argumente erhöht wird. Dies zeigt sich deutlich im Vergleich von «Weltwoche» und «Le Temps», die beide eine ausgeprägt thematische Berichterstattung pflegen. Während unter den 40 Prozent thematischen Beiträgen in der «Weltwoche» 38 Prozent monokausal sind, d.h. die Hintergrundinformationen auf einen einzigen Argumentationsstrang resp. eine These hin orientieren, sind die Hälfte der insgesamt 32 Prozent Beiträge in «Le Temps», die Hintergrundinformationen vermitteln, polikausal, d.h. in ihnen werden divergierende Argumente diskutiert und unterschiedliche Ursachen für Problemlagen eruiert.

Im Fazit hebt die Studie diese drei Bereiche als besonders problematisch heraus:

  1. Die starke Konzentration auf die Themen Radikalisierung und Terror seit 2015. Hier scheint bei einigen Zeitungen eine durch die Aufmerksamkeitsökonomie getriebene Verengung der Berichterstattungsfoki vorzuliegen.
  2. Die starke Zunahme der Distanz erzeugenden Berichterstattung. Eine überwiegend oder fast ausschliesslich negative Aspekte betonende und Distanz gegenüber den Muslimen in der Schweiz erzeugende Berichterstattung ist der vielfältigen Lebenswirklichkeit von Musliminnen und Muslime in der Schweiz nicht angemessen.
  3. Die Distanz erzeugende Berichterstattung, wenn sie mit Pauschalisierungen verbunden wird, d.h. wenn negative Typisierungen undifferenziert auf alle Muslime in der Schweiz bezogen werden. Diese Form der Berichterstattung ist – auch nach den Standesregeln der Journalistinnen und Journalisten selbst – als diskriminierend zu bezeichnen.

Der Gender-Gap auf dem Podium

An das Referat von Patrik Ettinger schloss sich in Basel eine lebhafte, von Jessica King, Geschäftsführerin von Fairmedia, geleitete Podiumsdiskussion an mit den journalistischen Profis Nina Fargahi, Chefredaktorin des Medienmagazins «Edito», Stefan Hohler, langjähriger Polizeireporter beim «Tages-Anzeiger», Min Li Marti, Verlegerin und Chefredaktorin der Wochenzeitung «P.S.» und SP-Nationalrätin, sowie Balz Rigendinger, Leiter Swissinfo.ch.

Die Diskussion drehte sich anhand aktueller Beispiele zentral um die Frage: Wie sinnvoll bzw. notwendig ist die Nennung der Nationalität bei Verbrechensmeldungen? Auffällig war die Geschlechterkluft auf dem Podium bei der Beantwortung dieser Frage. Die wichtigsten Punkte:

Ausländerkriminalität – ein Schichtenproblem

  • Die beiden Männer vertreten entschieden die Meinung, man müsse eben die Fakten bringen, man wolle keine Zensur und keine Schere im Kopf; Geschlecht, Nationalität, Alter seien zentrale Indikatoren bei der Berichterstattung über Verbrechen. Kriminalität sei nun mal zu grossen Teilen ein Ausländerphänomen, und das müssten die Medien abbilden. Rigendinger: «Medien bilden das Gleiche ab, das in den Köpfen der Konsumenten abgeht.»
  • Das schien den beiden Frauen dann doch etwas zu schlicht gedacht. Sie finden, die Nationalität werde oft sehr isoliert ins Spiel gebracht und aufgebauscht. Das schüre Ressentiments und schaffe einen Generalverdacht. Es fehle eine ganzheitliche Betrachtung. Es gehe auch nicht nur um Fakten, sondern um Relevanz. Die Schuhgrösse sei auch ein Faktum, aber eben nicht relevant. Medienschaffende müssten sich zuerst genauer Gedanken machen, ob die Herkunft direkt etwas mit der Tat oder dem Tatverdacht zu tun habe.
  • Zudem: Statistisch seien vor allem junge Männer kriminell. Wenn man die Risikofaktoren für Kriminalität betrachte, sei klar erkennbar, dass sie im Kern ein Schichtenproblem sei. Sobald man die entsprechenden Indikatoren einbeziehe, verschwänden die Unterschiede zwischen Ausländern und Schweizern bezüglich Kriminalität weitgehend. Aber durch die entsprechende Berichterstattung der Medien würde der Anteil der Ausländerkriminalität von der Bevölkerung massiv überschätzt.
  • Ein interaktiver Link des «Tages-Anzeigers» zeigt: Die durchschnittliche Leserschätzung der Kriminalitätsrate von Ausländern ist fast 12 mal höher als in Wirklichkeit (Ausländerkriminalität geschätzt: 25,6 Prozent / real 2,2 Prozent). (Siehe Link unten sowie auch die Studie von Prof. Ben Jann, Uni Bern, und die weiteren Artikel-Links am Schluss dieses Textes.)
  • Balz Rigendinger: Menschen bildeten ihre Identität über ein Differenzbewusstsein. Ausgrenzungsverhalten sei also quasi ein Naturgesetz: «So funktioniert der Mensch.» Dass aber Klickzahlen durch reisserische Schlagzeilen auf Kosten von Ausländern hochgepusht würden, das kenne er nicht. «Wenn das der Fall wäre, dann wäre es Hetze.»

Wie weit ist es her mit der Selbstreflexion der Medien?

Nina Fargahi weist darauf hin, dass heute in der Schweiz 37 Prozent Ausländer leben, aber nur etwa 3 bis 5 Prozent der Journalistinnen und Journalisten einen Migrationshintergrund haben. Hier wäre mehr Diversität dringend geboten, um in den Medien ein ausgewogeneres Bild der Gesellschaft zu repräsentieren.

20060318 Australia NSW Sydney AntiWarProtest MuslimWomen.jpg

Gegen Schluss schaltet sich auch der Referent Patrik Ettinger nochmals in die Debatte ein. Ob die Medien die Realität abbilden oder selber schaffen, sei die falsche Frage. Es gehe schlicht darum, dass Medienschaffende sich vermehrt und immer wieder fragen: Welchen Teil der Wirklichkeit bilde ich hier ab? Mit welcher Brille (weltanschaulich, biografisch etc.) betrachte ich diese Realität? Welche Voraussetzungen und Ressourcen (Zeitmangel, Kompetenzen zur Einordnung) stehen mir zur Verfügung? Es gehe ganz wesentlich um diese ständige, auch medienethische Selbstreflexion des eigenen Tuns.

Die Fairmedia-Veranstaltung bot genau dafür eine kompetente und spannende Plattform. Soweit ich es überblicke, hat bis heute kein einziger Journalist und kein Medium darüber berichtet. Medienforscher werden oft als Störenfriede und Nestbeschmutzer betrachtet. Das ist mehr als töricht. Kompetente Qualitätskontrolle sollte zu den ureigensten Interessen der aktuell von so vielen Seiten bedrängten Medienbranche gehören.

Wer noch ein paar Zahlen und Einblicke mehr zu dieser Thematik verträgt, dem seien die folgenden Links empfohlen:

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Alfred Schlienger, Theater- und Filmkritiker, u.a. für die «Republik»; ehem. Prof. für Literatur, Philosophie und Medien an der Pädagogischen Hochschule; Mitbegründer der Bürgerplattform Rettet-Basel!; lebt in Basel.

Unter «kontertext» schreibt eine externe Gruppe Autorinnen und Autoren über Medien und Politik. Sie greift Beiträge aus Medien auf und widerspricht aus politischen, journalistischen, inhaltlichen oder sprachlichen Gründen. Zur Gruppe gehören u.a. Bernhard Bonjour, Rudolf Bussmann (Redaktion, Koordination), Silvia Henke, Mathias Knauer, Guy Krneta, Alfred Schlienger, Felix Schneider, Linda Stibler, Martina Süess, Ariane Tanner, Rudolf Walther, Christoph Wegmann, Matthias Zehnder.

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

————————————————————–

Grafikquellen        :

Oben         —           Moschee des Türkischen Kulturvereines Olten in Wangen bei Olten

Author Nadf       —          Source      :    Own work

I, the copyright holder of this work, release this work into the public domain. This applies worldwide.
In some countries this may not be legally possible; if so:

——————–

2.) von Oben          —          Die 1963 eröffnete Mahmud-Moschee in Zürich, die erste Moschee der Schweiz

————————————–

Unten      —       20060318 Australia NSW Sydney AntiWarProtest MuslimWomen

 

Abgelegt unter Bildung, International, Kultur, Religionen | Keine Kommentare »

Die Greta-Krise

Erstellt von DL-Redaktion am 15. Januar 2020

Ein Appell zum Aushalten von Widersprüchen

Ein Schlagloch von Georg Seeßlen

Wie ist es möglich, so viel Aufmerksamkeit und Zustimmung zu erzeugen – und trotzdem ändert sich nichts? Ein Appell zum Aushalten von Widersprüchen

Greta Thunberg ist eine kluge junge Frau. Nicht bloß im Verhältnis zu ihren Kritikern, deren Strunzdummheit nicht nur aus Strammrechts- und FDP-Lautsprechern dröhnt, sondern in Form von, nun ja, „Kabarett“ auch im öffentlichen Fernsehen versendet wird – ungefähr so lustig wie ein Grillabend beim Ortsvereinsvorsitzenden der AfD von Niedertrachtlingen. Von klugen Menschen kann man, taz-Leserinnen und -Leser werden es wissen, einiges verlangen; grenzenloser und naiver Optimismus gehört nicht unbedingt dazu.

Daher ist die doppelte Aussage von Greta Thunberg in Bezug auf die „Klimabewegung“ – Wir haben viel erreicht! Und: Wir haben (beinahe) nichts erreicht! – eine sehr genaue Beschreibung des derzeitigen Status: Öffentlichkeit wurde hergestellt, das Bewusstsein erweckt, Diskurse wurden begonnen. Doch in der Praxis ist davon kaum etwas angekommen. An auch ökologisch entscheidenden Machtpositionen schalten Menschen, denen Klima, Umwelt und Natur wurst sind. Solange die Nationen im Wettbewerb miteinander stehen und Wirtschaftskriege gegeneinander oder Wirtschaftsbündnisse gegen Menschen und Landschaften führen, verlaufen alle Versuche, die Probleme in größerem Zusammenhang anzugehen, im Sand. Was die Ökologie anbelangt, hat sich also eine neue Schere aufgetan: die von öffentlichem Gerede und wirklichem Handeln. Nicht neu, das.

Was aber mag es sein, was zwischen Reden und Handeln vermittelt, einmal im Sinn von Umsetzung, das andere mal im Sinn von Verhinderung? Es gibt ein schmutziges Wort dafür: Politik. Und was gerade mit der Klimabewegung passiert, zwischen der künstlichen Aufregung über ein „Oma“-Lied und einer juristischen Kampagne gegen Organisationsformen der demokratischen Zivilgesellschaft, ist unter anderem Ausdruck einer Krise, die für jede soziale Bewegung unausweichlich ist. Spätestens beim Erreichen des Punktes, an dem Vernunft und Moral an die Interessen von Macht und Kapital rühren. Die Frage tut sich auf: Wie ist es möglich, so viel Aufmerksamkeit, ja sogar so viel Zustimmung zu erzeugen – und trotzdem ändert sich nichts? Wer oder was macht so was? Um den Verlust der politischen Unschuld kommt niemand herum. Weder eine Person noch eine Bewegung.

Man sollte daher die Doppelaussage „Wir haben viel erreicht“ und „Wir haben nichts erreicht“ nicht als Eingeständnis des Scheiterns ansehen, sondern als Zäsur. Wenn es weitergehen soll, müssen die Protagonisten und Sympathisanten der Klimabewegung erkennen, dass die Zeit der „vor-politischen“, der moralischen, wissenschaftlichen und appellativen Aktivität vorbei ist. Was in der Aufmerksamkeitsökonomie und in der Symbolsprache der Personalisierung erreicht werden konnte, wurde erreicht. Nun schlägt das Imperium zurück, und die Rebellen drohen an Erschöpfung oder Hysterisierung zugrunde zu gehen.

Doch könnte das Ende einer „Welle“ des Widerstands durchaus auch Vorbereitung einer zweiten Welle sein. Ein Bindeglied dafür mag vielleicht Antonio Gramscis Aufforderung sein, in sich einen Pessimismus des Geistes und einen Optimismus des Handelns zu vereinen. Und das ist nicht der einzige Widerspruch, den man auszuhalten lernen muss.

Quelle          :        TAZ         >>>>>        weiterlesen

——————————————————————

Grafikquellen         :

Oben         —      Stockholm (August 2018)

————————

Unten         —        Georg Seeßlen während seines Vortrags beim „Kölner Kongress 2017“

Abgelegt unter Bildung, Flucht und Zuwanderung, Medien, Umwelt | Keine Kommentare »

Die Jugend im Iran

Erstellt von DL-Redaktion am 15. Januar 2020

Bagdad und die Wut der Jugend

Tehran Bazaar protests 2018-06-25 03.jpg

Von      von Feurat Alani

Nach der Tötung von Qassem Soleimani, dem Kommandanten der iranischen Al-Quds-Einheiten, durch eine US-Drohne Anfang Januar droht der Irak endgültig zum Schlachtfeld der Konfrontation zwischen den USA und Iran zu werden. Dabei richteten sich die Proteste der jungen Generation seit Oktober 2019 gerade auch gegen den Einfluss aus Teheran und Washington.

Die Bilanz ist schrecklich. Über 500 Tote und mehr als 20 000 Verletze zwischen dem 1. Oktober 2019 und Anfang Januar 2020. Vom Tahrir-Platz im Herzen Bagdads bis zu den Städten im Süden des Landes lehnen sich die Menschen gegen die Regierung und die sie stützenden Milizen auf. Sie fordern das Ende des Systems, das 2003 installiert wurde – nachdem Diktator Saddam Hussein in Folge der Invasion US-amerikanischer Truppen und ihrer Verbündeten, allen voran die Briten, gestürzt worden war.

Der Dialog zwischen den Demonstranten und den politischen Machthabern ist völlig zum Erliegen gekommen. Seit dem Rücktritt von Ministerpräsident Adel Abdel Mahdi am 29. November 2019 ist die herrschende Klasse taub für die Forderungen der Jugend und sucht nach einem neuen Regierungschef. Junge Aktivisten werden reihenweise ermordet oder entführt; selbst nach dem Blutbad vom 6. Dezember, der damit endete, dass in einem Parkhaus, das als Versammlungsort genutzt wurde, 20 Demonstranten von unbekannten Milizionären getötet wurden.1

Alles begann am 27. September. Zwei Ereignisse brachten an diesem Tag das Pulverfass zum Explodieren: Erstens lösten Sicherheitskräfte gewaltsam eine friedliche Versammlung von jungen Hochschulabsolventen auf, die vor dem Büro des Ministerpräsidenten standen und angemessene Jobs forderten. Zweitens musste Generaloberst Abdel Wahab al-Saadi seinen Posten räumen. Der stellvertretende Kommandeur der irakischen Antiterroreinheiten (CTS) genießt wegen seiner Rolle im Kampf gegen den sogenannten Islamischen Staat (IS) den Status eines Na­tio­nal­helden.

Milizionäre außer Kontrolle

Schnell hieß es, Teheran stecke hinter der Entlassung al-Saadis. Der Generaloberst galt als Mann Washingtons und der CTS, die er auch als Bollwerk gegen die hegemonialen Bestrebungen der Haschd al-Schaabi (Volksmobilisierungseinheiten) benutzte. Diese Koalition aus mehreren schiitischen Milizen wurde 2014 gegründet, um nach dem Fall Mossuls einen heiligen Krieg gegen den IS zu führen. Finanziert wurden diese Einheiten vor allem von Iran, und die iranischen Revolutionsgarden – der bewaffnete Arm Teherans in der Region – übernahmen ihre Ausbildung.

Repression gegen junge Arbeitslose und die Kaltstellung eines Nationalhelden, um Teheran zu gefallen – diese beiden Ereignisse verdeutlichen gut die doppelte Motivation der irakischen „Hirak“ (Bewegung): erstens die Wut über eine katastrophale soziale und ökonomische Situation und zweitens den Verdruss über den Einfluss Irans.

Police during 2018 Iranian protests 05.jpg

Die aktuellen Proteste der irakischen Zivilbevölkerung sind zwar spontan entstanden, doch gleichzeitig gehören sie in eine Serie von Demonstrationen, die 2003 ihren Anfang nahm und angesichts der vielen nicht gehaltenen Versprechen nie abgebrochen ist. Viele der ungelösten Probleme waren schon damals Thema: Korruption, Klientelismus, Arbeitslosigkeit, bewaffnete Gewalt und ein dahinsiechendes, ineffektives politisches System.

Dabei war das Land nie so reich wie heute: Als Profiteur des hohen Ölpreises lag der Staatshaushalt 2019 bei 112 Milliarden US-Dollar (99 Prozent der irakischen Exporte kommen aus dem Ölsektor). Gleichzeitig hat aber auch die staatliche Korruption zugenommen. Anfang 2019 bestätigte eine parlamentarische Kommission, dass in den vergangenen 16 Jahren über 300 Milliarden US-Dollar in dunklen Kanälen verschwunden sind.

Mit einer Arbeitslosenquote, die in manchen Regionen des Landes fast bei 50 Prozent liegt, ist die junge Gene­ra­tion die Hauptleidtragende dieser Misswirtschaft. Die Anzahl der Selbstmorde ist nach Angaben der parlamentarischen Menschenrechtskommis­sion zwischen 2016 und 2018 um mehr als ein Drittel gestiegen, von 383 auf 519. Obwohl die tatsächlichen Zahlen vermutlich höher sind, hat die Bevöl­kerung auf die Veröffentlichung sehr emotional reagiert. Ein weiterer Schock:

2019 haben einige der Opfer ihren Selbstmord live in den sozialen Me­dien übertragen.

Alle Regierungen seit 2003 haben den Bildungssektor stark vernachlässigt. Heute fehlen im Irak mehr als 20 000 Schulen; in einem Klassenzimmer drängen sich zuweilen über 80 Schulkinder. Noch alarmierender ist es, dass im Schuljahr 2017/18 etwa 130 000 Kinder nicht eingeschult wurden. Dabei ist die Lage in den ehemals vom IS kontrollierten Gebieten besonders desolat.2

„Diese Generation hat zwar keine Möglichkeit zu reisen, ist aber über die sozialen Medien sehr gut vernetzt“, erklärt Mustafa Saadoun, Gründer der irakischen Beobachtungsstelle für Menschenrechte. „Die jungen Leute sehen, dass ihre Altersgenossen im Ausland sehr gut leben, auch in Ländern, die ärmer sind als der Irak. In einem rechtlosen Land zu leben, mit bewaffneten Milizen überall, das ist für sie nicht länger akzeptabel.“ Die aktuelle Krise gehe sehr viel tiefer als alle vorangegangenen, meint Saadoun. „Der Protest richtet sich gegen das gesamte System, und deswegen bleiben die politischen Verantwortlichen stumm. Ihre persönlichen Interessen sind bedroht.“

Saadoun arbeitet als Journalist in Bagdad und war einer der Köpfe der Proteste auf dem Tahrir-Platz 2015. Damals forderten die Demonstranten soziale Reformen von der Regierung Haidar al-Abadi. „2015 war alles sehr viel weniger gewalttätig. Und wir haben uns auch nur jeden Freitag versammelt. Heute haben wir nach weniger als zwei Monaten fast 500 Tote, alles friedliche Demonstranten, von denen war niemand bewaffnet!“

Neben dem sozioökonomischen Zerfall des Landes ist vor allem die Allgegenwart Irans ein Brandbeschleuniger. 2003 versprachen die US-Invasoren Demokratie, tatsächlich aber befindet sich der Irak in großen Schwierigkeiten: die Anwesenheit ausländischer Truppen auf seinem Territorium, die Zerschlagung der Strukturen des alten Regimes, das Verschwinden einer Reihe von Institutionen, die konfessionellen Spannungen, der maßgebliche Einfluss Oppositioneller, die lange Zeit im Ausland gelebt haben und wenig von der ­Realität im Land verstehen – all dies hat den Staatsapparat stark geschwächt. Und es hat der Einflussnahme durch ­Teheran und Washington den Weg geebnet.

Seit dem von US-Präsident Obama 2011 beschlossenen Abzug der US-Truppen hat Teheran allerdings die Oberhand über seinen US-amerikanischen Rivalen gewonnen. Im November 2019 veröffentlichte die Website The Intercept Geheimdokumente,3 die enthüllten, was für die meisten Iraker ohnehin ein offenes Geheimnis war: Teheran durchdringt den irakischen Staatsapparat in einem erschreckenden Ausmaß.

Man könnte fast von einer nationalen Unterwanderung sprechen, so groß ist der Einfluss Irans überall im Nachbarland. Nach dem Abzug der US-Truppen wurden die irakischen CIA-Informanten unverzüglich von den iranischen Geheimdiensten rekrutiert. Dass es irakische Quellen waren, die diese Geheimdokumente geleakt haben, verdeutlicht zudem die Verbitterung eines großen Teils der Sicherheitskräfte.

„Im Laufe seiner Geschichte hat der Irak sich stets gegen Besatzer und jegliche Form der Unterdrückung gewehrt“, sagt Muntadhar Nasser, ein Menschenrechtsaktivist, der seit 2015 bei keiner Kundgebung auf dem Tahrir-Platz gefehlt hat. „Die Angriffe der Regierung auf die Bildung, die endemische Korruption, die schlechte Verwaltung des Landes – all das hat die Wut der Jugend angestachelt.“

Am 1. Oktober ging es in einem der ersten Slogans der Protestbewegung nicht um die Stromausfälle oder um die Arbeitslosigkeit, sondern um eine nationale Vision, die seit 2003 mit Füßen getreten wird: „Nurid Watan“ (Wir wollen eine Heimat/Nation). „Um die Zukunft eines Landes aufzubauen, ist Bildung die Basis“, meint Hatem al-Zaidi, ein Demonstrant auf dem Tahrir-Platz. „Und der Motor dafür ist politische Unabhängigkeit. Wir lehnen jede ausländische Einmischung in die Angelegenheiten Iraks ab. Wir wollen weder Iran noch die USA.“

Quelle          :     Le Monde diplomatique           >>>>>            weiterlesen

————————————————————

Grafikquellen :

Oben          —        Tehran Grand Bazaar strikes and protests to the economic situation

—————————–

2.) von Oben        —    2017–18 Iranian protests

——————————

Unten       —           Dunja Hayali mit ihrer Laudatorin Iris Berben beim Radio Regenbogen Award 2017 im Europa-Park in Rust

Abgelegt unter Asien, Bildung, Kultur, Medien | Keine Kommentare »

Die 68er und links

Erstellt von DL-Redaktion am 13. Januar 2020

Studentenrevolte 1967/68, West-Berlin

File:Ludwig Binder Haus der Geschichte Studentenrevolte 1968 2001 03 0275.4246 (16463777644).jpg

Quelle          :         untergrund-blättle-CH.

Von     Ilse Bindseil  streifzuege.org

Früher, sagen wir zwischen 1965 und 1975, wäre eine Position wie die von Philipp Demandt anlässlich der Entfernung eines sexistisch anstössigen Bildes aus einem Museum vertretene („Erst hängen wir die Bilder ab, dann die Freiheit an den Nagel“, FAZ-Interview 1.2.2018) eine linke Position gewesen.

Nicht, weil der Direktor des Frankfurter Städel für Freiheit eintrat, sondern seiner inhaltlichen Aussage wegen: „Ob uns das heute gefällt oder nicht: Kunstwerke werden immer auch im Kontext des Begehrens geschaffen.“ Was er hier so entschieden wie vorsichtig formuliert, war seinerzeit Exklusivwissen der rebellischen Nachnazigeneration, die sich der Psychoanalyse wieder zugewandt und die als Verkörperung jüdischer Abartigkeit in die Emigration getriebene Freud’sche Lehre vom Trieb gewissermassen repatriiert hatte. Es war dialektisch, und damit links, weil es die Gegensätze Trieb und Kunst in einen verbindlichen Zusammenhang brachte; das heisst von einem Trieb ausging, der für Gutes und Böses verantwortlich war.

War es damals links gegenüber der Spiessermoral, die den lieben Gott für das Gute und den Teufel fürs Böse, für die Kunst die Inspiration und für die Perversion den Trieb, für alles einen Namen und eine eigene Ursache hat, so gilt es heute als Ausdruck machtgeschützter männlicher Gleichgültigkeit gegenüber dem anderen Subjekt. Links dagegen, sofern die Bezeichnung aufrechterhalten wird, ist wie in ein anderes Paradigma gerutscht, das dichotomisch, nicht dialektisch strukturiert ist.

Es gibt wieder eine anständige Sexualität und eine lasterhafte, und es würde sicherlich auch einen guten Trieb und einen bösen geben, wenn nicht der Begriff selbst, am liebsten würde ich sagen so triebhaft wäre, dass man ihn besser ganz lässt und durch den, am liebsten würde ich sagen harmlosen Begriff Macht ersetzt, der das Böse in einem im weitesten Sinn politischen Spektrum situiert, wo es schon immer zu Hause war. Offenbar gibt es auch eine von schmutzigen Bildern, schmutzigen Phantasien, schmutzigen Motivationen befreite Kunst, die gefestigt und gereinigt übrigbleibt, wenn man die Ersteren entfernt hat. Würde man aus der Vogelperspektive einen Blick auf die Ideologiegeschichte werfen, käme es einem so vor, als würde das Pendel zurzeit mit Macht zugunsten einer substantiell gemeinten Richtigkeit ausschlagen, die sich vom Liberalismus abgrenzt, ohne freilich den Sozialismus in den Blick zu bekommen.

Das ist eine für 68er höchst unangenehme Wahrnehmung, nicht nur, weil das Konzept der antiautoritären Freiheit ins Zwielicht geraten ist, sondern weil ihr problematisches Verhältnis zum Sozialismus unversehens wieder virulent wird. Hatte links etwa schon damals mit Sozialismus wenig zu tun, und ist eine linke Position heute deshalb so schwer zu formulieren*

Früher war links eine Gewissheit, ein fester Ort, für Nazi-Kinder ein rettender Hafen. Für Arbeiterkinder war links eine Tradition, für Intellektuelle eine Erdung. Unnötig, der Frage bis auf ihren letzten Grund zu gehen, was links ist. Zu viel war damit auch verknüpft, als dass es verantwortungsvoll gewesen wäre. Wichtiger, links zu sein und sich als Linke zu verhalten. Auch wenn man die Sache nicht bis in alle Verästelungen überblickte, ja gelegentlich voll danebenlag, so stand der Bezug zur Wirklichkeit, ein immer fordernder, nie gleichgültiger Bezug, doch ausser Frage, und wo es Zweifel gab, halfen die Gegner nach, die zur Vereindeutigung von links nicht wenig beigetragen haben.

Heute ist links, um ein Wort von Walter Benjamin zu gebrauchen, vielfach „zerfällt“. Das Dreierbündnis von Arbeit (Objektivität), Intelligenz (Subjektivität) und Ethik mutet willkürlich an. Zwar, was der Kalauer über das Alter sagt, growing old is compulsory; growing up is optional, gilt auch hier. Aber das Verhältnis von compulsory und optional hat sich verschoben. Nicht alles, was sich als Zusammenhang präsentiert, ist auch gewährleistet, und was optional ist, ist womöglich eher halluziniert als eine reale Perspektive. Optional, im unangenehmen Sinn von halluziniert, ist vor allem die traditionelle Rolle der Intelligenz als Aufklärerin einer tumben Menge, womöglich als Anführerin.

Compulsory ist nicht zuletzt die Existenz der far-away-Sklavenarbeit, ohne dass sie sich im postmodernen Bewusstsein gehörig abbilden liesse, compulsory scheint überhaupt das Gesetz, dass sich der Kapitalismus über das Nichtkapitalistische, in Rosa Luxemburgs Begriff, über seine Ränder erhält. Abgekoppelt von Aufklärung und Gewalt: das ethische Gebot, Menschen zu retten. „Es gibt kein Gutes ausser: Man tut es.“ (Erich Kästner) Das ist eine andere Grundvoraussetzung als: „Man kann nichts Gutes tun, es sei denn, man ist links.“

In den ersten Jahrzehnten nach dem Dritten Reich galt die letztere Voraussetzung. Wer nicht durch einen als natürlich empfundenen Gegensatz zum Nationalsozialismus geprägt worden war, musste diesen Gegensatz selbständig und in einer Weise herstellen, die vom Mainstream prompt als übertrieben empfunden wurde, so als würde eine durch den NS nicht ernstlich in Frage gestellte unpolitische Normalität und Mitte aufs Spiel gesetzt. Wer den Nationalsozialismus in den Fokus rückte und sich mit ihm, der bis weit in die Biographien hineinreichte, auseinandersetzte, sich explizit in die Tradition seiner Gegner und Opfer und damit gegen die Mitläuferideologie seiner familiären Vorbilder stellte, war links und wurde sogleich als links identifiziert.

*Was bedeutete es unter diesen Umständen, links zu sein? Es bedeutete, den durch den NS zerstörten Bezug sowohl zur bürgerlich-liberalen Aufklärung als auch zur marxistischen Klassentheorie wiederherzustellen, und nicht von Anfang an stellten beide Projekte sich als unterschiedlich, gar antagonistisch dar. Die Grenze zur liberalen Diskussion musste erst herausgearbeitet werden, ohne dass links seinen Bezug zum Bürgerlichen, durch Habermas’ Öffentlichkeitsdiskurs angestossen, gänzlich losgeworden wäre; die breite Anwendbarkeit des Etiketts „linksliberal“, nicht nur als Schimpfwort von links, auch als Selbstdefinition eines aufgeklärten Bürgertums, steht dafür.

Nicht nur gewann links eine über seinen traditionellen Bereich hinausreichende Bedeutung, der Begriff verlor auch an Inhalt und Bestimmtheit, so dass man ebenso umgekehrt von einer Ausdehnung des Bürgerlichen bis weit in das Feld der Linken hinein sprechen kann. Antiautoritär war damals vielleicht der erste ernsthafte Konkurrent für links. Der Begriff markierte einerseits Unabhängigkeit von der traditionellen Zuordnung und behauptete gleichzeitig, ein natürlicher Ausdruck linken Bewusstseins zu sein, öffnete aber einen Spalt zwischen dem Lebensgefühl und der objektiven Zugehörigkeit, was ihn zu einer niemals ganz geklärten Angelegenheit machte, einem verführerischen Kompromiss oder einer scheinhaften Vermittlung.

Zielte die Totalitarismusdebatte der frühen Bundesrepublik, den Linken ein Graus, explizit auf die Übereinstimmung zwischen links und rechts, so wurde die Grenzziehung zwischen linksliberaler und linker Position erst mit der RAF Pflicht. Wer erkennbar oder vielmehr unverkennbar links sein wollte, hatte schliesslich RAF werden müssen. Umgekehrt, wer dank seiner liberalen, auch antiautoritären Prägung nicht RAF werden wollte, war in kürzester Zeit nicht mehr links, sondern Realist und machte als solcher Karriere. Wer sich der Grenzziehung verweigerte, war in Kürze als Sympathisant markiert. Angesichts der heutigen Konjunktur rechter Parteien und Bewegungen, die bürgerliche Errungenschaften, Freiheit und Gewaltenteilung, aufs Korn nehmen, wird das Dilemma einer linken Position erneut deutlich. Bevor sie sich über sich selbst klar werden kann, hat sie sich in der Verteidigung der bürgerlichen Werte aufgerieben.

Dass die heutigen Schwierigkeiten, links zu sein, vor allem mit dem Zusammenbruch real- und staatssozialistischer Systeme zu tun haben, trifft auf den ersten Blick nur für die zu, die immer schon und originär links waren. Opfer der NS-Herrschaft, mühsam Überlebende, im Kalten Krieg ebenso rasch wieder verboten und ausgegrenzt wie im Dritten Reich bedroht und verfolgt, in der jungen BRD nahezu unsichtbar – so dass man selbst links sein konnte, ohne sich mit ihnen abzugeben –, sind sie auf keinen Fall die, die ab Mitte der 60er Jahre eine als links empfundene Bewegung prägten. Was für Letztere durch diesen Zusammenbruch zunichtegemacht wurde, hatte sich eher im Bereich der übersprunghaften Identifikation, einer mehr gefühlten als tatsächlichen Symbiose abgespielt.

Die im realkommunistischen Zusammenhang hervorragende Rolle von Strategie und Taktik war für jemanden, der sich vor allem gegen die in der Bundesrepublik herrschende Strategie der Verdrängung engagierte, eine harte Nuss gewesen, ebenso unverdaulich wie die virulent werdende Frage von Überwachung und Gewalt und die überragende Rolle der Führung, anders ausgedrückt, Herrschaft. Gerade sie war für jemanden, der die ererbte autoritäre Gesinnung als Schuld empfand und den Untertan in sich bekämpfen wollte, eine Zumutung, die nur durch den Masochismus der bürgerlichen Selbstbezichtigung ertragen werden konnte, aber nicht auf ewig. So wurde der Zusammenbruch des Realsozialismus eher mit Erleichterung quittiert und ohne dass sogleich deutlich wurde, wie sehr die Möglichkeit, links zu definieren und zu sein, davon in Mitleidenschaft gezogen wurde. Vielmehr war es eher so, als hätte man sich einer Illusion entledigt, und die Realität wäre übriggeblieben, nur welche?

Die heimliche Überzeugung, dass der Marxismus in den Rahmen der bürgerlichen Selbstaufklärung mehr als in den Rahmen proletarischer Selbstermächtigung gehört, dass man Marxist sein kann, ohne Kommunist sein zu müssen, womöglich besserer Marxist, wurde nicht widerlegt: sie schwand dahin. Marxismus wurde ein geistiger oder gestriger Standpunkt: als ökonomische Theorie so richtig, dass man ihn beinahe als bürgerlich bezeichnen konnte, politisch aber ohne Bedeutung. Angesichts der Konjunktur postmoderner Methoden, die die gesellschaftliche Widersprüchlichkeit nicht ableiteten, sondern von ihr ausgingen, die sie nicht platonisch nach Wesen und Erscheinung sortierten, sondern ihren Schein als ihr Wesen nahmen und sich vom Zwang zur Herleitung, zur Aufdeckung des Verborgenen und Entlarvung des Offensichtlichen damit befreiten, wurde der Marxismus im Westen zu einer reservatio mentalis.

Er wurde eher behauptet als betätigt, eher festgehalten als bearbeitet. In hohem Masse auf die Realität angewiesen, an der er Anstoss nehmen, von der er sich abstossen konnte, war er eher Kritik als Entwurf und merkwürdigerweise so gut wie nie Selbstkritik. Selbstaufhebung, für uns Kinder der Nachnazizeit mehr Utopie als Bedrohung, kam für die Hüter des Marxismus nicht infrage. So wurde er eine Sache für sich, etwas, was man tun oder lassen konnte. Die Betonung liegt auf lassen.

Trotzdem fehlt etwas, wenn Links fehlt. Es fehlt auch denen, die nicht in einer Familie von Sozis, Kommunisten gar, aufgewachsen sind und durch die gesellschaftliche Entwicklung um eine wie immer fragliche politische Heimat gebracht wurden. Betrachtet man die bürgerlichen Mittel der Verweigerung – als da sind individuelle Leistungsverweigerung, politischer Pazifismus und Hungerstreik, philosophische Skepsis und Stoa, das spirituelle Prinzip Erleuchtung statt Bereicherung, das ästhetische Prinzip Grenzüberschreitung und Provokation oder, praktisch, selbstgewählte Formen der Genügsamkeit –, so scheint das Nein hinreichend repräsentiert, ja durch das Prinzip der Selbstbegrenzung veredelt. Was also fehlt?

Es fehlt eine Position, die Anspruch erhebt auf die nicht hintergehbare Gesellschaftlichkeit der eigenen Person. Die war in der politischen Ökonomie ohne Abstriche, wenn auch hermetisch repräsentiert. Bereits in der kulturellen Selbstvergewisserung verschwammen aber idealistische und sozialistische Ideale und suggerierten eine Totalität, die in ihrer latenten Positivität und Spiessigkeit verdächtig war, ein Ärgernis nicht zuletzt für aufbruchsbereite Bürgerkinder, die sich an ihre Herkunft noch erinnern konnten. Führte etwa jeder Gedanke ins Bürgerliche zurück? War das Proletariat, im geschichtsphilosophischen Kontext des Kommunistischen Manifests, nicht ein bürgerliches Schicksal, Geschichtsphilosophie womöglich immer bürgerlich? War nicht schon der Kampf gegen den Feudalismus ein Kampf um die aristokratischen Werte Stilsicherheit, Grosszügigkeit, Tapferkeit gegen die Kleinbürgerei, ein – die neurechte Inanspruchnahme aristokratischer Grundwerte erinnert daran – Kampf des Bürgertums mit sich selbst? Wie steht es um die Möglichkeit, über sich hinauszudenken? Verhindert die Form nicht, was sie verspricht: dass die Idee über sich hinauswächst, nicht zuletzt die Idee des Universalismus?

Das Erste und Offensichtlichste, wenn von links die Rede ist, stellt die ökonomische Theorie heute Anforderungen, die ein Doppeltes umfassen: ein Verständnis des Kapitalismus sowohl als Tatsache, die man feststellen, als auch als Konstrukt, über das man nachdenken muss. Beide Anforderungen sind, wie es in Stellenausschreibungen heisst, „anspruchsvoll“: je umfassender, auch abstrakter sie sind, desto elitärer der Appell, der von ihnen ausgeht, desto schlechter die Prognose für links. Wer soll den Kapitalismus in seiner doppelten Erscheinung als Inbegriff partikularen Interesses und als abstraktes Gesetz begreifen, wenn er der eigenen Theorie gegenüber blind bleibt? Wer soll es schaffen, dass er auf dem langen Weg vom Abstrakten zum Konkreten, dem Herleitungsweg, nicht ein einziges Mal „falsch abbiegt“?

Den gesellschaftlichen Stoffwechsel nicht nur nach seinen bekannten, sondern auch nach seinen unbekannten Prinzipien begreifen wollen, heisst die Bedingtheit, auch die Spiegelbildlichkeit der eigenen Theorie einräumen. Dass dies nicht ohne weiteres als links gilt, ist dem Doppelcharakter von links als Theorie und Bewegung geschuldet. Linke Selbstreflexion schert sich um die Notwendigkeiten der Letzteren nicht; sie stellt auch links in Frage.

Es ist daher kein Wunder, wenn in der Wirklichkeit immer wieder Anhaltspunkte gesucht wurden, die die Orientierung erleichterten, zugleich Realität verbürgten. Herrschaftstheorien spiegeln die Suche nach solchen Haltepunkten wider, der Staat als Agent der Ökonomie, Verkörperung und Verschleierung dessen, „was die Welt im Innersten zusammenhält“, ist ein erkennbarer Gegner. Gegen den Staat sein erfordert keine über jeden Zweifel erhabene Theorie, dafür eine grundsätzliche Einstellung und persönlichen Mut. Allerdings verliert der Gegner an Kontur in dem Mass, wie er von rechts in Frage gestellt wird und wie er ein Monopol nicht nur auf Herrschaft, sondern auch auf Partizipation und soziale Gestaltung geltend machen kann. Insofern er nicht nur ein Zerrbild des gesellschaftlichen Ganzen, sondern auch dessen Verkörperung beziehungsweise das eine in der Form des andern ist, bedeutet die Entscheidung für links auch Verzicht auf eine gesellschaftliche Praxis, die, wiewohl durch und durch schlecht, doch Allgemeinheit für sich in Anspruch nehmen kann. Dass prominente Linke aus der Studenten- und antiautoritären Bewegung sich in Staatsdienste begaben, hat unter anderem mit diesem Dilemma zu tun.

Wenn heute der Vorwurf des linken Antisemitismus erhoben wird, dann hat das mit der genannten Vereinfachung ebenso wie mit der vermissten Praxis zu tun. Wiewohl Inbegriff der Kontingenz, ist Antisemitismus ein leichterer Gegner als der Kapitalismus, weil das Schwierige seinem Wesen zugerechnet wird; es muss gehütet, nicht aufgelöst werden. Sich den Antisemitismus zum Gegner zu erwählen eröffnet darüber hinaus die Möglichkeit einer Polarisierung, die die praktische Perspektive ersetzt. Dazu bietet er eine vereinfachte Form der Selbstkritik an, die das Böse, das sie als Fremdes identifiziert, begrifflich und praktisch aus sich herausschneidet.

http://www.ndr.de/kultur/geschichte/chronologie/talare2_v-vierspaltig.jpg

Dank der dem Antisemitismus innewohnenden traumatischen Qualität würde der Antisemitismusvorwurf das unbefangene Selbstbewusstsein, das linke Selbstvertrauen gleichwohl ernsthaft infrage stellen, gäbe es zu links nicht noch einen anderen Zugang als bloss den intellektuellen. Um die sachliche Seite des Kapitalismus zu begreifen, braucht es Theorie, um die Gewalt, die in der Sache steckt, abzulehnen, braucht es ein intaktes Bewusstsein seiner selbst. Auf der Basis dieses Selbstbewusstseins gerät der Satz „Links ist richtig“ in Bewegung, er kehrt seine regulative Seite hervor: Was richtig ist, ist links. Gegenüber dem hergeleiteten linken Standpunkt hat der intuitive durchaus eine kritische Funktion. Mag die Herleitung noch so stimmig erscheinen – meist: je kurzschlüssiger sie ist –, wenn die Intuition sagt, das kann unmöglich links sein, dann stimmt es auch.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————

Grafikquellen        :

Oben         —       Source   –  2001_03_0275.4246 / Ludwig Binder: Studentenrevolte 1967/68, West-Berlin; veröffentlicht vom Haus der Geschichte

Author Stiftung Haus der Geschichte
This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.
Checked copyright icon.svg This image was originally posted to Flickr by Stiftung Haus der Geschichte at https://flickr.com/photos/132468467@N06/16463777644. It was reviewed on by FlickreviewR and was confirmed to be licensed under the terms of the cc-by-sa-2.0.

————————–

2.) von Oben         —        Studentenrevolte in West-Berlin

—————————–

Unten       —           Kulturgeschichte II

Die BRD bis zur Wiedervereinigung

Abgelegt unter Bildung, Deutschland, P. DIE LINKE, P.Die Grünen | Keine Kommentare »

Die zornigen Zwanziger

Erstellt von DL-Redaktion am 5. Januar 2020

Der Generationenkonflikt

An ASEAN Youth Leader Asks Secretary Kerry a Question (10174729113).jpg

Eine Kolumne von

Die Konflikte, die wir erleben, drehen sich fast alle darum, ob Regeln und Gewohnheiten der Vergangenheit unverändert gelten sollen. Progressive haben dabei die mächtigste Kämpferin auf ihrer Seite: Zeit.

Menschen sind symbolgeil bis in ihre ältesten Kleinsthirnwindungen hinein, schon deshalb macht die neue Dekade einen Unterschied. Seit einiger Zeit kocht blubbernd der bestimmende Sound des neuen Jahrzehnts herauf: Die zornigen Zwanziger beginnen.

Diese Dekade wird, für diese Prognose braucht man keine hellseherischen Fähigkeiten, von Konflikten geprägt werden. Auf den ersten Blick wirken viele darunter wie Varianten eines klassischen Generationenkonflikts. Kein Zufall, dass die ikonische Figur des alten, weißen Mannes vor einiger Zeit ins öffentliche Bewusstsein geriet. Im März 2019 schrieb Bernd Ulrich in der ZEIT: „1968 war ein Kindergeburtstag – verglichen mit dem beginnenden Generationenkonflikt.“

Das 20. Jahrhundert kollidiert mit dem 21. Jahrhundert

In den vergangenen Wochen gab es eine Menge Anzeichen dafür, dass das Alter eine wesentliche Rolle bei den Konflikten spielt, die sich bezeichnenderweise alle rund um Netz- und Medienereignisse drehten und in erster Linie in sozialen Medien ausgetragen wurden:

  • Das weltweite Strohfeuer der Wendung „Ok Boomer“.
  • Die Aufregung um einen vorweihnachtlichen Tweet von Fridays for Future über demnächst sterbende Großeltern.
  • Ein satirisches Liedchen einer WDR-Sendung, in dem eine fiktive Oma als „Umweltsau“ bezeichnet wurde.

Obwohl sich die jeweiligen Aufregungen unterschieden, schienen die Spannungen zwischen Alten und Jungen das wiederkehrende Muster zu sein. Ich glaube nicht, dass wir einen klassischen Generationenkonflikt vor uns haben, wie es ihn schon oft und eigentlich ständig gab – sondern einen Konflikt der Epochen. Holozän versus Anthropozän, um gleich dickstmöglich aufzutragen. Oder etwas kleiner, nachvollziehbarer: Das 20. Jahrhundert kollidiert mit dem 21. Jahrhundert.

Konflikte über die Gültigkeit von Regeln aus einer vergangenen Epoche

Historiker sprechen vom „langen 19. Jahrhundert„, weil es eigentlich erst mit dem Ausbruch des Ersten Weltkriegs 1914 endete. Ich schlage vor, künftig vom „viel zu langen 20. Jahrhundert“ zu sprechen, das in seinem egozentrischen Furor nervig bis in die Zwanzigerjahre rein ragt.

Die Konflikte, die wir erleben, drehen sich fast alle darum, ob Regeln und Gewohnheiten des vergangenen Jahrhunderts weiterhin unverändert gelten sollen. Oder man nicht neu nachdenken sollte, was vielleicht einmal richtig war oder schien, aber jetzt falsch geworden ist.

Vordergründig ist es leicht, den Kampf zwischen Holozänikern und den Anthropozän-Leuten als Generationenkonflikt zu begreifen, und ganz falsch mag das nicht sein. Aber die Grenzen sind viel stärker verwischt. Es sind ja nicht nur die Alten, es sind ja auch und manchmal vor allen anderen die Mittelalten, die heute vielleicht zwischen 35 und 55 Jahre alt sind.

Es handelt sich um eine Alterskohorte, die bei ihrem persönlichen Fortkommen oft viel Zeit und Arbeit investiert hat in gesellschaftliche Strukturen, die sich gerade verwandeln, verschieben oder untergehen.

Die eher bürgerlich orientierten Leute, die Banklehren gemacht haben oder Journalistik studierten, die von Sportwägen träumten oder auf eine Kreuzfahrt sparten, die Karriere machten oder zumindest ihr Leben danach ausrichteten, weil die große Überbotschaft des Bürgertums im ausgehenden 20. Jahrhundert war: Du bist dein Job.

Woraus leicht eine sehr materiell fixierte Haltung entsteht, wenn man nicht aufpasst. Die Überbetonung des Dinglichen, in einer Zeit, in der das Nichtdingliche, das Virtuelle, das Digitale offensiv und rücksichtslos voranschreiten.

Kampf gegen die Insignien von Erfolg und bürgerlichem Glück

Plötzlich kommen von überall her Leute, die die Insignien von Erfolg und bürgerlichem Glück aus dem 20. Jahrhundert nicht nur ignorieren, sondern ablehnen oder sogar bekämpfen.

Wp10 20110115 IMG 9974.jpg

Und es sind eben nicht nur die Jungen, sondern auch die Menschen, die schon in den vergangenen 20, 30, 40 Jahren weniger mit der Konsum- und Karrieregesellschaft anfangen konnten.

Denen es leicht fällt, den Sportwagentraum aufzugeben, weil sie ihn genau genommen noch nie träumten. Die zornigen Zwanzigerjahre werden geprägt sein von den Abwehrkämpfen derjenigen, die ihre Mühen noch in die Gesellschaft des 20. Jahrhunderts investiert haben.

Die echten Konflikte erscheinen zu schmerzhaft, um sie ernsthaft zu diskutieren

Quelle       :          Spiegel-online        >>>>>         weiterlesen

——————————————————————

Grafikquellen      :

Oben          —            A student asks U.S. Secretary of State John Kerry a question during a Youth Leaders meeting in Bandar Seri Begawan, Brunei, before the U.S.-ASEAN Summit meeting begins on October 9, 2013. [State Department photo/ Public Domain]

 ———————————

Unten          —        Sascha Lobo; 10 Jahre Wikipedia; Party am 15.01.2011 in Berlin.

Abgelegt unter Bildung, Kultur, Positionen, Überregional | Keine Kommentare »

Wie ich meinen Vater fand

Erstellt von DL-Redaktion am 4. Januar 2020

Unser Autor wuchs ohne Vater auf.

Wikipedia-sobibor-1.jpg

Von Boris Messing

Bis er seinem Großvater zufällig im „Spiegel“ begegnet. Seine Familiengeschichte führt ihn ins Vernichtungslager Sobibór, nach Kalifornien und zu seinen jüdischen Wurzeln.

och bevor ich lesen oder schreiben konnte, erzählte ich meiner Mutter oft Geschichten, die sie für mich aufschrieb. Es waren Helden- und Abenteuergeschichten, fantastische und oftmals wirre Märchen. Und manchmal, sagt sie, hätte ich in ihnen auch nach meinem Vater gesucht. So erinnert sie es zumindest, als ich sie nach meiner Kindheit frage.

Sehr schwierig sei es mit mir gewesen. Als Baby hätte ich nächtelang geschrien, so lange, bis ich blau anlief. Ich weigerte mich, von ihrer Brust zu trinken, und mied ihren Körperkontakt. Weil ich so heftig schrie und zitterte, fuhr meine Mutter häufig mit mir in die Kinderklinik nach Karlsruhe, aber sie fanden nichts. Sie untersuchten mich auf Spastik und auf Epilepsie, später auch auf ADHS, aber nie fanden sie auch nur die kleinste Kleinigkeit. Ich war gesund.

Während meiner Gymnasialzeit häuften sich die Fragen nach meinem Vater, ich wollte wissen, wo er ist und was er macht. Die kryptischen Antworten meiner Mutter reichten mir nicht mehr, die Sache ließ mich nicht los. Ein Gefühl, irgendwie anders zu sein, erwuchs mit den Jahren, besonders ab meiner Jugend, wuchs so stark an, dass es mich innerlich zerriss. Da war ein Dämon in mir, und ich begriff nicht, woher er kam – bis ich vor zehn Jahren meinen Vater fand.

Ich habe die Geschichte schon so oft erzählt, dass es mir irgendwann vorkam, als berichte ich über eine andere Person. Aber diese Person bin ich. Ein Mensch, der an so etwas wie Schicksal nie geglaubt hat; ein Mensch, für den ein Zufall stets ein Zufall war, egal wie viele Umstände ein Ereignis möglich machten. Und noch heute rätsle ich über das Zusammenfallen jener Umstände, die mich zu ihm geführt haben. War das wirklich Zufall? Oder eine göttliche Fügung aus dem Äther, ein Hinweis zur Lösung der latenten Ungewissheit, die mich immer quälte: Wer bin ich? Was von meinem Vater steckt in mir? Würde ich mich in der Begegnung mit meinem Vater erkennen, vielleicht sogar besser verstehen können?

Alles kam im Mai 2009 ins Rollen. Ich fuhr mit dem Zug von Berlin nach Heidelberg, um eine alte Freundin zu besuchen, von der ich mir ein wenig Trost erhoffte. Mein Leben in Berlin war aus den Fugen geraten, Partys, Drogen, Sinnkrisen; Ängste, die ich nicht begriff, und über allem die panische Sorge, die Kurve nicht zu kriegen. Meine angefangene Bachelor-Arbeit über Humanexperimente in den KZs trug auch nicht gerade zu meiner Erheiterung bei. In dieser bedrückten Stimmung fuhr ich also in den Süden.

John Demjanjuk 3.jpg

Für die Fahrt kaufte ich mir den Spiegel, den ich damals fast nie las. Schweigend blickte ich aus dem Fenster und dachte über das Zerbrochene in meinem Leben nach, hörte zur Ablenkung Musik und blätterte im Magazin herum – die Gier der Reichen nach dem großen Crash, Steueroasen in Europa, Oba­ma will den Friedensprozess in Nahost beleben, Interview mit dem Holocaust-Überlebenden Thomas Blatt. Gut, dachte ich, Nationalsozialismus geht immer, und las das Interview. Es drehte sich um den Demjanjuk-Prozess, der bald in München verhandelt werden sollte. John Demjanjuk wurde vorgeworfen, Wächter im polnischen Vernichtungslager Sobibór gewesen zu sein, in dem an die 250.000 Juden ermordet wurden. Blatt würde als Nebenkläger im Prozess vertreten sein und berichtete im Interview, wie er das Vernichtungslager überlebt hatte – als Einziger seiner Familie. Ein Kästchen auf der Mitte der Seite mit einem Bild von ihm informierte über seine Biografie: 1927 im polnischen Schtetl Izbica geboren, 1943 nach Sobibór deportiert, ausgewandert in die USA. Lebt und arbeitet in Santa Barbara.

Als ich den Bahnsteig in Heidelberg betrat und meine Freundin mich mit einem breiten Lächeln in die Arme schloss, hatte sich meine Ahnung bereits in Unruhe verwandelt. Wir gingen in ihre Wohnung, und ich pfefferte den Spiegel in einem Akt der Verneinung in eine Zimmerecke, als könnte ich damit die Unruhe, die in mir rumorte, verbannen. Nach einer Woche hielt ich es aber nicht mehr aus, fuhr nach Bruchsal zu meiner Mutter und zeigte ihr das Interview. „Renata“, sagte ich, „kann es sein, dass das mein Opa ist?“ Sie betrachtete sein Konterfei und zögerte. „Ja … ich denke, das ist er.“

Das war der Moment, in dem ich explodierte. Wütend feuerte ich ihr die Vorwürfe entgegen, die ich ihr schon so oft gemacht hatte. Wie kannst du dir da so sicher sein? Warum hast du dir damals nichts aufgeschrieben! Warum hast du dir nichts gemerkt! Warum zum Teufel bist du nur so gedankenlos gewesen! Ich sah, wie Schuldgefühle ihr Gesicht verkrampften, ihre Pein, die mich gleichermaßen quälte, denn ich liebte meine Mutter. Aber die Wut ging sehr viel tiefer, sie rüttelte an den Grundfesten meiner Identität.

Was ich wusste und was sie mir an diesem Tag erneut erzählte, waren die alten unbelegten Wahrheiten: Der Name meines Vaters ist Leonard Sabra Blatt; sein Vater, an dessen Vornamen sie sich nicht erinnern konnte, war irgendwann aus Polen in die USA eingewandert, nach Santa Barbara, wo er lange, vielleicht noch immer lebte. Möglich auch, dass er das Holocaust-Museum in Los Angeles mitbegründet hatte (geprüft und nichts herausgefunden) und eine Tochter hat, die eine bekannte Mathematikerin ist (geprüft und nichts herausgefunden) – heute weiß ich, dass die letzten beiden Vermutungen falsch sind. Das war alles, was mir meine Mutter über meine amerikanisch-jüdische Familie erzählen konnte.

2001 schon hatte meine Mutter an das Generalkonsulat in Los Angeles geschrieben mit der Bitte der Preisgabe des Wohnorts von Leonard Sabra Blatt, notariell anerkannter Vater von Boris Messing, 18 Jahre alt. Das Antwortschreiben: „In den USA gibt es kein wie in Deutschland übliches polizeiliches Meldesystem. Alle Anschriften- und Personenermittlungen sind daher sehr schwierig, in vielen Fällen sogar unmöglich.“ Vorschlag des Konsulats: ein Detektivbüro engagieren, Tagessatz zwischen 400 und 1.000 Dollar. Das kam nicht infrage, Arbeiterfamilie, alleinerziehende Mutter, kein Geld. Und auch eigene Recherchen, die ich in den folgenden Jahren betrieben hatte, blieben ergebnislos.

Außer einer Vaterschaftsurkunde hatte meine Mutter keine Dokumente aufbewahrt, die mir die Suche nach ihm erleichtert hätten. Sie kannte weder den Vornamen meines Großvaters, noch wusste sie etwas über die Umstände, wie er in die USA gekommen war. Von meiner Oma wusste sie überhaupt nichts. Mir kam es nicht in den Sinn, dass mein Opa ein Holocaust­überlebender sein könnte. Seit dem frühen 19. Jahrhundert waren polnische Juden in die USA ausgewandert, Millionen von Juden waren aus Russland und Osteuropa dorthin gegangen. War die Familie meines Opas eine davon gewesen? Meine Mutter konnte mir nicht viel über meinen Vater erzählen. Er sei wild, Veganer und gegen Drogen gewesen. Das war so ziemlich alles. Mit 22 Jahren, Anfang der 80er, war sie für ein Jahr lang in den Staaten herumgereist, die meiste Zeit in Kalifornien. Sie traf den gleichaltrigen Lenny, wurde schwanger und flog zurück nach Deutschland, wo sie eine Schauspielausbildung beginnen wollte. Das Einzige, was ich von meinem Vater je zu Gesicht bekam, waren Nacktbilder von ihm, wie er sich mit langen roten Haaren an einem Baum räkelt. Und ein Bild mit meiner Mutter in schreiend bunten Leggins vor einer Schrottkarre mit schlecht aufgemaltem Peace-Zeichen. That was it.

Meine Kindheit verbrachte ich viele Jahre lang bei meinen Großeltern in Süddeutschland. Zwischen meinem dritten und siebten Lebensjahr sah ich meine Mutter nur an den Wochenenden und in den Ferien. Sie machte ihre Schauspielausbildung in Hamburg und ich erinnere mich noch, dass ich in dieser Zeit häufig krank wurde, weil ich sie vermisste. Als sie von Hamburg nach Süddeutschland zurückkehrte, dauerte es Jahre, bis ich wieder Vertrauen zu ihr fasste und wir uns zusammenrauften. Sie hatte mich im Stich gelassen, und das ließ ich sie auch spüren. Lenny rief mich bisweilen an oder schickte mir Pakete mit Rock-CDs und irgendwelchem Tinnef, meistens an meinen Geburtstagen. Ich war für ihn erreichbar, aber umgekehrt galt das nicht. Sie habe mich vor ihm schützen wollen, gestand mir meine Mutter später, sie war überzeugt davon gewesen, dass sie mich in Gefahr gebracht hätte, wenn ich ihm als Kind begegnet wäre. An die Telefongespräche mit Lenny erinnere ich mich nicht und auch nicht, wann sie begannen. Nur an das Allerletzte erinnere ich mich genau. Mit ihm brach der Kontakt ab.

„Ich bin im Gefängnis“, sagte er mit erstickter Stimme. „Im Gefängnis?“– „Yes.“ Ich hatte in der Schule gerade erst angefangen, Englisch zu lernen und war mir nicht sicher, ob ich richtig verstanden hatte. Aber nach mehrmaligem Nachfragen bestand kein Zweifel mehr. Mein Vater saß im Knast, weil er Dokumente gefälscht hatte, Pässe, Führerscheine, Versicherungspolicen. Er legte auf, und das war es dann. Von heute auf morgen meldete er sich nicht mehr. Ich erinnere mich noch gut daran, wie vor den Kopf gestoßen ich mich nach diesem Telefonat gefühlt hatte, dass es das letzte sein sollte für viele Jahre, war mir natürlich nicht klar in dem Moment. Je mehr Zeit verstrich und er sich nicht bei mir meldete, desto öfter fragte ich meine Mutter nach ihm aus.

Sobibór extermination camp (08).JPG

Die Zerrissenheit meiner Gefühlswelt nahm immer krassere Züge an. Schon mit 11, 12 Jahren war ich für zwei Jahre in Therapie, weil ich mich für den Bruder Jesu gehalten und intensiv mit dem Tod auseinandergesetzt hatte. In meiner Jugend fing ich dann an, meine Umgebung zu terrorisieren: Lehrer, Schüler, Freunde, die Freunde meiner Mutter und natürlich meine Mutter selbst. Ich war gut mit Worten und erkannte schnell die Schwachstellen bei anderen Menschen, in die ich meinen Stachel stach. Ich beschimpfte und erniedrigte meine Mutter: Sie könne nichts und sei ein Niemand, sie habe mich im Stich gelassen und würde es niemals zu etwas bringen. Gleichzeitig fühlte ich mich deswegen schuldig, ich verstand nicht, weshalb ich sie und andere so fertigmachte. Tagelang schloss ich mich ein und weinte, der Dämon in mir ließ mir keine Ruhe. Als meine Mutter es nicht mehr aushielt, sagte sie zu mir, ich solle mein Bündel packen und verschwinden, dann verließ sie hastig die Wohnung. Stunden später kehrte sie zurück und fand mich weinend und zerknirscht am Küchentisch vor. Ich bat sie flehentlich, mich nicht fallen zu lassen, es sei ein Abgrund in mir, den ich nicht verstünde. Sie hielt zu mir.

Sollte meine Suche nun endlich vorbei sein?

So stur und widerspenstig und verletzend ich auch sein konnte, auch meine Freunde hielten zu mir. Sie scheuten keinen Konflikt und boten mir Paroli, andererseits gaben sie mir zu verstehen, dass sie meinen Eigensinn auch schätzten. Wenn ich wollte, konnte ich sehr charmant sein. Ich bin sehr direkt und habe einen sarkastischen Humor, das hat es mir immer leicht gemacht, mit Leuten in Kontakt zu kommen. Außerdem spielte ich Gitarre und war ein leidenschaftlicher Entertainer. Seit meinem elften Lebensjahr war ich in verschiedenen Theatergruppen, dort und durch die Musik schaffte ich es immer wieder, meine widersprüchlichen Gefühle aufzulösen.

—————————————————————

Grafikquellen       :

Oben        —      Historic sign at the railway spur in Sobibor. Compare with present-day sign of the Sobibor Station at the Internet Archive.

——————————

2.) Von Oben          —        John Demjanjuk hört seinen Urteilspruch in Jerusalem. Todesstrafe

 John Demjanjuk hearing his death sentence. Demjanjuk Trial Jerusalem

—————————–

Unten     —        Sobibór german extermination camp… ( Deitsches Nernichtungslager)

Abgelegt unter Bildung, Deutschland, Kriegspolitik, Religionen | Keine Kommentare »

Stadtgespräch aus Köln

Erstellt von DL-Redaktion am 31. Dezember 2019

Drohungen gegen Journalisten –
Nennt sich Meinungsfreiheit

Bennypic.jpg

Von Alexander Nabert

Ein Journalist hat das Pech, über Nacht zur Zielscheibe von Nazis zu werden. Und sein Sender? Lässt ihn mit dem Mob lange alleine.

Wegen einer sarkastischen Bemerkung versuchen Neonazis gerade einen Journalisten einzuschüchtern. Seit Samstag erreichen Danny Hollek, einen freien Mitarbeiter der „Aktuellen Stunde“ des WDR Gewalt- und Todesdrohungen. Und der Sender reagiert nur zögerlich.

Anlass ist ein Tweet von Hollek zur Debatte rund um ein satirisches Kinderlied im WDR. Im Lied hieß es unter anderem: „Oma ist ’ne Umweltsau“, was viel überzogene Ablehnung erfuhr, bis der WDR vor rechten Protesten einknickte und das Video des Liedes löschte. Hollek schrieb: „Eure Oma war keine Umweltsau. Stimmt. Sondern eine Nazisau.“

In Hunderten Kommentaren und Postings in den sozialen Netzwerken und auf rechtsradikalen Websites wird seitdem über Hollek hergezogen. Auch der WDR als Arbeitgeber von Hollek wird adressiert. Der Mob will, daran lässt er keinen Zweifel, den Journalisten arbeitslos sehen. Mindestens.

Der Hass bleibt dabei nicht digital. Der stellvertretende Landesvorsitzende der neonazistischen Kleinpartei Die Rechte, ­Michael Brück, verbreitete ein Foto von sich, auf dem er angeblich vor dem Elternhaus des Journalisten steht. „Hausbesuch bei der Familie von WDR-Antifajournalist Danny Hollek“, schreibt der Neonazi, der bis zu ihrem Verbot eine Führungsfigur der gewalttätigen Organisation Nationaler Widerstand Dortmund war und über einen Onlineversandhandel die militante Neonaziszene mit Sturmhauben und Ähnlichem versorgt. Eine ernsthafte Bedrohung.

Oma war kein Nazi

Mittlerweile ist es fast an der Tagesordnung, dass Journalisten – insbesondere solche, die zum rechtsextremen Milieu recherchieren – heftig bedroht werden. Erst im November organisierten Neonazis eine Demonstration vor dem Wohnhaus eines NDR-Mitarbeiters in Hannover. Doch dort gab es breite Solidarität für den betreffenden Kollegen, auch aus dem Sender.

Im Fall von Hollek hingegen schrieb die „Aktuelle Stunde“ auf Twitter: „Der betroffene Mitarbeiter […] hat den Tweet von seinem privaten Twitter-Account abgesetzt. Wir distanzieren uns scharf von Form und Inhalt.“ Zur Bedrohung ihres Mitarbeiters durch Nazis twitterte die „Aktuelle Stunde“ zunächst nichts. Stattdessen hieß es am Sonntag, man habe mit Hollek gesprochen. Und: „Aus unserer Sicht ist zu dem Thema nun alles gesagt.“

Quelle      :         TAZ        >>>>>        weiterlesen

—————————————————————

Grafikquelle     :        The photograph shows the cast of the second musical „Benny, Maja und die Zeitbanditen“.

Abgelegt unter Bildung, Feuilleton, Kultur, Medien | Keine Kommentare »

Defender 2020:

Erstellt von DL-Redaktion am 27. Dezember 2019

Mit Leopard, Tiger und Fuchs gegen die angreifenden Wildschweine!

BERET CEREMONY.jpg

Quelle      :          Scharf   —   Links

Von Dr. Nikolaus Götz

Die westeuropäische Bauernschaft schlottert schon vor Angst vor dem bevorstehenden Angriff der Wildschweine! Nicht die ewig ’bösen’ Russen kommen, diese todbringenden Nachfahren der germanischen Wikinger, sondern die Gefahr der Afrikanische Schweinepest (ASP) steht vor den Toren Westeuropas und droht mit der totalen Vernichtung dieses Wirtschaftszweiges der Ernährung. Aus dem tiefen Osten kommt diese neue Bedrohung der europäisch-christlichen Leitkultur, und die alte Geisel Gottes ’BSE’ reincarniert sich neu als ’ASP’. Diese grunzenden, ungezähmt anstürmenden, wilden Horden von Schweinen in einer endlich wieder ’freien Naturlandschaft’, jedoch der deutschen Sprache nicht mächtig, nehmen keine Rücksicht auf das gelobte Land der Dichter und Denker. Wie furchtbar! Wie schrecklich! Ach, wie grausam!

Entlang der westeuropäischen Außengrenze der EU gegen Osten werden so präventiv, unbemerkt von den Mainstream-Medien, wieder Zäune errichtet und auch die alten Nationalstaaten, gar Provinzen, im Griff von egomanischen Patrioten, versuchen verzweifelt erneut schnell eigene Grenzanlagen zu installieren, weswegen die „gute, alte Mauer“ mit ihren Selbstschussanlagen fast eine Renaissance erlebt. Doch solche unkoordinierten Schutzmaßnahmen helfen nicht, da bekannter Weise selbst „der antifaschistische deutsche Schutzwall“ Löcher hatte! Und jetzt ’stehen’ diese Schweine mit ihrem Todesvirus schon 40 km vor Deutschland (Siehe: top agrar.com/schwein (news)!

Der Schaden für das Gemeinwesen ist immens! Bisher mussten nicht nur die Baukosten für die Zäune regional gestemmt werden, sondern es galt auch die Bezahlung des Bewachungspersonals wie das der Reparaturtrupps zu tragen. Doch leider waren alle Anstrengungen und Mühen besorgter Regionalpolitiker vergeblich, weswegen die Frage gestattet sei: „Wer endlich wird der aus dem Osten kommenden Gefahr ein „Halt!“ gebieten?“ Uff! Da haben wir Europäer, wir Deutsche ja Glück! Jetzt kommt nämlich „Defender 2020“ (dt.: Verteidiger/Verteidigerin 2020) und Deutschland hat sogar die Führung der NATO-Speerspitze übernommen (Siehe: spiegel.de/politik/ausland/defender-2020).

Der Leopard der führt die Jagd nun an

Während die aufgeklärte Mehrzahl aller Deutschen „Krieg als Mittel der Politik“ ablehnt, lieben die deutschen konservativen d.h. ’bewahrenden’ Parlamentarier das Säbelrasseln und die „Sandkastenspiele“ der Militärs, weswegen diese ’Volksvertreter’ im Deutschen Bundestag jedes Jahr dem „Krieg“ stets zustimmen. Diese „Männer und Frauen“ wissen, dass sie nie nicht selbst „an die Front“ müssen! ’Verteidiger/Verteidigerin 2020’ heißt also das neuste NATO-Spiel der Militärs und bringt nach 25 Jahren endlich wieder einmal alle friedlieben Kräfte des Planeten Erde zusammen. An deren Spitze steht für die BRDeutschland nun eine Saarländerin, die ’AKK’ (Annegret Kramp-Karrenbauer ), die seit Juli 2019 ’Bundesangriffsministerin’ ist und die selbst noch nie, dank der Gnade ihrer späten Geburt, einen Krieg erlebt hat! Wäre da der laufende Angriff dieser Schweine nicht ein lohnendes, zivilisatorisch humanes Abwehrziel für eine rein defensive Armee, wie es die NATO ja ist?

Und so würden diese alliierten Friedenstruppen, unter dem Kommando dieser deutschen „Speerspitze“, mit Leopard, Tiger und Fuchs gegen diese Wildschweine ausrücken. Bestimmt würden sie diese Schweine in Polen ’vertreiben’ und weiter diese ’Pest’ bekämpfen, bis ins Land, wo einst die christlichen Ordensritter ein ’Bollwerk der Menschlichkeit’ errichteten: im Feudalismus und mit der üblichen Leibeigenschaft für das Volk! Diese aktuellen Schweine aber würden alle – früher oder später – verrecken: entweder am Gestank der hochgiftigen Abgase der dröhnenden Dieselmotoren oder an den in die Landschaft verschossenen uranhaltigen Übungsgeschossen. Vielleicht würden sie sofort auch einfach tot umfallen, hingestreckt durch einen plötzlichen Herzinfarkt! Bestimmt würden diese Schweine auch jämmerlich eingehen, an der ewig strahlenden Hinterlassenschaft einer nun kontaminierten, mit tiefen Furchen durchzogenen Ackerlandschaft, zeitlich kurz bevor diese Feinde aus dem Osten das zu schützende westeuropäische Territorium erreichten.

Jedoch erfordert der allein durch die friedensliebenden Militärs angerichtete ökologische Schaden an Mensch und Umwelt einen sofortigen Abbruch sämtlicher geplanter Militärhandlungen. Zwar demonstriert die ’Deutsche Friedensbewegung’ schon gegen ’Defender 2020’, doch wer aus den Völkern hört schon ihre Signale? Mit einem erneuten massenhaften Protest der bundesdeutschen ’Fridays for Future’ – Bewegung, gegen die durch das Manöver ’Defender 2020’ gemachten und direkt zu sehenden ökologischen Schäden, könnten die bisher nur schulschwänzenden ’Jugendlichen’ beweisen, dass die neue Jungendgeneration wirklich etwas für den Erhalt der – auch ihrer – Natur tun will. Und wie frei oder wie manipuliert wird der Presseverbund der Mainstreammedien über das kommende ökologische Desaster von ’Defender 2020’ berichten? Und die zuschauenden, die ’konservativen Politiker’ in allen Parteien werden wie eben, wie nach den Zweiten Weltkrieg, wieder sagen: „Davon hab ich nix gewuxt!“

Die Schweine zogen sich zurück – nur noch zwei Mützen blieben leer zurück.

Wünschenswert aber wäre für das westeuropäische Wirtschaftssystem, wie für Deutschland speziell, ein größtmöglich angerichteter Schaden. Das Traumergebnis wäre der Totalruin des von der NATO mit ’Defender 2020’ ’befriedeten Territoriums’, da die größtmögliche Zerstörung zwangsläufig zu einem Wirtschaftsboom, ja sogar zu einem ’Wirtschaftswunder’ führen wird (Vgl.: Deutschland im Jahr 1945). Bestimmt würde unsere erfolgreiche AKK (CDU) für ein solches Planziel sorgen, zumal sie als künftige Kanzlerin dann ja auch als individueller Erfolg ihrer Person, die Eliminierung der jetzt noch möglicherweise erfolgenden Schweinepest ’ASP’ aufzuweisen hätte. Auch deshalb sei dem anstehenden NATO-Manöver ’Defender 2020’ viel Erfolg gewünscht! Zweifelnden Kritikern sei noch schnell angemerkt, dass die Saarländer seit dem deutschen Mittelalter nach jedem Krieg stets bei den Siegern waren! Also Hurra, AKK!

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————–

Grafikquellen         :

Oben    —      Wir sind bereit für Blut und Schweiß    —     The men and women of 5th SFAB donned their brown berets for the first time today in a ceremony at JBLM’s Iron Mike statue. The brown color signifies our commitment to „muddy boot“ leadership, to being on the ground at home and abroad working hand in hand with our partner forces on the issues that most affect global security and the preservation of freedom.

Abgelegt unter Bildung, International, Kriegspolitik, Mensch | Keine Kommentare »

40. Todestag: Rudi Dutschke

Erstellt von DL-Redaktion am 24. Dezember 2019

Die Kunst zu provozieren – Vorbild und Feindbild

Von Ralf Pauli

An deutschen Hochschulen wird wieder über die Grenzen der Meinungsfreiheit gestritten. Wie viel Dutschke steckt in heutigen Studi-Protesten?

Vor Semesterbeginn hätte Karim Kuropka nicht für möglich gehalten, dass er wegen seiner hochschulpolitischen Aktivitäten einmal um die eigene Sicherheit fürchten muss. Doch genau das ist diesen Herbst passiert, nach der Rückkehr von AfD-Gründer Bernd Lucke an die Universität Hamburg.

Wegen der tumultartigen Szenen, die sich bei Luckes erster Vorlesung abspielten, stempelte die Bild-Zeitung Kuropka und seine Kommiliton:innen zu „Linksextremisten“. Was dann folgte, veranlasste Kuropka zum Kauf eines Pfeffersprays – und zu einer unheilvollen Vorhersage: „Die mediale Kampagne von rechts erinnert mehr und mehr an die Zeit der 68er.“

Man könnte meinen, an Ku­rop­kas Hochschule wäre man daran gewöhnt, dass Studierende ihre Professoren stören. Schließlich wurde hier, im Hamburger Audimax, im Jahr 1967 das Transparent entrollt, das schnell zum Motto der Studentenproteste wurde: „Unter den Talaren Muff von 1000 Jahren“. Ein Slogan, der nicht nur die Autorität der Hochschulen in Frage stellte, sondern – in Form der Außerparlamentarischen Opposition (APO) – auch die der damaligen Großen Koalition.

Nur: Die gleichen Störaktionen, zu denen schon Studentenführer Rudi Dutschke gegen den Vietnamkrieg oder die Bonner Notstandsgesetze aufrief – Sitzblockaden, Protestmärsche und Sprechchöre – lösen auch heute noch Entrüstungsstürme aus.

Distanzierung von Störaktionen

Und so wird im Jahr 2019 an deutschen Hochschulen nach wie vor über angeblich linksradikale Studierende und eingeschränkte Meinungsfreiheit gestritten. Nicht nur in Hamburg, sondern auch in Göttingen, wo die Antifa nur wenige Tage später eine Lesung von CDU-Politiker Thomas de Maizière verhinderte.

Und zuletzt in Berlin, wo der angekündigte Besuch von AfD-Politikerin Beatrix von Storch bei einer Klimaveranstaltung an der Freien Universität für Wirbel sorgte.

Doch der Reihe nach: Mitte Oktober ruft der AStA der Universität Hamburg, deren Vorsitzender Karim Kuropka ist, zur Demonstration gegen Wirtschaftsprofessor Lucke auf, um auf dessen Rolle beim Aufstieg der AfD, aber auch auf seine neoliberalen Wirtschaftskonzepte hinzuweisen.

Von den gezielten Störaktionen, die zum ­Abbruch der Vorlesung „Makro­ökonomik II“ und einer zweiten Lucke-Vorlesung kurz ­darauf führen, haben sich die Studierendenvertreter:innen umgehend distanziert.

AStA erhält Hassmails

Dennoch treffen bei Kuropka haufenweise Hassbotschaften ein. Ein Facebook-User teilt mit, ein AStA-Gruppenfoto in geschlossenen Nazigruppen geteilt zu haben, damit sie „am eigenen Leib erfahren wohin eure asozialen Methoden führen“.

Ein E-Mail-Verfasser äußert den Wunsch, Kuropka mal über den Weg zu laufen. „Du hast so eine wunderbare, hässliche, Sozi Kanaken Fresse zum reinschlagen.“ Ähnliche Drohungen fallen auch in Göttingen und in Berlin: gegen Mitglieder der Antifa, gegen linke Studierende und auch gegen Klimaaktivist:innen der Fridays for Future.

http://www.ndr.de/kultur/geschichte/chronologie/talare2_v-vierspaltig.jpg

40 Jahre nachdem Rudi Dutschke an den Spätfolgen eines Attentates vom April 1968 gestorben ist, schlägt linken Aktivist:innen, so scheint es, mehr Hass denn je aus dem rechten Lager entgegen. Die Junge Union Hamburg etwa wirft dem Hamburger AStA „totalitäre Züge“ vor, selbst der innerhalb der CDU liberale Politiker Ruprecht Polenz fühlt sich an die 68er erinnert, „wo es pauschal gegen ‚bürgerliche Wissenschaft‘ ging“.

Lucke selbst spricht von „Nazi-Methoden“ und bekommt kräftigen Zuspruch aus seiner früheren Partei. Ein ­AfDler twittert gar: „Die #Linken sind die neuen #Braunen.“

Erfolg für rechte Kampagne

Über diese Anfeindungen wundert sich Karim Kuropka nicht sonderlich. „Das ist die klassische Täter-Opfer-Umkehr der Rechten“, sagt der 32-Jährige. „Das haben wir schon zur Genüge erlebt.“

Was Kuropka, Student der Linguistik und SPD-Mitglied, aber ärgert: dass die Rechten mit ihrer Kampagne Erfolg haben: „Alle reden jetzt über Meinungsfreiheit und nicht über die Verantwortung, die Herr Lucke für das gesellschaftliche Klima in Deutschland trägt.“

Und dann holt Kuropka aus, um den Bogen zu schlagen von Dutschke und Springer zur AfD und zu rechten Blogs wie ­„Tichys Einblick“; von den Mechanismen der Aufmerksamkeit zum Dilemma für linke Hochschulgruppen in einer, wie er sagt, „überwiegend rechten“ Medienlandschaft. „Ein Lucke ruft einfach bei der Welt an und hat seine Schlagzeile. Die Studierenden dringen mit ihren Botschaften aber oft nicht durch.“

Deshalb verteidigt Kuropka nicht nur den Protest: Er hält ihn für notwendig – auch wenn dafür mal eine Vorlesung ausfallen muss.

Dutschke wollte Stadtguerilla

Vielleicht liegt hier das sichtbarste Vermächtnis von Rudi Dutschke: die Kunst der Provokation. Dutschkes Motto „Ohne Provokation werden wir überhaupt nicht wahrgenommen“ war maßgeblich für die Sichtbarkeit der Subversiven Aktion oder des Sozialistischen Deutschen Studentenbunds (SDS).

In der Zeit sprach Dutschke auch als Erster von der Notwendigkeit einer „Stadtguerilla“ nach dem Vorbild der kommunistischen Tupamaros in Uruguay. Später distanzierte sich Dutschke scharf vom Terror von RAF & Co.

Quelle      :           TAZ            >>>>>           weiterlesen

———————————————-

40. Todestag von Rudi Dutschke

Eine Frage der Haltung

Voormalige Westduitse studentenleider Rudie Dutschke, geeft lezing op Katholieke, Bestanddeelnr 928-4129.jpg

Kommentar von Bernd Pickert

Man muss Dutschke 40 Jahre nach seinem Tod nicht lesen – wohl aber sich sein Prinzip aneignen: Sich mit dem Gegebenen nicht abzufinden.

Am Heiligabend vor 40 Jahren starb Rudi Dutschke an den Spätfolgen des Attentats. Im April 1968 hatte der verhetzte Hilfsarbeiter Josef Bachmann den bekanntesten Repräsentanten der linken Studierendenbewegung in Berlin niedergeschossen. Ein rechter Mordanschlag. 40 Jahre später frustrierend aktuell.

Als Dutschke starb, war der Autor dieser Zeilen 14 Jahre alt, war dabei, sich als linker Schüler zu politisieren, und überlegte kurz, zur Trauerdemonstration auf dem Kurfürstendamm zu gehen.

Ich bin dann doch nicht gegangen, warum, weiß ich nicht mehr. Wie die meisten meiner Generation wusste ich damals über Dutschke eigentlich nichts – ich kannte ihn vor allem aus dem Wolf-Biermann-Lied „Drei Kugeln auf Rudi Dutschke“, das meine Eltern auf ­Vinyl hatten. Aber Dutschke oder seine Theorien waren keine Bezugsgrößen.

Dachte ich.

Als junge Linke halfen wir, besetzte Häuser in Kreuzberg zu renovieren, und gingen natürlich auf alle Demos. Wir waren verängstigt ob der Gefahr des Atomtods und deshalb ­engagiert in der Friedensbewegung und in Gorleben. Wir waren fasziniert vom Sieg der Revolution in Nicaragua und arbeiteten dort in Kaffee- und Baubrigaden.

Quelle        :         TAZ         >>>>>           weiterlesen

—————————————————————

Grafikquellen         :

Oben     —         Ehrengrab auf dem St Annen-Kirchhof, Dahlem

———————————–

2.)von Oben     —       Kulturgeschichte II

Die BRD bis zur Wiedervereinigung

—————————–

Unten         ..       Collectie / Archief : Fotocollectie Anefo Reportage / Serie : [ onbekend ] Beschrijving : Voormalige Westduitse studentenleider Rudie Dutschke, geeft lezing op Katholieke Hogeschool te Tilburg Datum : 12 februari 1976 Locatie : Noord-Brabant, Tilburg Persoonsnaam : Dutschke, Rudie Fotograaf : Peters, Hans / Anefo Auteursrechthebbende : Nationaal Archief Materiaalsoort : Negatief (zwart/wit) Nummer archiefinventaris : bekijk toegang 2.24.01.05 Bestanddeelnummer : 928-4129

Abgelegt unter APO, Berlin, Bildung, Mensch, Opposition | Keine Kommentare »

Tweet von Greta Thunberg

Erstellt von DL-Redaktion am 19. Dezember 2019

Advent, Advent, das Internet brennt

Eine Kolumne von

Die Aufregung um den Bahn-Tweet von Greta Thunberg ist verflogen – die Debatte war wieder mal unerträglich. Doch die nächste Eskalation kommt bestimmt. Vielleicht ja schon an Weihnachten.

Die Greta-Bahn-Aufregung erträgt bereits seit Tagen niemand mehr, nicht einmal als Meta-Greta-Thema. Weil sie ein sozialmediales wie redaktionelles Trauerspiel künstlicher Aufregung war. Es handelte sich um die Simulation einer eigentlich notwendigen Klimadebatte. Also eine Ersatzdebatte um ein Symbol, bei dem man Projektionen, Gefühlen und Schuldzuweisungen freien Lauf lassen konnte, ohne auf nervige Fakten zu Klima und Kapitalismus achten zu müssen. Oder gar zu differenzieren.

Doch es wird garantiert wieder geschehen, und zwar vermutlich so:

Zu Weihnachten postet Greta Thunberg auf Twitter einen schwedischen Weihnachtsgruß samt Foto einer Kerze am Weihnachtsbaum: „God Jul!“. In den ersten Sekunden bleibt es geradezu auffällig ruhig. Nur wenige Tausend Beschimpfungen und Drohungen von mittelalten Autofahrern trudeln ein. Sigmar Gabriel mahnt die SPD-Spitze routiniert, das Deutsche Auto nicht auf dem Klimaaltar zu opfern, bloß weil eine durchreisende Zopfträgerin ärztlich unbehandelte Visionen twittert. Aber dann eskaliert es.

Das eigens eingestellte Greta-Team der Deutschen Bahn lädt sie in einer Erstreaktion auf Twitter ein, Weihnachten „ganz bodenständig im stehenden Zug zu feiern“, wie es gute deutsche Pendlertradition sei. Die Kerze müsse sie aber weglassen. Der Tweet schließt mit dem vom Humorbeauftragten der Bahn genehmigten, ersten Zwinkersmiley eines deutschen Staatsunternehmens sowie einem Link auf das PDF der 400-seitigen Brandschutzverordnung der Bahn samt Bußgeldkatalog für die Entzündung einer offenen Flamme in geschlossenen Zügen. Per Twitter kündigen 3000 empörte Leute ihre Bahncard 25.

Der Wutwetterwart Jörg Kachelmann attackiert Greta frontal: Eine Kerze sei in Sachen Klima das Allerschlimmste, was man überhaupt tun könne, außer vielleicht mit einer Saturn-V-Rakete einen Holzofen kaufen zu fahren. Der Rußausstoß je Kilojoule Energieleistung sei bei Kerzen höher als bei einem SUV. Als eine Professorin für Kerzenwissenschaft andeutet, dass er sich eventuell verrechnet haben könnte, beschimpft Kachelmann sie, ihre Familie, ihre 150 Follower, ihre Universität und mehrere Personen mit ähnlichen Profilbildern als „dumm“, „knalldumm“ und „galaktodumm“.

Franziska Giffey wirft Greta in der „Bild“-Zeitung vor, ihre Doktorarbeit schlampig verfasst zu haben. Sigmar Gabriel wirft Giffey vor, ständig unaufgefordert über die Medien Politik zu machen. Sie solle sich lieber darum kümmern, dass die SPD endlich wieder von einer starken Hand geführt werde.

Bei „Maischberger“, im „Focus“ und im eilig produzierten „Brennpunkt“ beschwert sich Hans-Georg Maaßen zunächst, dass kluge, konservative Stimmen wie seine aus der Öffentlichkeit verbannt würden. Dann beschuldigt Maaßen Greta der Hetze gegen Andersdieselnde. Als Experte für links- und öko-extremistische Codes erkenne er in der Kerze die Aufforderung, Autofahrer anzuzünden. Weil eine sozialdemokratische Landtagsabgeordnete Gretas Tweet gelikt hat, empfiehlt er dringend die Einrichtung eines Untersuchungsausschusses gegen „linksradikale Kräfte in der SPD“. Die Morddrohungen der „Atomwaffendivision“ gegen Greta bezeichnet er als „verständliche, trotz des etwas schärferen Tones teilweise sogar gerechtfertigte, zutiefst bürgerliche Unmutsbekundungen“. Der Name zeige ja schon, dass es sich um Witzbolde handele. Er wisse aus zuverlässiger Quelle, dass die Gruppierung gar nicht über Atomwaffen verfüge und auch die Division allenfalls rudimentär beherrsche.

Die Grünen danken Greta für ihr bisheriges, eindeutig von den Grünen inspiriertes Klimaengagement, aber tadeln sie für ihre „beschämende Baumfeindlichkeit“. Die jährliche Rodung der Weihnachtsbäume gehöre als „institutionalisierter Baummassenmord“ zu den schlimmsten menschengemachten Naturkatastrophen. Als Alternative zum klassischen Weihnachtsbaum empfiehlt die Partei das mit einer Energiesparbirne beleuchtete Foto einer Zwergfichte von 1987 oder den temporären Familienumzug per S-Bahn in einen emissionsarmen Nadelwald.

Wp10 20110115 IMG 9974.jpg

Die konservative Tageszeitung „Die Welt“ recherchiert, dass Gretas Kerze entweder aus Bienenwachs und damit nicht vegan, wahrscheinlich aber eher aus Stearin ist. In einem furios ausgeruhten, hoch emotionalen Erklärstück legt die „Welt“ dar, dass Stearin aus Palmöl hergestellt wird und beschuldigt Greta, quasi eigenhändig Orang-Utans ermordet zu haben. Mit einer so aufwendigen wie bunten Statistik beweist die „Welt“ der Welt und vor allem sich selbst, dass das Menschenaffentötungsäquivalent einer einzigen schwedischen Palmölkerze rund 200 Runden auf dem Hockenheimring mit einem Porsche 911 ohne Katalysator entspricht.

Quelle          :     Spiegel-online           >>>>>         weiterlesen

——————————————————–

Grafikquellen        :

Oben       —          Twitter

Greta ThunbergVerifizierter Account @GretaThunberg 14. Dez.

Traveling on overcrowded trains through Germany. And I’m finally on my way home!

—————————

2.) von Oben        —         EU parliament (April 2019)

Abgelegt unter APO, Bildung, International, Umwelt | Keine Kommentare »

Schland – legale Sterbehilfe

Erstellt von DL-Redaktion am 16. Dezember 2019

Von den Herren über Leben und Tod

Von Bernd Hontschik – Chirurg und Publizist.

Deutschland kennt «Nichtanwendungserlasse». Sie hebeln Gerichtsurteile aus. Zum Beispiel die legale Sterbehilfe an Schwerstkranke.

Vor kurzem hat mein Demokratieverständnis einen Knacks bekommen. Ich habe einen neuen Begriff kennengelernt: den Nichtanwendungserlass. Davon hatte ich noch nie gehört. Hinter diesem Wort verbirgt sich die erstaunliche Möglichkeit der Regierung, die Gültigkeit letztinstanzlicher Gerichtsurteile auf einen Einzelfall zu beschränken, also deren allgemeine Anwendung zu verhindern. Niemand kann sich daher auf ein solches Urteil berufen. Bisher wurde der Nichtanwendungserlass ausschliesslich im Bereich der Finanzverwaltung eingesetzt, um den Staat vor finanziellen Einbussen zu schützen. Aber dann kam Jens Spahn.

Dieser Bundesgesundheitsminister sorgt nicht nur für ständig neue Gesetze, sondern tritt auch geltendes Recht mit Füssen und missachtet es, wenn es nicht in sein Weltbild passt.

Das Bundesverwaltungsgericht hatte im März 2017 das Bundesinstitut für Arzneimittel und Medizinprodukte (BFArM) letztinstanzlich dazu verurteilt, die Abgabe von potentiell tödlich wirkenden Betäubungsmitteln an Schwerstkranke in extremen Ausnahmefällen zuzulassen. Es ging dabei um das Medikament Pentobarbital, das vor etwa hundert Jahren entdeckt worden ist. Pentobarbital wurde lange Jahre als Schlafmittel verschrieben. Es machte aber rasch abhängig, und plötzliches Absetzen führte zu schweren Entzugserscheinungen bis hin zum Delirium. Während das Mittel beispielsweise in der Schweiz von jedem Arzt verschrieben werden kann, ist das in Deutschland inzwischen untersagt, denn es wird in der Sterbehilfe eingesetzt. In höherer Dosierung tritt nach dem Einschlafen ein Herz- und Atemstillstand ein.

Um dieses Medikament ging es in dem Prozess vor dem Bundesverwaltungsgericht. Für wenige, eng umschriebene schwerste Krankheitszustände hat das Gericht die Verschreibung von Pentobarbital zugelassen. Im Bundesgesundheitsministerium gilt aber die eigene Moral und Meinung mehr als eine höchstrichterliche Entscheidung. Das BFArM wurde vom Ministerium angewiesen, alle bisher eingegangenen, etwas mehr als hundert Anträge gar nicht zu bearbeiten. Die Schwerstkranken liess man in dem Glauben, dass ihre Anträge und Gutachten, für die sie ihre wenige Kraft, ihre beschränkte Zeit und viel Geld investiert hatten, entsprechend den strengen Vorgaben des Urteils geprüft würden. Ein Staatssekretär schrieb sogar, es sei nicht Aufgabe des Staates, Selbsttötungshandlungen zu unterstützen, dies sei mit den Grundwerten unserer Gesellschaft nicht zu vereinbaren. Das ist purer Zynismus. Von einer ‚Unterstützung’ durch den Staat war nie die Rede. Es ging einfach nur um die Möglichkeit, ein bestimmtes Medikament zu erhalten.

Nur selten hatte ich bei meiner ärztlichen Tätigkeit mit Menschen zu tun, die ihrem Leben ein Ende setzen wollten. Sie alle waren Menschen, die angesichts der aussichtslosen Prognose ihrer schweren Erkrankung, mit unvorstellbaren Schmerzen und allumfassenden Einschränkungen keinen Sinn mehr in ihrem Weiterleben finden konnten. Nur ganz wenige Menschen sind vom Schicksal so sehr geschlagen. In unserem ganzen grossen Land mit seinen mehr als 83 Millionen Einwohnern sind es gerade einmal einhundert Betroffene, die dieses erlösende Medikament brauchen. Mehr als zwanzig der Antragsteller sind inzwischen verstorben. Ich möchte nicht wissen, unter welchen Umständen. Minister und Bürokraten fügen jenen, die noch am Leben sind, jeden Tag weiteres Leid zu. Das muss ein Ende haben.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Der Chirurg Bernd Hontschik ist u.a. Mitglied bei der Thure von Uexküll-Akademie für Integrierte Medizin AIM, bei MEZIS und bei der Ärzte für eine Verhütung eines Atomkriegs IPPNW, ist im Beirat der Akademie Menschenmedizin AMM und im wissenschaftlichen Beirat der Fachzeitschrift «Chirurgische Praxis». Kolumnen von Hontschik erscheinen regelmässig in der Frankfurter Rundschau. Sein neuestes Buch: «Erkranken schadet Ihrer Gesundheit», 2019, Westend Verlag.

—————————–

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

————————————————————

Grafikquellen         :

Oben      —        Bernd Hontschik fotografiert von Barbara Klemm (2009)

Abgelegt unter Bildung, Europa, Gesundheitspolitik, Hessen | Keine Kommentare »

Verkehrsmittel der Welt

Erstellt von DL-Redaktion am 14. Dezember 2019

Beinahe eine Ode an die Bahn

9480 1440 314-1 D-DB.jpg

Wem nutzen die Wagons wenn der Zug nicht kommt, heute nicht, morgen, übermorgen ?

Eine Kolumne von

Bahnfahren könnte so schön sein und wäre auch noch gut fürs Klima, wären da nicht die teils museale Technik und die Politik mit ebensolchen Prioritäten.

Dies ist keine der in sozialen Medien allgegenwärtigen Beschwerden über die Deutsche Bahn, sondern das genaue Gegenteil. Es ist eine Liebeserklärung an das wunderbarste Verkehrsmittel der Welt. Allerdings keine vorbehaltlose, weil aus digitaler, technologischer und historischer Sicht verfasst.

In wenigen Tagen werden die Millionen Bahnkunden, die Tickets über App oder Webseite buchen, eine fabelhafte Zumutung erleben: Sie müssen eine Sicherheitsfrage akzeptieren, also eine Frage, mit deren Antwort man das Passwort umgehen kann.

Sicherheitsfragen sind in der IT, was in der Körperpflege der Vierzigerjahre die radioaktive Zahnpasta war (hier eine Werbung des Produkts „Doramad“). Einige Zeit hielt man sie für eine tolle Erfindung, bevor klar wurde: Nee. Bei der Bahn beginnt es damit, dass die sechs auswählbaren Sicherheitsfragen inhaltlich etwa aus der Zeit von Doramad stammen dürften. Die erste: „Wie lautet der Geburtsname Ihrer Mutter?“

———————————

Möchte mal wissen, wer der @DB_Bahn zu diesem antiquierten Scheiß geraten hat. pic.twitter.com/5T6Lko90Sr

— Hendrik Wieduwilt (@hwieduwilt) 10. Dezember 2019

———————————

Im Jahr 2019 davon auszugehen, dass alle Mütter verheiratet sind, den Namen des Ehemanns angenommen haben und deshalb ihre Geburtsnamen ein unknackbares Geheimnis darstellen, ist für sich genommen bereits sexistischer, gestriger Quark. Und doch nur der Anfang. Denn vier weitere der sechs Fragen zielen auf völlig dysfunktionale Antworten: Das Lieblingsbuch, der Lieblingsfilm, der Name der ersten Lehrerin oder des ersten Lehrers, der Name der erstbesten, pardon: ersten, besten Freundin.

Vielleicht sollte jemand der Bahn mitteilen, dass soziale Medien existieren, in denen man solche Informationen für sehr, sehr viele Menschen recherchieren kann. Erst recht, wenn man ohnehin im weiteren Umfeld einer Person unterwegs ist. In Zeiten von Cybermobbing an Schulen eine Passwort-knackende Frage anzubieten, die ein paar Dutzend Mitschüler in jedem Fall kennen, weil sie die gleiche Erstlehrkraft hatten, erscheint nur mäßig clever.

Der Quatsch mit dem Passwort

Die sechste Sicherheitsfrage ist noch absurder: „Wie lautet die Nummer einer ihrer Kundenkarten oder Ausweise?“ Man muss sich den Sinn von Passworten vergegenwärtigen. Es handelt sich um nichtdingliches Zugangswissen, das nicht, wie etwa ein Schlüssel oder eine Kreditkarte, geklaut werden kann. Wer mit dieser Sicherheitsfrage seine Brieftasche verliert, hat dann gleich auch seinen Bahnaccount verloren. Da hätte man den Quatsch mit dem Passwort auch gleich lassen können.

Der Tech- und Rechtsjournalist Hendrik Wieduwilt nannte die Sicherheitsfrage auf Twitter „antiquierten Scheiß“. Ich habe selten eine derartige Beschönigung in digitalen Dingen gehört. Denn ganz nebenbei sind solche Sicherheitsfragen auch ein Verstoß gegen die DSGVO. Wenn man nicht – haha – seinen ersten Lehrer vorher fragt, ob man seinen Namen verwenden darf und dessen schriftliche Erlaubnis an die Bahn mitschickt.

Wp10 20110115 IMG 9974.jpg

Das alles könnte eine schlechte digitale Anekdote sein, wenn dahinter nicht ein Muster stünde, das die Deutsche Bahn zu dem gemacht hat, was sie heute ist: Eine technologische Sanierungsruine, die nur deshalb noch einigermaßen funktioniert, weil Hunderttausende bewundernswerte Mitarbeitende kräftezehrende Strapazen aller Art ertragen. Ja, meine Liebe zur Bahn bezieht sich auf die, die dort arbeiten. Auf die Technik definitiv nicht.

Quelle       :          Spiegel-online             >>>>>         weiterlesen

————————————————————–

Grafikquellen       :

Oben     —          DB 1440 314 enters Wuppertal-Unterbarmen. This train with 1440 308 is bound to Hagen. DB class 1440 is a version of Alstom Coradia Continental consisting of three parts: 1440 3xx + 1441 8xx + 1440 8xx.

——————————–

Unten       —       Sascha Lobo; 10 Jahre Wikipedia; Party am 15.01.2011 in Berlin.

Abgelegt unter Bildung, Finanzpolitik, Regierung, Wirtschaftpolitik | Keine Kommentare »

Zum Mordfall Walter Lübcke

Erstellt von DL-Redaktion am 13. Dezember 2019

Mutmaßlicher Mörder übte bei Reservisten das Schießen

+Postplatz Dresden - Glasdach und Werbefläche - Bundeswehr - Handwerker gesucht - Gas, Wasser, Schiessen - Bild 002.jpg

Von , , und

Der Hauptverdächtige im Mordfall Lübcke, Stephan E., hatte keine Erlaubnis zum Waffenbesitz. Trotzdem trainierte er bei einem Schützenverein an scharfen Schusswaffen.

„Achtung Lebensgefahr“ steht in roten Buchstaben auf einem Schild: „Schießsportanlage“. An der Fassade des zweistöckigen Hauses gleich daneben prangt ein rundes Wappen mit gekreuzten Gewehren, Pistolen, Armbrust und Eichenlaub. Es ist das Wappen der Schützengesellschaft zu Grebenstein 1553 e. V., die hier außerhalb der nordhessischen Kleinstadt Grebenstein zwischen grünen Feldern ihren Vereinssitz hat. Auf dem nach allen Seiten abgezäunten Schießstand hinter dem Vereinsheim hat auch Stephan E., der mutmaßliche Mörder des Regierungspräsidenten Walter Lübcke, trainiert.

Noch im Oktober 2018, sieben Monate vor dem Mord an dem hessischen CDU-Politiker, nahm E. an einer Schießübung auf dem Gelände der Schützengesellschaft zu Grebenstein rund 20 Kilometer nördlich von Kassel teil. Das belegen Anwesenheitslisten des Schießstandes, die ZEIT ONLINE einsehen konnte. Nach Recherchen von ZEIT ONLINE war E. kein Mitglied der Grebensteiner Schützengesellschaft, sondern nutzte deren Schießanlage als Gast einer anderen Schützengruppe: der SSG Germania Cassel.

Bisher war nur bekannt, dass der 46-Jährige als Referent für Bogensport in einem anderen Kasseler Schützenverein aktiv gewesen war. Dennoch konnte Stephan E. in den vergangenen Jahren auch an scharfen Waffen trainieren, dank der SSG.

Die SSG ist selbst unter Sportschützen in der Region nur wenigen bekannt, sie gilt als Gemeinschaft für Reservisten der Bundeswehr. Die Gruppe betreibt keine Webseite und ist auch nicht beim Amtsgericht Kassel im Register als Verein eingetragen. Außer einzelnen Hinweisen auf Teilnahmen von SSG-Mitgliedern bei Wettkämpfen anderer hessischer Schützenvereine, finden sich keine Spuren zu der Schießsportgruppe. Nach Angaben des Verbandes der Reservisten der Deutschen Bundeswehr handelt es sich bei der SSG Germania Cassel nicht um eine offizielle Reservistenkameradschaft. Keiner der Schießsport-Dachverbände in Deutschland bestätigte, dass die Gruppe zu seinen Mitgliedsvereinen gehört.

Eine Schützengruppe, die sich versteckt

ZEIT ONLINE hat über den Vorstand der Grebensteiner Schützengesellschaft eine Anfrage an die SSG Germania Cassel gerichtet, die wochenlang unbeantwortet geblieben ist. Der Vorsitzende der Schützengesellschaft Grebenstein Jörg Rohrbach hat zwar regelmäßig in seiner Funktion mit der SSG zu tun und assistiert dem Verein nach eigenen Angaben auch auf dem Schießplatz. Nähere Auskünfte zu der kleinen Schützengruppe aber lehnte er mit Verweis auf den Datenschutz ab.

So findet sich bislang niemand, der sich zum Training des späteren mutmaßlichen Mörders Stephan E. bei der SSG äußern will. Mitglieder der gastgebenden Grebensteiner Schützengesellschaft bestätigten lediglich, dass er an Übungen der SSG Germania Cassel auf ihrem Schießstand teilnahm. Laut Anwesenheitslisten des Schießstandes war Stephan E. innerhalb von zwei Jahren insgesamt fünfmal dort.

+DVB Haltestelle Altenberger Straße mit Werbeplakat - Bundeswehr macht den Meister. - Bild 001.jpg

Als Sportschützengruppe kann man sich auf Schießständen anderer Vereine einmieten, wenn man keine eigene Anlage unterhält. Der Grebensteiner Verein vermietete seinen Schießstand an die SSG Germania Cassel.

E. war viele Jahre in der hessischen Neonaziszene unterwegs und ist mehrfach für Straf- und Gewalttaten verurteilt worden. Er selbst besaß keine Waffenbesitzkarte und auch keine andere waffenrechtliche Erlaubnis. Das bestätigt sein Verteidiger Frank Hannig. Doch Mitglieder von Schützenvereinen dürfen Gäste zum Training auf den Schießstand einladen, ganz ähnlich, wie es in anderen Sportarten auch üblich ist. Für dieses Probetraining dürfen Schützen ihrem Gast auch Waffen und Munition überlassen, solange eine fachkundige Aufsicht dabei ist. Der Verein muss darüber Buch führen.

Quelle           :          Zeit-online            >>>>>           weiterlesen

—————————————————————-

Grafikquellen         :

Oben       —      Karriere Bundeswehr    +Postplatz Dresden – Glasdach und Werbefläche – Bundeswehr – Handwerker gesucht – Gas, Wasser, Schiessen – Bild 002

Abgelegt unter Bildung, Hessen, Kriegspolitik, Regierungs - Werte | Keine Kommentare »

Stadtgespräch aus Neukölln

Erstellt von DL-Redaktion am 13. Dezember 2019

Hipsterkiez mit Hakenkreuzen
Rechte Anschlagserie in Berlin-Neukölln

Von Malene Gürgen

Die rechten Taten bleiben weitgehend unter dem Radar der bundesweiten Öffentlichkeit. Doch die Opfer wissen ganz genau, wer gemeint ist.

Vielleicht wäre es einfacher, wenn Neukölln in Sachsen läge. Oder wenigstens am östlichen Rand von Berlin. Vielleicht wäre es einfacher, öffentliches Augenmerk auf eine aktuelle, unaufgeklärte rechtsextreme Terrorserie zu lenken, auf mangelnde Ermittlungserfolge und eine mögliche Verstrickung der Sicherheitsbehörden, wenn die Geschichte an einem Ort spielte, von dem man das erwartet: Neonazis, die Anschläge begehen, Polizei und Verfassungsschutz, die mindestens wegschauen.

Aber diese Geschichte spielt in Berlin-Neukölln. Ein Großteil der mehr als 60 Angriffe, Anschläge und Brandstiftungen, die der seit Mai 2016 laufenden Serie zugerechnet werden, ereignet sich dort, wo auch die mutmaßlichen Täter zu Hause sind, im Süden des Bezirks, viel weniger großstädtisch und viel weniger medial bekannt als der Norden. Aber ab und an trifft es auch den Norden, der dem Rest der Republik wahlweise als Hipster-Mekka oder Clankriminalitäts-Gruselmärchen bekannt ist. Zum Beispiel in dieser Woche, als die Fenster eines Imbissrestaurants, eines Spätkaufs sowie ein Treppenhaus großflächig mit Hakenkreuzen und SS-Runen besprüht wurden.

Vielleicht wäre es mit der bundesweiten Aufmerksamkeit auch einfacher, wenn durch diese Anschlagserie Menschen nicht nur eingeschüchtert, finanziell belastet und psychisch zermürbt würden, sondern wenn schon Menschen körperlich zu Schaden gekommen wären, so richtig. Bei Ferat Kocak, kurdischstämmiger Lokalpolitiker der Linkspartei, wäre es damals fast so weit gewesen, in einer Februarnacht 2018, als sein Auto nur ein paar Zentimeter neben der durchs Einfamilienhaus verlaufenden Gasleitung verbrannte.

Der Betreiber des Imbisses, auf dem am Dienstagmorgen große rote Hakenkreuze prangten, ist ein naher Verwandter von Ferat Kocak. Ob sich die Einschüchterung gegen ihn und seine Familie richtet oder allgemein gegen ein migrantisches Neukölln, ob die Täter dieselben waren wie die, die Kocaks Auto anzündeten, werden die Ermittlungen zeigen, würde man gern schreiben. Allein, die Ermittlungen haben in dieser Sache überhaupt noch nie irgendetwas gezeigt, weder jetzt noch bei der letzten Serie vor acht Jahren, als beispielsweise eine Einrichtung der Falken so oft attackiert wurde, dass die Jugendarbeit dort bis heute hinter einem meterhohen Hochsicherheitszaun stattfindet.

Tatort: Wildenbruchstraße

Gedenktafel Wildenbruchstr 10 (Neuk) Günter Bodek.JPG

Die beschmierten Häuser befinden sich in der Wildenbruchstraße, die in der Liste der Tatorte dieser Serie bereits mehrfach auftaucht: 2016 deponierten Unbekannte einen Brandsatz vor einem linken Café, ein weiteres Lokal, das als Treffpunkt linker und migrantischer Gruppen dient, wurde schon zweimal attackiert, zuletzt vor wenigen Wochen. Ebenfalls in der Wildenbruchstraße, Ecke Sonnenallee, befindet sich in einem imposanten Gebäude: die Polizeidienststelle Direktion 5, Abschnitt 54.

Quelle          :           TAZ         >>>>>         weiterlesen

——————————————————————

Grafikquellen           :

Oben         —      Berlin-Neukölln,

This work has been released into the public domain by its author, Alex1011 at German Wikipedia. This applies worldwide.

—————————

Unten          —    Memorial plaque, Günter Bodek, Wildenbruchstraße 10, Berlin-Neukölln, Germany

Abgelegt unter Berlin, Bildung, Religionen, Überregional | Keine Kommentare »

Solidarität unter Studenten

Erstellt von DL-Redaktion am 11. Dezember 2019

 Hallo Hongkong  – Schaut auf diese UNI !

Datei:Eingangsgebaeude TU Darmstadt.jpg

Aus Darmstadt von Kevin Culina

Studierende der TU Darmstadt solidarisieren sich mit den Protesten in Hongkong. Darunter zwei Austauschstudenten aus China. Anderen Landsleuten geht das zu weit.

Es ist eine erstaunliche Kooperation: Lee aus Hongkong, groß und mit Brille, der sagt, dass er für Frieden und Demokratie in Hongkong bete. Und Franklin aus China, etwas kleiner, der schnell und aufgeregt spricht und seine Argumente mit unzähligen Videos zu untermauern sucht. Beide studieren in Darmstadt und sorgen sich um die Zukunft Hongkongs. So sehr, dass sie zu drastischen Worten greifen. „Ich sehe hier, von außen, wie meine Hongkonger Freunde vielleicht vernichtet werden“, sagt Lee und wirkt dabei sehr ergriffen. Die beiden Austauschstudenten haben beschlossen, nicht mehr länger zusehen zu wollen, wie die Demokratie in der Sonderverwaltungszone vor die Hunde geht.

Seit Mai dieses Jahres protestieren immer wieder Zigtausende Hongkonger gegen den zunehmenden politischen Einfluss aus China. Die Peking-nahe Regierung geht gewaltsam gegen die Proteste vor, Demonstrant*innen liefern sich immer wieder Straßenschlachten mit der Polizei. Zum Sinnbild des Protestes wurde die gewaltsame Räumung der Polytechnischen Universität. Weltweit solidarisierten sich Politiker*innen, Künstler*innen und natürlich Hochschulen mit den Hongkonger Studierenden (siehe Spalte).

Einstimmig für Resolution

So auch in Deutschland. Unter anderem in Lüneburg, Heidelberg und Berlin haben sich Studierendenvertretungen solidarisch mit Hongkong erklärt – und dank Lee und Franklin auch in Darmstadt. Mit vier weiteren Mitstreiter*innen initiierten sie eine Resolution. „Solidarität mit Protesten in Hongkong“ heißt sie und wurde am 20. November einstimmig vom Studierendenparlament der Technischen Universität Darmstadt beschlossen. Doch wie auch an anderen Hochschulen sind nicht alle mit dieser Resolution einverstanden.

In Darmstadt sei eine über 10-köpfige Delegation des Vereins der Chinesischen Wissenschaftler und Studenten in Darmstadt (VCWSD) in den Büroräumen der Studierendenvertretung aufgetaucht und habe eine Rücknahme der veröffentlichten Resolution gefordert, erinnert sich AStA-Vorstand Felix Ziegler. „Das Auftreten war teilweise feindselig“, beschreibt er den Besuch. Man habe versucht, im Gespräch den Entstehungsprozess verständlich zu machen, aber „aus dem Gespräch ist keine Versöhnung mehr entstanden“. Die Delegation habe angekündigt, „weiter gegen uns vorgehen zu wollen und Proteste zu planen“, so Ziegler.

Unter ausländischen Studierenden an deutschen Universitäten ist die Gruppe der Chinesen am größten, 42.676 waren es im Wintersemester 2018/19. Wie viele Chinas Rolle in Hongkong kritisch sehen, ist schwer zu sagen. Lee und Franklin zumindest sind zwei von ihnen. Lee studiert Informationstechnik, arbeitet zudem bei einem großen deutschen Technikunternehmen. Seinen vollen Namen will er nicht in der Zeitung lesen. Er hat Angst vor Verfolgung. Anlass dazu geben ihm die hitzigen Diskussionen über die Rolle Chinas in Hongkong, die nicht nur an seiner Hochschule entbrannt sind. So berichtet der AStA der TU Berlin von Morddrohungen nach ihrer Soli-Aktion mit Hongkong. Einschüchtern wolle man sich jedoch nicht lassen.

191001 HK police draws gun against protesters 01.jpg

Auch Franklin ist besorgt. Der 23-Jährige, der eigentlich anders heißt, wohnt erst seit Kurzem in Darmstadt, studiert Maschinenbau. Das Leben in Deutschland ermögliche ihm „persönliche und akademische Freiheit“, die er aus China nicht kenne. In seiner Heimat sieht Franklin derzeit keine Zukunft für sich. „Mir war früh klar, dass ich raus will aus China“, sagt der im Südwesten des Landes aufgewachsene junge Mann. „Das chinesische Regime bedroht die Freiheit der Welt“, sagt er. Und, „wir müssen etwas gegen die aufstrebende Macht der Regierung unternehmen“, insbesondere an einem auch für China so wichtigen Technikstandort wie Darmstadt.

Bei vielen seiner Kommiliton*­innen stoßen Lee und Franklin mit ihrem Anliegen auf offene Ohren. So bewundert das Studierendenparlament in seiner Resolution den „Mut“ der Demonstrant*innen, „trotz der lebensbedrohlichen Umstände für ihre Grundrechte und die Menschenrechte in Hong Kong einzustehen“, und verurteilt „die kompromisslose, gewalttätige und menschenrechtsverletzende Vorgehensweise der Regierung und der Polizei“. Außerdem solle die TU Darmstadt prüfen, ob Kooperationen und Austauschprogramme mit den Partneruniversitäten in Hongkong angesichts der Polizeigewalt „noch ethisch tragbar sind“.

Die TU Darmstadt sieht jedoch „keinen Anlass“, die Kooperationen mit den Partner­uni­versitäten in Hongkong „in irgendeiner Weise einzuschränken“, heißt es in einer Stellungnahme. Man betrachte „enge internationale Beziehungen zwischen Hochschulen unter demokratischen Bedingungen als sehr sinnvoll“ und schätze die „‚Brücken bauende‘ Funktion von Netzwerken“, heißt es. Man biete Darmstädter Austauschstudierenden jedoch eine umgehende Rückholung an. Einer von vier hätte dieses Angebot angenommen.

Ähnlich zurückhaltend ist auch die Hochschulrektorenkonferenz (HRK): „Nach aller Möglichkeit sollten die Kommunikationskanäle, gerade auch in schwierigen Zeiten, offen gehalten werden“, heißt es auf Anfrage der taz. Der Zusammenschluss deutscher Hochschulen und Universitäten wolle den „akademischen Austausch“ aufrechterhalten und „gerade jetzt eine wichtige Stütze sein“, so die HRK. Fast wortgleich plädiert auch der Deutsche Akademische Austauschdienst (DAAD) für die Fortführung bestehender Programme.

 

Quelle         :      TAZ       >>>>>          weiterlesen

Taiwan bietet Asyl und Studienplätze

2019-10-01 Demonstration Hong Kong 08.jpg

Aus Thaipeh von Felix Lee

Nirgendwo ist Unterstützung für die Hongkonger Demokratiebewegung so groß wie auf der Nachbarinsel. „Wir wollen zeigen, wie gastfreundlich wir Taiwaner sind“. Chou Chia-pei, NTU-Vizepräsidentin.

Von außen ist der Presbyterianischen Kirche von Taipeh nicht anzusehen, dass sie ein Hort des Widerstands ist. Die Kirche steht neben dem Parlamentsgebäude im Zentrum von Taiwans Hauptstadt. Gegenüber erstreckt sich das weitläufige Geländer der NTU, der renommiertesten Universität des Inselstaats. In einem Lagerraum der Kirche stehen Kisten mit Helmen und Gasmasken. Die Kirche wolle die Kisten demnächst nach Hongkong transportieren, sagt Hsu Hanyu. Mit den Gasmasken sollen sich die Demokratieaktivisten vor dem Tränengas der Polizei schützen können.

Hsu, 27, ist Mitglied der Sozialdemokratischen Partei Taiwans und war 2014 Teil der Sonnenblumen-Bewegung. Ihre Anhänger:innen hatten damals für mehrere Wochen das Parlamentsgebäude besetzt. Sie protestierten gegen die Annäherung der prochinesischen Regierung unter der konservativen Partei Kuomingtan (KMT). Seit vier Jahren ist mit der Demokratischen Fortschrittspartei (DPP) allerdings eine Regierung im Amt, die den China-freundlichen Kurs der Vorgängerregierung ablehnt und für eine offizielle Loslösung Taiwans von der mächtigen Volksrepublik eintritt, die Taiwan als „abtrünnige Insel“ betrachtet. Umso stärker setzt sich Hsu nun für die Demokratiebewegung in Hongkong ein. „Wir haben schließlich denselben Feind.“

Quelle          :         TAZ         >>>>>          weiterlesen

—————————————————————

Grafikquellen       :

Oben         —           Das Foto zeigt das neue Eingangsgebäude („Karo5“, Vordergrund), das Verwaltungsgebäude (rechts) und das Audimax-Gebäude (links) der TU Darmstadt.

Urheber Che010      /  Quelle    :    Eigenes Werk

Ich, der Urheberrechtsinhaber dieses Werkes, veröffentliche es als gemeinfrei. Dies gilt weltweit.

———————–

2.) Von Oben      —    Police draws gun against protesters, then shot warning rounds to the sky.

Unten      —       Hongkong    –     Demonstration against extradition bill, 1 October 2019

Abgelegt unter Asien, Bildung, Deutschland, Hessen, Mensch | Keine Kommentare »

Nobelpreis für Peter Handke

Erstellt von DL-Redaktion am 11. Dezember 2019

Am Arsch der Hölle

Graves srebrenica bosnia and herzegovina.jpg

Kommentar von Doris Akrap

Peter Handke ist ein Kretin, ein Arschloch. Dass er mit dem höchsten Literaturpreis geehrt wird, hat aber etwas Gutes.

Peter Handke ist ein Kretin. Er hat die Opfer des schwersten Verbrechens im postfaschistischen Europa verhöhnt, das Verbrechen geleugnet, sich mit einem überaus unappetitlichen Regime gemein gemacht und seine Worte und Urteile weder in aller gebotenen Eindeutigkeit und Lautstärke zurückgenommen noch mit aller gebotenen Schamesröte im Gesicht bei den Opfern und ihren Angehörigen um Entschuldigung gebeten.

Peter Handke ist ein Kretin, ein Arschloch. Dennoch hat die Entscheidung, dem österreichischen Schriftsteller am 10. Dezember in Stockholm den Nobelpreis für Literatur zu verleihen, etwas ausgelöst, das gut war.

Für die Überlebenden des Massakers von Srebrenica im Jahr 1995 ist die Nobilitierung eines Mannes, der als „Genozidleugner“ bezeichnet wird, eine „existenzielle Kränkung“, so formuliert es der aus dem belagerten Sarajevo 1994 nach Deutschland geflohene Schriftsteller Tijan Sila.

Aber, und das ist das Gute, diese Entscheidung blieb nicht unkommentiert. Noch einmal musste die ganze Welt darüber reden, dass es mitten in Europa nach dem Ende des Nationalsozialismus einen Genozid gegeben hat. Noch einmal musste die ganze Welt sich fragen, wie das trotz der Losung „Nie wieder“ eigentlich passieren konnte. Noch einmal musste die ganze Welt zur Kenntnis nehmen, dass sie im Bosnienkrieg versagt hat.

Dass es dazu kam, ist der Vehemenz, der Unerbittlichkeit und der Akribie zu verdanken, mit der dem Auszuzeichnenden seine eigenen Worte um die Ohren gehauen wurden.

Noch in den 1990ern und bis in die nuller Jahre hinein hätte ich das nicht ganz so gesehen. Ich bin in meinen Ansichten zum blutigen Zerfall Jugoslawiens gefühlt drei bis fünf Mal um den Block gelaufen. Und ich kann nicht ausschließen, dass ich vielleicht nochmal rummuss.

Ich hatte nie auch nur die leisesten Sym­pathien für den restjugoslawischen hyper­nationalistischen Autokraten, den serbischen Staatschef Slobodan Milošević. Aber genauso wenig hatte ich die für sein kroatisches Pendant Franjo Tuđman. Mein Vater hatte mir 1991 den jugoslawischen Pass abgenommen und durch einen kroatischen ersetzt.

Das aber ersetzte nicht meine Ansicht, dass das ursprüngliche jugoslawische Modell wesentlich friedlicher, kosmopolitischer, demokratischer und cooler war als diese von Nationalismus, Antisemitismus und ethnischem Testosteron aufgepumpte kroatische Unabhängigkeit.

Das war keine exklusive Haltung als deutsche Linke. Im Gegenteil. Während der eine Teil im wiedervereinigten Deutschland den Sieg über den Kommunismus feierte, kämpften die Nichtsodeutschen und Linken mit dem gesamtdeutschen Nationalismus, Rassismus und neonazistischer Gewalt – Baseballschlägerjahre ist das aktuelle Stichwort dafür. Diese Gruppe sah im neuen Deutschland das alte. Und dazu passte auch das Verhalten der deutschen Regierung in den jugoslawischen Zerfallskriegen ab 1991.

50 Jahre Manuskripte - Alfred Kolleritsch und Peter Handke.jpg

Von Bild bis Joschka Fischer, deutsche Medien und Politiker sahen in Serbiens Präsident Hitlers Wiedergänger, im Kosovo ein neues Auschwitz und bombardierten zum dritten Mal in diesem Jahrhundert Belgrad (1999). Und das alles, nachdem man den Massakern im Bosnienkrieg (1991 bis 1995) quasi zugeguckt hatte und der deutsche Außenminister Kroatien im Alleingang als unabhängigen Staat anerkannt hatte (1991).

Hans-Dietrich Genscher ist in Kroatien der einzige Politiker, nach dem zu Lebzeiten Straßen und Plätze benannt wurden. Schützenhilfe alter Verbündeter aus faschistischen Zeiten – so redeten wir damals.

Quelle         :           TAZ         >>>>>           weiterlesen

———————————————————-

Grafikquellen       :

Oben         —        New graves for victims of the Srebrenica genocide in 1995. Burial took place on 11 July 2010.

Abgelegt unter Bildung, Deutschland, Europa, Schicksale | Keine Kommentare »

SUV und das Klima

Erstellt von DL-Redaktion am 9. Dezember 2019

SUVs fressen alle CO2-Einsparungen von PKW auf

File:Platz da für mein SUV 07.jpg

Quelle        :     INFOsperber CH.

Von Daniela Gschweng

Der Trend zum «Strassenpanzer» hält an. SUVs verbrauchen so viel Sprit, dass es alle CO2-Einsparungen bei Kleinwagen aufwiegt.

Mehr als ein Drittel aller verkauften Personenwagen sind SUVs. 39 Prozent aller Konsumenten weltweit kauften im vergangenen Jahr einen der Stadt-Offroader, wenn sie ein neues Auto brauchten, Tendenz seit Jahren steigend. Diese Zahl hat die Internationale Energieagentur IEA Mitte Oktober als Vorabmeldung zum «World Energy Outlook 2019» veröffentlicht. Die Agentur bewertet jedes Jahr den Weltenergiekonsum und prognostiziert in drei möglichen Szenarien die zukünftige Entwicklung.

In den vergangenen zehn Jahren hat sich der Anteil der SUVs weltweit verdoppelt, stellt die Energieagentur fest. In der EU ist schon jeder dritte Neuwagen ein SUV, in den USA fast jeder zweite. Auch die wohlhabende Schweiz setzt auf den allradgetriebenen Wagen: Laut «Blick» haben inzwischen die Hälfte aller Neuwagen 4×4. Für Geländefahrten sind sie meist nicht gedacht, eher für das raue Zürcher Pflaster. Ihre Fahrer loben vor allem das hohe Sicherheitsgefühl und die – im wörtlichen Sinne – gute Übersicht.

Die Vorliebe für grosse, schwere Autos macht sich in Folge an der Tankstelle und auch auf dem Konto bemerkbar: SUVs verbrauchen etwa ein Viertel mehr Energie als ein Mittelklassewagen. Der durchschnittliche CO2-Ausstoss eines Fahrzeugs steigt dadurch drastisch an – so sehr, dass er alle «Gegenmassnahmen» wie effizientere Motoren und sparsamere Autos in der Summe glatt ausradiert.

Fast so schädlich wie die Kohleverbrennung

Die immer grösseren und schwereren Vehikel schaden der Umwelt erheblich mehr als kleinere und leichtere Autos. Trotz aller Massnahmen, die Treibstoff-Verbrennung sauberer und weniger umweltschädlich zu gestalten, ist der globale Treibstoffbedarf zwischen 2010 und 2018 um 5,3 Milliarden Liter (3,3 Millionen Barrels) täglich (!) gestiegen, was ausschliesslich auf SUVs zurückzuführen ist. Das ist die zweitgrösste Steigerung im CO2-Ausstoss nach den Emissionen der Elektrizitätserzeuger (Power).

Verbesserungen bei kleineren Fahrzeugen haben im gleichen Zeitraum zu einer Einsparung von 3,2 Milliarden Liter (2 Millionen Barrels) täglich geführt. Elektrofahrzeuge entlasten die Umwelt noch vergleichsweise wenig – durch den Nicht-Verbrauch von etwa 16 Millionen Litern Treibstoff pro Tag.

Personenwagen mit alternativen Antrieben sind zwar auf dem Vormarsch, noch ist der Marktanteil von Elektro-, Hybrid- und Wasserstoffautos aber gering. Bis 2025 werden etwa 350 Modelle auf dem Markt sein, schätzt die IEA. Dabei handelt es sich vor allem um Kleinfahrzeuge.

Die Präsentation des zukünftigen Pick-ups der Firma Tesla erfuhr kürzlich zwar viel Aufmerksamkeit, ist aber eher die Ausnahme als die Regel.

Den Schweizer Kunden ist das egal: Selbst beim kleinen Marktsegement der Elektro- und Hybridfahrzeuge machten SUVs hierzulande den grössten Anteil aus. Je nach Stromquelle ist auch das keine grosse Entlastung für das Klima. Es sei denn sie specken ab (siehe auch Infosperber: «Warum die Effizienz im Strassenverkehr gesunken ist»).

Die weltweit meisten SUVs sind jedoch Benziner und werden es voraussichtlich auch noch eine Weile bleiben. Wenn der Bedarf weiterhin mit ähnlicher Geschwindigkeit zunimmt wie in den vergangenen zehn Jahren, würden benzingetriebene SUVs bis 2040 die CO2-Einsparungen von fast 150 Millionen Elektroautos zunichtemachen, rechnet die IEA aus.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

keine

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

———————————————————————-

Grafikquellen:

Oben       —             The Platz da für mein SUV?! protest promoted a city limit of 70 and a minimum speed of 250 kph on the Autobahn

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: C.Suthorn / cc-by-sa-4.0 / commons.wikimedia.org
It is not permitted to upload this file to Facebook, Youtube, Twitter and many other social networks!
This file has been released under a license that is incompatible with the terms of service and licensing terms of Facebook, Youtube, Twitter etc.More information is provided by the Legal Team of the Wikimedia Foundation.

This file cannot be used at any pages which use different terms than the license granted here.

 ——————————-

Unten      —       „Kinder wollen Klimagerechtigkeit“

Abgelegt unter Bildung, Energiepolitik, International, Umwelt | Keine Kommentare »

Eine exemplarische Debatte?

Erstellt von DL-Redaktion am 6. Dezember 2019

Die Armut der Kritik am Anarchismus

File:Jahve meets anarchy.jpg

Quelle       :        untergrund-blättle      CH.

Von Mona Alona

In der Erfurter Zeitung „Lirabelle“ hätte eine Debatte zur vermeintlichen Kritik am Anarchismus und seiner Verteidigung stattfinden können.

Teaser

Auslöser waren die Vorurteile, Diffamierungen welche die Autorin Minna Takver verbreitete, in Verbindung mit ihrer hanebüchenen Unkenntnis ihres Gegenstandes. Anstatt sich der Auseinandersetzung wirklich zu stellen, lehnte die Redaktion der Lirabelle den zweiten Teil der „Armut der Kritik des Anarchismus“ von Mona Alona ab. Da es sich um eine beispielhafte Reaktion handelt und es Formen solidarischer, respektvoller und konstruktiver Auseinandersetzungen weiter zu üben gilt, lohnt es sich, diese schriftliche Provinz-Debatte als Beispiel vor Augen zu führen. Und selbstverständlich, weil der zweite Teil der „Armut der Kritik am Anarchismus“ ja auch irgendwo noch auftauchen sollte und das Ganze ein gewisses Lesevergnügen bereitet.

Wer sich den billigen Szene-Gossip ersparen will, kann die Texte von Minna Takver auch überspringen. Wer den zweiten Teil der Entgegnung lesen möchte, kann ins letzte Viertel scrollen…

Kritik aktueller anarchistischer Praxis in Jena. Teil I

(http://lirabelle.blogsport.eu/2019/05/22/kritik-aktueller-anarchistischer-praxis-in-jena-teil-i/)

Als Hotspot linksradikaler Politik in Thüringen birgt die anarchistische Szene Jenas auch kritikwürdige Aspekte. Minna Takver widmet sich in zwei Teilen der anarchistischen Strategie und ihrer Auswirkungen. Dieser erste Teil beleuchtet Anthropologie und Aktionen, der zweite Teil Identifikation und Geschichtskonstruktion. Die Autorin ist Mitglied im Club Communism.

A! In Jena; da ist was los!

So die Antwort auf die Frage, wo denn in Thüringen linksradikal am meisten geht, wenn der Eindruck entsteht, es gibt allerorten nur FaschistInnen und andere Menschenfeinde; die stetige berechtigte Angst vor Übergriffen inklusive. Viele in der Jenaer Szene eint, dass sie sich selbst unter der Bezeichnung anarchistisch verorten lassen oder durch ihre Politik dort zugeordnet werden können. Es gibt dort seit Jahren eine intensive Auseinandersetzung mit anarchistischer Theorie, an der sich jede_r beteiligen kann.

Mindestens genauso lange gibt es anarchistisch geprägte Aktionen im öffentlichen Raum, die linken Belangen Sichtbarkeit verschaffen, zum Beispiel, wenn es um die Frage nach Räumen zum Leben für Alle geht. Auch ganz konkret anarchistischen Raum gibt es, der offen ist, durch die Angebote, sowie durch seine hervorragende Lage in der Stadt. Es gibt mehrere anarchistische Medien, sowohl analog als auch digital. Und vor allem gibt es anarchistische Menschen, die solidarisch kochen, die sich in ihrer Betroffenheit als Eltern/-teile austauschen, die bei staatlicher Repression helfen, die sich nicht scheuen mit jüngeren oder neuen Gesichtern ins Gespräch zu kommen, die den Blick auf linksradikale Praxis über die deutschen Grenzen hinaus wagen, die Gefangene unterstützen, die sich mit der (radikalen) linken Geschichte in Jena und Umland auseinandersetzen, die gemeinsam wandern gehen, die unentgeltlich beim Stress mit der Lohnarbeit helfen, die Bücher und Wissen teilen und dabei stets versuchen, für antifaschistische, feministische und antirassistische Belange einzutreten. Dabei begegnet man den Leuten in ihrem Alltag, sei es Lohnarbeit, Familie oder Freizeit, was aller Kritik zum Trotz die dominante Realität ist.

Anarchist_innen in Jena schauen Filme, hängen ab, feiern gemeinsam und nehmen sich Zeit für ein Bier/eine Brause in lauschiger Umgebung, politisch interessante Gespräche inklusive. Es werden allgemein Menschen angesprochen, die irgendwie links sind, und mit den Gefangenen Leute unterstützt, die dem Staat in spezieller Weise ausgeliefert sind und auf „die draussen“ angewiesen sind. Durch die Aktionen und Räume tritt mit den Anarchist_innen in Jena linksradikale Politik unbestreitbar und dankenswerterweise aus ihrem Versteck heraus. Gerade weil diese Form der Praxis keine Selbstverständlichkeit unter den gegebenen Bedingungen ist, drängt sich die Frage auf, wie das möglich ist und welche Konsequenzen das hat. Bei näherer Betrachtung lässt sich in der anarchistischen Praxis eine Strategie entdecken, die diese antreibt, und deren Schwächen und Auswirkungen Sorge bereiten.

„Die Keimzelle einer neuen Gesellschaft“

Besagte Strategie möchte ein Umfeld zur politischen Radikalisierung und Betätigung schaffen. Es soll möglichst viele Bereiche menschlichen Lebens abdecken, um alle interessierten Menschen zu erreichen. Dazu wurden und werden Stützpunkte geschaffen, wie sie es schon länger in Jena gibt. Sie zu doppeln kann also nur den Zweck haben, sich vom Rest der radikalen Linken abzusetzen. Dadurch besteht die Gefahr der Schwächung strömungsübergreifender politischer Strukturen. Die besagten Stützpunkte bilden die wesentlichen Eckpfeiler des anarchistischen Zusammenhangs, in dem sich Menschen radikalisieren können sollen, um dann in den Rest der Gesellschaft hinein wirken zu können, mit dem Ziel eine Bewegung aufzubauen, die die Verhältnisse umstürzt. Dabei wird vernachlässigt, dass es auch in sogenannten Freiräumen kein Aussen von dieser Gesellschaft gibt und es geht damit eine Vorstellung von Menschen einher, die durch die Gesellschaft verblendet seien und in der richtigen Umgebung zu politischem Bewusstsein kämen.

Hauptgegner der Anarchist_innen sind Staat und Faschismus. Der Umkehrschluss daraus ist, dass jegliche Zusammenarbeit mit dem Staat korrumpiert. Konkrete Verbesserungen mit dem Staat (mit den FaschistInnen auch für die Autorin undenkbar) werden als reformistisch heruntergespielt. Zentral ist der Aufbau der anarchistischen Blase, nicht die Menschen, wodurch konkrete Verbesserungen ihrer Lebensumstände nur erkämpfenswert sind, weil sie gegen den Staat oder FaschistInnen durchgesetzt werden könn(t)en. So ist die Blase nur sehr eingeschränkt offen für Menschen, die für eine progressive Politik eintreten, ohne dass diese revolutionär ist. Auch schliesst sich die Blase gegen eine selbstkritische Infragestellung ab, wie sie notwendig sein wird, wenn ihre Stützpunkte nicht mehr der eigenen Gesellschaftsanalyse adäquat oder der eigenen Politik zweckmässig sind.

Es wird auch ausgeblendet, dass Stützpunkte primär von aussen bestimmt sind. Anarchistische Stützpunkte in Jena werden vorbehaltlos gefeiert, ohne offen zuzugeben, wie prekär ihre Existenz im Angesicht staatlicher Repression ist oder dass es sie ohne Bezug szeneexterner Ressourcen schwerlich geben kann. Die anarchistische Blase gibt sich autark gegen alles andere und macht sich damit selbst zu einer leichten Beute staatlicher Repression, da sie weder einen zivilgesellschaftlichen Deckmantel besitzt noch bürgerlichen Rückhalt will: kündigt ihnen die Vermieterin auf medialen oder politischen Druck hin, haben sie nichts in der Hand; werden ihre Vereinsstrukturen als staatsfeindlich verboten, gibt es wenig Gegenargumente vor Gericht.

„Konkrete Kämpfe gegen diese Verhältnisse“

Mit der Vorstellung von Menschen, als durch die richtigen Umstände radikalisierbar, geht auch einher, dass solche Umstände gezielt hergestellt werden könnten. Zentral hierfür ist die Konfrontation mit den beiden Hauptgegnern Staat und FaschistInnen, durch die Menschen ein (im linksradikalen Sinne) positives politisches Bewusstsein entwickeln würden. Staatliche Repression gilt dabei im Zweifelsfall als Bestätigung der eigenen Strategie. Mit dieser Strategie der direkten Konfrontation liegt es nahe, ohne Rücksicht auf Verluste vorzugehen, sei es für die Verhinderung eines Fascho-Aufmarsches oder das Erkämpfen eines selbstverwalteten Hauses.

Leider zielte die reale Aktion selten ernsthaft darauf: kein Haus wurde in Jena in den letzten Jahren besetzt, mit der Absicht es hinterher tatsächlich zu behalten. Die existierenden Stützpunkte sind alle auf legalem Weg eingerichtet worden. Und zwar aus gutem Grund: da sie nicht in der Konfrontation erkämpft wurden, sind sie bisher auch nicht so in den Fokus von Staat oder FaschistInnen geraten, dass sie in ihrem Bestehen gefährdet wären. In der Deckung zu agieren, war im Falle der Stützpunkte definitiv erfolgreicher als die direkte Auseinandersetzung mit dem Staat (und anderen Grundeigentümer_innen).

Gleiches gilt für Fascho Aufmärsche: sich nicht dabei erwischen lassen, wie man einen Kabelbrand verursacht oder vorab anonym Informationen für die bürgerliche Öffentlichkeit zu publizieren, wäre im provinziellen Thüringen wirksamer, als mit ein bis zwei Dutzend Anderen nur unzureichend vermummt den Versuch zu wagen, gegen die Materialübermacht der Bullen anzurennen oder in der direkten Auseinandersetzung Schaden davon zu tragen. Darüber hinaus gibt es keine grösseren Aktivitäten Jenaer Anarchist_innen, um FaschistInnen das Leben schwer zu machen. Letztere werden immer erst dann konkret relevant, wenn sie in der Stadt politische Veranstaltungen machen und anlässlich des staatlichen Aufgebots sich der Erfahrungsraum der direkten Gruppen Konfrontation eröffnet.1 Eine solidarische Masse in die Auseinandersetzung mit Polizei oder Justiz zu ziehen, indem man die Unterstützung zum Beispiel bei Hausbesetzungen einfordert, nur um eine politische Radikalisierung hervorrufen zu wollen, ist so gefährlich wie kein anderer Teil der anarchistischen Strategie.

109 tramsigt klotter (39037057).jpg

Die Wahrscheinlichkeit, dass Menschen aus solchen Konfrontationen beschädigter heraus kommen als vorher, ist so viel höher als die, dass sie sich entschliessen hinterher ihr politischen Engagement auszudehnen. Der deutsche Staat ist leicht dazu in der Lage jede_n von uns zu brechen, geschundene Körper, zerstörte Privatexistenzen und traumatisierte Psychen bleiben. Die Sicherheit jedes einzelnen Menschen aber sollte aufgehoben sein in radikaler Politik und nicht durch sie hinweg gewischt werden. Jede politisch emanzipatorische Aktion muss vorher mit den Risiken, die sie birgt, mit den Bedürfnisse, der an ihr Beteiligten, und ihren Zielen abgewogen werden. Das geht nur im Dialog und sei es dadurch, dass man als Initiator_innen Risiken und Ziele transparent macht. Selbstkritik verhütet womöglich, dass wir noch härter gegen uns selbst und damit noch härter gegen andere werden.

Die Armut der Kritik am Anarchismus. oder: A macht Wissen (Teil 1)

(http://lirabelle.blogsport.eu/2019/10/08/die-armut-der-kritik-am-anarchismus-oder-a-macht-wissen-teil-i/)

Ohne Freude arbeitet sich Mona Alona an Minna Takvers Text in der letzten Lirabelle ab, weil sich dieser als paradigmatisch für die Armut der Kritik am Anarchismus dafür anbietet. Und weil es einiger Richtigstellungen bedarf.

Starke Irritation rief der Artikel von Minna Takver bei mir hervor. Im Gespräch stellte sich heraus, dass dies Freund*innen ähnlich ging, die etwa äusserten, sie wüssten nicht, ob sie in der gleichen Stadt wie die Autorin leben. Insgesamt vermisse ich in Takvers Text den Ansatz, einer politischen Szene tatsächlich Selbstreflexion zu ermöglichen und sie organisatorisch, strategisch oder theoretisch weiterzuentwickeln. Dies könnte erstens gelingen, wenn es sich um eine selbstkritische Perspektive handeln würde, zweitens, wenn der Text von Minna Takver nicht zur Hälfte aus Unterstellungen bestehen würde und wenn in ihm schliesslich, drittens, überhaupt sein Gegenstand erfasst werden würde, den er bedauerlicherweise zur Gänze verfehlt. Anstatt über Ethik, Organisation und Theorie des Anarchismus zu schreiben, würde ich mich lieber mit „konkreten Kämpfen gegen diese Verhältnisse“ befassen. Die hanebüchene Unkenntnis des Anarchismus‘, die langweiligen Vorurteile und der nahezu historische Abgrenzungsreflex ihm gegenüber, lassen mein Schreiben jedoch schon fast als eine solche (leider notwendige) Auseinandersetzung erscheinen. Deswegen lohnt es sich, mich fragend durch Takvers Text voran zu graben:

Die rein negative Kritik, welche Takver formuliert, ist der Abglanz einer untergehenden Epoche. Einer, in der Menschen traumatisiert von ihrem Vernichtungspotenzial waren und damit einen Umgang finden mussten. Dies ist verständlich und dem ist nichts hinzuzufügen. Es war aber auch eine, deren Nachgeborenen es sich in gewisser Weise leisten konnten, sich in ihrem Selbsthass zu suhlen, einen allzu deutschen Zynismus zu kultivieren und ihre politische Praxis zu weiten Teilen in schmutzigen Grabenkämpfen zu sehen. Damit meine ich wohlgemerkt nicht die zivilgesellschaftlichen Schützengräben in den Herrschaftsverhältnissen, sondern die Differenzen zwischen an sich vernünftigen Leuten. Darum schreibe ich es in diesem Zusammenhang in aller Deutlichkeit: Eine gesellschaftliche Linke, die nicht mehr aufzubieten hat, als allein ihre negative Kritik, wird künftig keinerlei Relevanz mehr beanspruchen können, sondern als krude Marotte abgewiesen werden. Als zu gross, zu tief, zu umfassend stellt sich die multiple gesellschaftliche Krise dar. Übrigens nicht allein für Personen in linksradikalen Kreisen.

Dies führt zum zweiten Punkt, dem falschen Verständnis von gesellschaftlicher Totalität. Takver – und ich beziehe mich hier stellvertretend auf sie – bedarf ihrer. Sie scheint fast existenziell auf sie angewiesen zu sein, um mit dem Gefühl ihrer eigenen Ohnmacht zurecht zu kommen und jenem einen Sinn zu verleihen. Doch das Ohnmachtsgefühl in dieser Gesellschaft ist, ebenso wie die Angst vor „Konfrontationen“, ein Produkt derselben. Wie zurecht bemerkt wurde, trifft dies selbstverständlich auch auf das Bedürfnis nach „Handlungsfähigkeit“ oder der Sehnsucht nach „Gemeinschaft“ in diesen vereinsamenden gesellschaftlichen Zuständen zu.

Weil dies jedoch der Fall ist, zeigt sich dadurch, dass es durchaus unterschiedliche Möglichkeiten gibt, mit den ökonomischen, sozialen, kulturellen, politischen Verhältnissen umzugehen, auf sie zu reagieren oder gar in ihnen zu agieren. Dass im Anarchismus agency und community betont werden, ist nicht vorrangig naiv oder eine Verkennung der Umstände, sondern ebenfalls Teil der Realität – mit ihren jeweiligen Potenzialen und Problemen. Hierbei ist es kein Zufall, dass zeitgemässe progressive links-emanzipatorische Texte mit dem wörtlichen – also vulgären – Verständnis von gesellschaftlicher Totalität brechen und sich stattdessen auf die Suche nach Verhältnissen begeben, die parallel zu den dominanten ebenfalls vorhanden sind.

Drittens. Was versteht Takver nicht alles unter „Anarchismus“? In Kürze: Alles, was irgendwie in der linken Szene herum springt und Aspekte von Selbstorganisation aufweist. Solidarisches Kochen, wie auch immer finanzierte oder betriebene selbstorganisierte Räume oder das Teilen einer gemeinsamen (zu unterschiedlichen Graden politisierten) Lebensrealität, hat aber zunächst einmal nichts mit Anarchismus zu tun. Vielmehr handelt es sich um Praktiken, die wahrscheinlich in jeder linken Szene von Jena bis nach Sydney gelebt werden. Es stimmt, dass Anarchist*innen solche Dinge als Formen potenziell egalitärer Selbstorganisation betonen und diese als „Keimzellen einer neuen Gesellschaft“ betrachten.

Es stimmt aber ebenso, dass die gesamte sozialistische Bewegung – historisch betrachtet – selbstorganisierte Institutionen und Beziehungen in einem solch beachtlichen Umfang hervorbrachte, dass die Vorstellung, damit die zukünftige Gesellschaft bereits aufzubauen, für viele keineswegs als abwegig angesehen wurde. Takver kritisiert nicht „den“ Anarchismus, wie sie behauptet. Ihr Szene-Gossip ist keine Kritik. Sie wettert gegen linke Szenen allgemein, wo denn noch welche zu finden sind. Aus ihrer Darstellung müsste konsequenterweise geschlussfolgert werden, dass der Anarchismus die einzige verbleibende sozialistische Strömung ist. Was zweifellos unsinnig wäre. Mit der Handvoll tatsächlicher Anarchist*innen setzt sie sich nicht auseinander.

Deswegen sollte Takver, viertens, wenn sie meint, Politik-Beratung für Jenaer Szene-Angehörige betreiben zu müssen, auch einen Schimmer von dem haben, wovon sie schreibt. Völlig fehlgeleitet ist ihre Unterstellung, Anarchist*innen in Jena würden die vermeintliche Übermacht des Staates in einer „direkten Konfrontation“ verkennen. Allein ihrer Fantasie entspringt es, dass sie uns andichtet, wir würden mit den Bullen kämpfen wollen – quasi so „Mann gegen Mann“, wie irgendeine bescheuerte maoistische Gruppierung andernorts. Gleichwohl gibt es ein ganzes Bündel emanzipatorischer Wege, „weder von der Macht der anderen, noch von der eigenen Ohnmacht sich dumm machen zu lassen“ (Adorno). Neben anarchistischen Ansätzen werden diese in Jena dankenswerterweise auch von einer guten feministischen Organisierung gepflegt.

Ob absichtsvoll oder unbewusst entsprechen sie dem Konzept von sozialer Revolution. Dieses meint eine prozesshafte, umfassende und radikale Transformation der Gesellschaft auf verschiedenen Ebenen. Die soziale Revolution geht von den vorfindlichen gesellschaftlichen Bedingungen und Beziehungen aus, bezieht sich nicht auf den Staat und kritisiert deswegen auch rein politische Handlungsmodi. Dass dies innerhalb linksradikaler Kreise schwer vermittelbar zu sein scheint, ist keineswegs der Unzulänglichkeit oder Unverständlichkeit anarchistischer Theorien geschuldet. Vielmehr zeugt diese Vermittlungsschwierigkeit von der Armut an Vorstellungskraft, Motivation, Selbstbewusstsein, Aufrichtigkeit und Erfahrung in den Teilen der deutschen gesellschaftlichen Linken, die ich hiermit adressiere.

Wenn Takver sich nur etwas mit anarchistischem Denken befassen würde, könnte sie auch, fünftens begreifen, dass ihre Behauptung, Jenaer Anarchist*innen würden im „Staat“ und „Faschismus“ ihre „Hauptgegner“ sehen, völliger Humbug ist. Sicherlich ist der libertäre Sozialismus das diametrale Gegenstück zum Faschismus. Aus diesem Grund betreiben Anarchist*innen Antifaschismus aus Notwendigkeit, aber nicht als Selbstzweck. (Dies gilt übrigens auch für alle anderen Aktivitäten.) Wir sind in einer historisch-politischen Konstellation angekommen, wo blosse Versuche der Abwehr des Faschismus diesen nicht mehr verhindern (werden). Deswegen braucht es (oftmals schwache und teilweise widersprüchliche) Ansätze, wie wir die bestehende Gesellschaft überwinden können. Denn der Faschismus kommt nicht von „rechts aussen“, sondern entsteht bekanntlich in ihrer Mitte.

Im Unterschied zu den meisten marxistisch geprägten Linksradikalen, meinen Anarchist*innen eine solche Aussage nicht als hohle Phrase, um dann praktisch sozialdemokratische Politik zu machen. Umgekehrt bedeutet dieser Anspruch allerdings, unser tägliches Handeln sozial-revolutionär auszurichten. Das ist ziemlich unspektakulär und es gibt dafür auch keine moralischen Bewertungsmassstäbe, wer dies zu welchem Grad tut. Eigentlich ist dies auch der Hauptgrund für eine kollektive Organisierung: Sich gemeinsam zu bewegen – etappenweise, verbunden mit unseren konkreten Lebenssituationen und -umfeldern und als die bestimmten Personen, die wir sind.

Als absoluter Quatsch erweist sich in diesem Zusammenhang Takvers Aussage, eine wäre „gefährlich“ eine „solidarische Masse in die Auseinandersetzung mit Polizei oder Justiz zu ziehen, indem man die Unterstützung zum Beispiel bei Hausbesetzungen einfordert, nur um eine politische Radikalisierung hervorrufen zu wollen“. Jedes Wort ist hierbei hohl und giftig. Traurig ist, dass die Autorin offenbar nie Solidarität erfahren hat. Ihre Behauptung, das Ziel einer Soli-Kundgebung wäre das Hervorrufen einer „Radikalisierung“ ist ein Affront. Lieber lässt sie Menschen in ihrer Betroffenheit allein, als sie darin zu unterstützen. Dies mag seinen Grund darin haben, dass sie Leid gar nicht überwinden möchte, weil sonst die Grundpfeiler ihrer Identität bröckeln würden. Ich befürchte, gerade daraus entwickelt sich der instrumentelle Charakter, den sie nun anderen unterstellt.

Um abschliessend zu Takvers Lieblingsthema zu kommen, den sogenannten „Stützpunkten“. Die hierbei mitschwingende militärische Denkweise wird sicherlich von den meisten (der paar) Anarchist*innen in Jena abgelehnt, weswegen wir sie uns nicht einfach zuschreiben lassen sollten. Der Begriff „Freiräume“ hat allerdings ebenfalls seine Nachteile. In jüngeren Diskussionen wird dagegen viel von „Zwischenräumen“ gesprochen, was ich erst mal für einen guten Arbeitsbegriff halte. Takvers Vorstellung, ein Raum, wie beispielsweise das FAU-Lokal könnte sich nur durch indirekte staatliche Gelder finanzieren, ist eine blosse Diffamierung, die der Verleumdung als „Antifa e.V.“ wenig nachsteht. Das Lokal wird von den Mitgliedern vollständig selbst getragen. Es ist so anfällig gegenüber staatlicher Repression wie jeder Raum in der Öffentlichkeit. Selbst Linkspartei-Büros sind davon bekanntlich nicht ausgenommen. Wenn Takver den „Jenaer Anarchist*innen“ also empfehlen sollte, ein Haus in der Innenstadt zu kaufen und Eigentümer zu werden, so wären sie sicherlich nicht dagegen. Sie würden es bloss für utopisch im schlechten Sinne halten.

Kritik aktueller anarchistischer Praxis in Jena. Teil II

(http://lirabelle.blogsport.eu/2019/10/08/kritik-aktueller-anarchistischer-praxis-in-jena-teil-ii/)

Als Hotspot linksradikaler Politik in Thüringen birgt die anarchistische Szene Jenas auch kritikwürdige Aspekte. Minna Takver widmet sich in zwei Teilen der anarchistischen Strategie und ihrer Auswirkungen. Der erste Teil beleuchtet Anthropologie und Aktionen, dieser zweite Teil Identifikation und Geschichtskonstruktion. Die Autorin ist Mitglied im Club Communism.

„Historische Tradition und Werte des Anarchosyndikalismus“

Auf den Gegenprotesten zu Fascho Demos in black block Kluft herum rennen birgt einen Reiz, dem sich weder Autorin noch Jenaer Anarchist_innen entziehen können: dadurch fühlt man sich als Teil von etwas grösserem, es gibt einen Zusammenhang zwischen mir und jeder anderen, die so herum rennt (auch wenn es kaum Sinn macht ausserhalb eines konkreten black block). Mit dem hoch gezogenen Tuch über Mund und Nase bin ich anders als die anderen Normalos, ich bin ein Vorschein auf die Zukunft. Dazu bleibt nur zu sagen: hoffentlich nicht!

Nicht nur in Demo Aktionen schaffen sich Jenaer Anarchist_innen eine gemeinschaftsstiftende Identität. In ihrer Blase werden Menschen Identifikationsangebote gemacht: es gibt diverse kulturelle Aktivitäten, konsumierbare Waren und die Konstruktion einer fast schon mythischen, heroischen anarchistischen/autonomen/antifaschistischen Geschichte durch Entdeckung immer neuer Held_innen in Jena/er Umland/Thüringen. Dabei dient die Auseinandersetzung mit der eigenen linksradikalen Geschichte nicht dazu, sich ihr Scheitern einzugestehen und aus ihren Fehlern und theoretischen Sackgassen zu lernen. Stattdessen wird im anarchistischen Umfeld für Jena eine historische Kontinuität hergestellt, die letztlich als Legitimation für das heutige Wirken dient, statt Legitimität durch die Vertretung der eigenen Politik herzustellen (die dann freilich sich ihrer gesellschaftlich marginalen Position bewusst sein müsste).

Auch durch den engen, solidarischen Bezug auf süd/süd-ost/osteuropäische gegenwärtige anarchistische Praxis wird Identität gemacht, wobei die Schwächen der anderen Anarchismen unsichtbar bleiben. Eine kritische Haltung zu revolutionärer Praxis oder Theoriegeschichte und ihre Transformation sind dabei nicht in Sicht. Die Konstruktion von Gefangenen als einer zu befreienden Gruppe von Unterdrückten, mit denen eine kontinuierliche Zusammenarbeit möglich ist, ist ebenfalls Teil anarchistischer Identität. Selbst wenn Gruppen im anarchistischen Spektrum in einem Staatsbetrieb für bessere Arbeitsbedingungen kämpfen, sind sie trotz ihrer staatlich hoch legalistischen Mitteln (Klagen vor Gericht, angemeldete Kundgebungen) keiner Kritik innerhalb der anarchistischen Szene Jenas ausgesetzt. Daran lässt sich wohl am deutlichsten ablesen, dass die gemeinsame Identität wichtiger ist als die konkrete politische Praxis.

Gleiches gilt für die immer wiederkehrende Diffamierung einer so genannten „Staatsantifa“, unabhängig davon, ob sie die Lebensbedingungen von Menschen verbessert oder nicht. Die Gegner von Anarchist_innen und „Staatsantifa“ sind die gleichen: FaschistInnen; aber nur erstere agieren wahrhaft authentisch gegen sie, da sich Zweitere mit dem anderen Hauptgegner (Staat) verbünden. Und wieder gibt es keine interne Auseinandersetzung mit dieser zweifelhaften Selbstbeweihräucherung. Die anarchistische Blase Jenas neigt wie alle Blasen dazu szene- und/oder subkulturförmig zu werden und sich damit gegen Kritik abzuschliessen. An dieser Stelle drängt sich die unbeantwortete Frage auf, wie Solidarität mit noch lebenden und bereits verstorbenen Menschen aussehen kann, die für die Emanzipation streiten/stritten, ohne dass es in Verklärung dieser Menschen abdriftet?

Diese Frage betrifft nicht nur Anarchist_innen. Weiter steht die Frage im Raum für wen ein solches Identitätsangebot attraktiv ist: In Jena gibt es eine enge Verknüpfung des grösseren anarchistischen Dunstkreises mit der studentischen Lebensrealität, die weitgehend abgekoppelt ist von der Freizeit- und Lohnarbeits-/Schulrealität des Rests der Gesellschaft. Dabei herrscht die bereits erwähnte Mentalität von „GANZ ODER GAR NICHT“ vor, welche sich mit dieser Lebensrealität einfacher vereinbaren lässt. Leider lässt sie sich nach dem Ende des Studiums auch einfach wieder ablegen und so wählt der grössere Dunstkreis Option 2, der harte Kern Option 1. Eine politische Betätigung grösserer Zusammenhänge über die Zeit des Studiums hinaus wird so nicht realisierbar.

Keine Lösung

Aus der identitätsstiftenden Blase heraus gibt es gelingende Kooperation mit und gegenseitige Unterstützung von verschiedensten nicht anarchistischen linksradikalen Menschen und Gruppen in der Kleinstadt Jena. Resigniert lässt sich vermuten, dass das aus der eigenen Schwäche der anarchistischen Blase und einem Mindeststandard linker Politik resultiert. Die Sorge bleibt, dass die Anarchist_innen uns im Stich lassen, wenn sie stark geworden sind, weil wir keine Anarchist_innen sind. Die Stärke der anarchistischen Szene in Jena ist ihre Aktivität. Ihre Schwäche die geringe Selbstkritik. Ihre Gefährlichkeit der kompromisslose Hunger nach Widerspruchslosigkeit. Mit der Kritik daran verbindet sich die Hoffnung, dass doch noch alles für alle gut wird, denn eine andere Lösung hat die Autorin nicht.

Die Armut der Kritik am Anarchismus oder: A macht Wissen. Teil II

Gespannt wartete Mona Alona auf die letzte Ausgabe der Lirabelle, um zu lesen, ob es Minna Takver gelingen würde, ihren haltlosen Szene-Gossip auf die Ebene von Kritik zu hieven. Doch wiederum wurde sie massiv enttäuscht. Mona hätte es nicht für möglich gehalten, dass der zweite Teil von Takvers vermeintlicher „Kritik aktueller anarchistischer Praxis in Jena“ tatsächlich ebenso problematisch wie der erste ist. Daher fühlte sie sich dazu getrieben, diese Steilvorlage zu nutzen, um Grundlagenwissen zu vermitteln.

1887 wurde ein Buch veröffentlicht, das den reisserischen Titel Der Anarchismus und seine Träger. Enthüllungen aus dem Lager der Anarchisten trägt. Sein junger Autor, Rudolf Emil Martin, positioniert sich darin als vehementer Anti-Anarchist. Er reiste im Stile eines schmierigen Boulevard-Journalisten nach London um die dortige #anarchistische Szene – in ihr viele exilierte Deutsche und Russen – vorgeblich investigativ zu studieren. Aufgrund seines übertrieben bürgerlichen Bewusstseins, seiner mangelnden Lebenserfahrung, wie auch seiner fetischistischen Staatsgläubigkeit, besteht sein Buch jeweils zu einem Drittel aus blossen Erfindungen, aus falsch eingeordneten Wahrnehmungen, sowie aus kontextlosen Zitaten von anarchistischen Flyern und Zeitungen. Bis 1919 entwickelte sich Martin zum Anhänger der Sozialdemokratie ohne irgendwelche Kontakte zu sozialen Bewegungen zu haben. Nur diese könne nach dem grossen Krieg noch das Chaos der Anarchie verhindern, glaubte er. So wie Martin ist Minna Takver nicht ansatzweise in der Lage, ihren Gegenstand zu erfassen und sich mit Menschen auseinanderzusetzen, die ihn tatsächlich kennen. Im Unterschied zu ihm versteht sie sich vermutlich nicht (mehr) als kleinbürgerliche Sozialdemokratin, sondern als sowas wie Kommunistin. Umso trauriger, dass sie offensichtlich nicht in der Lage ist, selbst irgendeine inhaltliche Positionen zu beziehen. Stattdessen ernährt sie sich wie ein Zombie durch die Diffamierung von Menschen, die ihre potenziellen Genoss*innen sein könnten. Aus diesem Grund wird ihre Ideologie auch untot bleiben und nie eine progressive emanzipatorische Rolle spielen können. Nun aber im Detail zur Wiederlegung von Takvers herbeiphantasierten Behauptungen:

Identität scheint für Takver ein Reizwort zu sein. Umso erstaunlicher ist es, dass sie „der anarchistischen Szene in Jena“ Identifikationen zuschreibt, von denen sie offensichtlich jedoch keinerlei Ahnung hat. Unter der Überschrift „Historische Tradition und Werte des Anarchosyndikalismus“ schreibt sie völlig zusammenhangslos davon, dass sie es sinnlos findet, wenn sie selbst unorganisiert und ziellos im black block herumläuft. Was das mit Anarchismus zu tun haben soll, ist mir schleierhaft, ebenso wie die blosse Erfindung, Anarchist*innen würden sich irgendwelcher Heldenmythen bedienen. Wenn wir uns nicht das Scheitern auch von Geschichten ansehen würden, an denen Anarchist*innen beteiligt waren, hätten wir 2014 keine Veranstaltungsreihe unter dem Motto „Gekonnt scheitern“ organisiert, um genau dies zu thematisieren.

Von „theoretischen Sackgassen“ des Anarchismus zu sprechen, steht Takver dabei absolut nicht zu, weil sie keine Ahnung von anarchistischer Theorie hat, wie sich in ihren Texten überdeutlich zeigt. Die Bezugnahme auf eine historische Tradition würde die Legitimation für das Handeln im Hier und Jetzt herstellen, lesen wir weiter. So what? Genau die Beschäftigung mit der eigenen Geschichte ermöglicht ja erst ein Lernen und die Selbstreflexion, zu welcher Takver nicht fähig ist. Im Übrigen „legitimieren“ wir uns durchaus vorrangig durch das, was wir tun und nicht durch irgendwelche vorgetragenen Phrasen, wie es Takver oder irgendwelche rot-roten Gruppen tun.

Erneut zeigt sich, dass Takver durchgängig von sich auf andere schliesst, somit also die Beschäftigung mit ihren eigenen Widersprüchen vermeidet. Anstatt selbst zu denken – oder auch mal nachzufragen – ringt sie wie im ersten Text mit ihrer eigenen Orientierungslosigkeit und bringt nicht den Willen auf, gegen ihre Ohnmachtsgefühle handlungsfähig zu werden. Anarchismus ist etwas Bestimmtes. Seine ethischen Wertvorstellungen, Organisationsprinzipien und theoretischen Grundsätze entspringen nicht dogmatischen Festlegungen oder idealistischen Konstruktionen, sondern den jahrzehntelangen Erfahrungen in sozialen Bewegungen. Position zu beziehen, die über das Anti-Irgendwas hinausgeht – dafür steht der Anarchismus heute wie auch in den sozialistischen Geschichten.

Auch die praktizierte antinationale Solidarität namentlich mit „süd/süd-ost/osteuropäischen“ anarchistischen Gruppen hält Takver fälschlicherweise für einen Aspekt unserer Identititätskonstruktion. Eigentlich kennen nur einige von uns Leute, die Leute kennen und das ist alles. Sich auf den osteuropäischen Kontext zu beziehen ist jedoch auch darüber hinaus sinnvoll, um auch nach 30 Jahren von der post-realsozialistischen Situation zu lernen, das heisst, auch weiterhin die Irrwege des Staatssozialismus zu kennen und zu benennen. Ausserdem wissen jene, die ansatzweise antinational unterwegs sind, dass es emanzipatorische Kräfte in osteuropäischen Ländern noch deutlich schwerer haben, als hierzulande. Mit den „Kommunist*innen“ dort ist keinerlei emanzipatorische Politik zu machen. Seit seiner Entstehung war der Anarchismus eine globale Bewegung, die sich zugleich lokale Verankerungen schaffte. Antinationale Solidarität zu praktizieren ist auch heute wichtig und sollte möglichst auf direkten Kontakten statt auf antiimperialistischen Projektionen beruhen.

Persönlich angesprochen fühlte ich mich, als Takver vom Staatsantifaschismus schrieb, denn das ist eines meiner vielen Lieblingsthemen. Ob jemand „authentisch“ gegen den Faschismus handelt oder nicht ist mir dabei ziemlich egal. Wie bei allen sozialen Kampffeldern wäre allerdings mein Wunsch, dass Antifaschismus (wieder) autonomer geschieht. Dies ist eine strategische Frage, die nichts mit einer angeblichen „Selbstbeweihräucherung“ zu tun hat. Bekanntermassen verhinderten die staatlichen Präventionsprogramme gegen Rechtsextremismus nicht, dass in den letzten Jahren ein neuer Rechtsterrorismus entstanden ist.

Die Gewaltbereitschaft, der Waffenbesitz, die Kampferfahrung und die militante Organisierung von Neonazis und anderen Faschisten haben noch einmal deutlich zugenommen. Die staatlichen Repressionsbehörden unternehmen – trotz ihrer geheimdienstlichen Erkenntnisse – wenig und nur sporadisch etwas dagegen. Die Gründe dafür liegen auf der Hand: rechtsterroristische Verschwörungen reichen bis in die Kreise von Elitesoldaten, Polizei und Innenministerien. Tendenziell dienen sie autoritären staatlichen Interessen, weil sie sich vorrangig gegen Nicht-Staatsbürger*innen und emanzipatorische soziale Bewegungen richten.

Wie man nach den Erfahrungen mit dem Verfasssungsschutz im Nachgang des NSU-Terrors noch naiv den Staat als Verbündeten gegen den Faschismus begreifen kann, ist mir unklar. Und dennoch nutzen wir selbstverständlich die Mittel, die wir zur Verfügung haben. Möglicherweise arbeitete sogar die eine oder andere von uns bei der „Staatsantifa“. Vielleicht sogar für Lohn! Wir sind so grossherzig, dass wir sie dennoch nicht aus unserem identitären Klüngel ausgeschlossen haben – Stell dir das mal vor, Minna Takver! Also lass uns diese onging debate des Verhältnisses zum Staat gerne weiterführen.

Über Szenen und die vermeintlich studentische Blase schrieb ich ja schon im vorherigen Teil. Wiederholt zeigt Takver, dass sie nicht „den“ Anarchismus kritisiert, sondern die linke Szene in Jena. Damit betreibt sie also eine Gleichsetzung, die für alle Beteiligten völlig unangemessen ist. Zudem behauptet sie damit einen Standpunkt ausserhalb der Szene einzunehmen, den sie offensichtlich nicht hat, da sie gegen „den“ Anarchismus pöbelt, um sich mit ihren eigenen Identitätsproblemen nicht auseinandersetzen zu müssen. Überhaupt ist ihre Rede von einer „anarchistischen“ Szene völliger Unsinn. Wo fängt die denn an?

Wenn sich fünf Leute in einer Gruppe treffen oder jemand ein A an deine Hauswand gemalt hat? Warum kreierst du so ein krudes Bild, Minna? Du weisst doch genau, wie das läuft: Es gibt Leute, die sich treffen, bestimmte Ansichten haben und vielleicht gelegentlich irgendwelche Sachen machen. Das ist bei euch vermeintlichen Kommunist*innen doch überhaupt nicht anders. Allerdings bin ich es Leid, deine blossen Behauptungen auf Papier zu lesen. Eine Unterscheidung von einem „harten Kern“ und einen diffusen „Dunstkreis“ in der angeblichen Szene entspringt lediglich deiner Phantasie oder den „Erkenntnissen“ des Verfassungsschutzes. Ich ziehe die Parallele nicht ohne Grund, weil die Diffamierungen in deiner diffusen Argumentation bedauerlicherweise einen harten autoritären Kern aufweisen.

Ist dies auch der Grund, warum Takver uns einen Maximalismus andichtet? Eine Mentalität des „GANZ ODER GAR NICHT“ nehme ich in meinem Umfeld eigentlich nicht wahr. Vielmehr versuchen wir uns wo es geht auf die Kritik und Praxis im Handgemenge zu konzentrieren. Es mag sein, dass einzelne Personen in ihrem Verbalradikalismus und einer vorgetragenen absoluten Haltung in der Vergangenheit über die Stränge geschlagen haben. Das macht mich selbst skeptisch, denn wer sich zu weit aus dem Fenster lehnt, begibt sich in die Gefahr, tief zu fallen.

Meiner Erfahrung nach legen sich jugendliche Allmachtsfantasien jedoch, sobald sich Personen langfristig in „konkrete Kämpfe gegen diese Verhältnisse“ einbringen. Auch hierbei handelt es sich keineswegs um ein spezifisches Problem des Anarchismus. Dass eine solche Hybris Minna Takver besonders aufstösst, ist allerdings nicht einer solidarisch-kritischen Haltung geschuldet, sondern ihrer Affirmation der Ohnmacht als zentralem Bestandteil ihrer negativen Identität.

Als wäre es nicht langsam genug, suggeriert Takver darüber hinaus jedoch, dass wir uns zukünftig mit der linken Szene entsolidarisieren könnten. Klar, aufgrund historischer und persönlicher Erfahrungen entsolidarisieren wir uns von Parteipolitik, autoritären Gruppierungen oder von Menschen, die lediglich Vorurteile und Unterstellungen für uns übrig haben. Niemals jedoch von Personen, die unter der bestehenden Herrschaftsordnung leiden und gegen sie mit emanzipatorischen Anliegen rebellieren. Wer das nicht weiss, sollte mit uns in Kontakt und Austausch treten, um sich davon zu überzeugen. Wiederum offenbart Takver hierbei ihren instrumentellen Charakter mit welcher sie ihre Diffamierungen auf Papier geschmiert hat. Mit einer manipulativen Einstellung unterstellt sie uns, was sie selbst betreibt.

101 polismur utanfor hvitfeldtska (39037040).jpg

Nach diesem Ritt muss ich auch den letzten Punkt entschieden zurückweisen: Es ist schlichtweg nicht der Fall, dass Anarchist*innen einen „kompromisslosen Hunger“ nach Widerspruchsfreiheit haben. Auch hierbei handelt es sich um eine leicht durchschaubare Projektion, wenn Takver wirklich glaubt, uns von ihrer vermeintlichen Position des Ausserhalb bewerten und beurteilen zu können. Schon wer nur ein klein wenig Ahnung von Anarchismus als sozialer Bewegung oder auch politischer Theorie hat, weiss, wie sehr diese Behauptung an den Haaren herbeigezogen ist. Takver widerspricht sich ja auch direkt selbst mit ihrer Annahme, die Widersprüchlichkeit im Anarchismus würde durch Identitätskonstruktionen gekittet werden. Ja was denn nun?

Meiner Erfahrung nach gehen Menschen sehr unterschiedlich mit den gesellschaftlichen Widersprüchen um uns herum und in uns um. Tatsächlich stellen sie uns vor ungeheurere Herausforderungen, wenn wir in-gegen-und-jenseits dieser Verhältnisse agieren wollen. Und zwar nicht um die Widersprüche der Herrschaftsordnung abzufeiern, sondern, um sie abzubauen und zu überwinden. Damit handelt es sich jedoch um etwas grundlegend anderes, als die von Anarchist*innen begrüsste Pluralität. Denn jene bringt zwangsläufig unterschiedliche Positionen hervor und macht deswegen eine – manchmal konfliktbehaftete, manchmal versöhnliche – permanente und nie abgeschlossene Suche nach den Gemeinsamkeiten erforderlich. Eben darin besteht Anarchie als produktiver Prozess auf den wir uns hier und heute einlassen können. Daher wünsche ich Minna Takver ehrlich, dass sie ihre konservative Sehnsucht danach überwindet, „dass doch noch alles für alle gut wird“. Erst der schmerzhafte Bruch mit dieser romantischen Vorstellung, könnte sie von ihren sozialdemokratischen Illusionen befreien und sie zum Mitwirken an solidarischen, egalitären, libertären Beziehungen und Organisationen motivieren.

Es tut mir Leid wenn das arrogant rüberkommt, Minna, aber wesentlich mehr noch, dass du mir dafür die Steilvorlage geliefert hast: Du hast versucht Kritik zu üben und bist daran kläglich gescheitert. Doch wir Anarchist*innen mögen Versuche. Und wir hüten uns vor einfachen Antworten. Deswegen setzen wir uns mit dir auseinander. Du brauchst nicht weiterhin billige Diffamierungen zu streuen und wie auf dem Pausenhof in der Schule oder innerhalb der sozialistischen Familie über uns zu lästern. Denn wir laden dich ein, ebenfalls in die Auseinandersetzung zu gehen und gemeinsam mit uns sozial-revolutionär zu werden. Deine „Kritik“ ist ein Armutszeugnis. Wir aber sind und bleiben dem reichen Leben auf der Spur.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————-

Grafikquellen         :

Oben     —          Jahve meets anarchy, Przedmieście Oławskie, Wrocław

Author Patryk Wojciechowski 1992
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

————————

2.) von Oben      —          109_tramsigt_klotter

————————

Unten       —     101_polismur_utanfor_hvitfeldtska

Abgelegt unter Bildung, International, Kultur, Mensch | Keine Kommentare »

Die Offenheit der Sprache

Erstellt von DL-Redaktion am 3. Dezember 2019

Eine Chance, kein Arschloch zu sein

File:Berkhof J.jpg

Non Mareice Kaiser

In der aktuellen Diskussion um Meinungsfreiheit heißt es häufig, unsere Debattenkultur sei elitär. Doch bei diskriminierungsfreier Sprache geht es nicht um Bildung, sondern um die Offenheit, anderen wirklich zuzuhören.

Wie laut es in einem Schweinestall ist, wusste ich schon als Kind. Welche Welt Bücher eröffnen können, erst sehr viel später. Wo ich aufgewachsen bin, gibt es mehr Schweine als Bücher und mehr Kühe als Menschen. Dass ich aufs Gymnasium gehen wollte, wurde als „Extrawurst“ bezeichnet, das Thema „Studium“ war ein rotes Tuch. Das Geld, das mein hart arbeitender Vater verdiente, reichte immer gerade so und eben nicht für Extrawürste oder rote Tücher. Als „bildungsfern“ würden einige das Umfeld, in dem ich aufwuchs, bezeichnen. Ich bin ein Arbeiterkind, sage ich heute. Den Begriff musste ich auch erst einmal lernen.

In unserer Straße wohnte auch meine Freundin Anika. Zuerst lebte sie dort mit ihrer Mutter und ihrem Vater. Irgendwann mit zwei Müttern, denn die Frau, die ich als ihren Vater kennengelernt hatte, war eigentlich ihre Mutter. Das erzählte sie uns – also dem ganzen Dorf – bei einem Dorffest. Ich weiß noch, dass meine Eltern mir erklärten, dass Anikas Vater sich dazu entschieden habe, als Frau zu leben und jetzt Anikas Mutter sei und einen anderen Namen habe.

Zu Anika habe ich heute keinen Kontakt mehr, deshalb kann ich sie oder ihre Mütter nicht fragen, wie das damals für sie war. Ich weiß nicht, wie es sich angefühlt hat, die Transition in unserem kleinen Dorf zu verbringen. Was ich aber weiß: Die Leute aus unserem Dorf hielten sich an die Bitte, Anikas zweite Mutter bei ihrem neuen Namen anzusprechen. Und zwar alle.

Die Frage, wie man heute sprechen soll, stellen sich aktuell viele Menschen. „Wie war nochmal das korrekte Wort?“, steht über einem Artikel der Zeit zum Thema Meinungsfreiheit. Die These: Unsere Debattenkultur sei elitär und schließe Menschen aus bildungsfernen Milieus aus. Das sehe ich anders.

Das Gefühl der Ausgeschlossenheit resultiert aus einem Unwohlsein. Menschen, die viele Jahre ihres Lebens sprachen, wie ihnen der Schnabel gewachsen war, bekommen heute Widerspruch zu hören, werden gar kritisiert. Das fühlt sich dann an, als könne man nicht mehr alles sagen. Dabei kann man einfach nur nicht mehr jeden Scheiß sagen, ohne mit einem Echo rechnen zu müssen.

„Die Klage von angeblichen Meinungsverboten kommt auffallend oft von Leuten, die es gewohnt waren, unwidersprochen zu bleiben. Wenn man nachhakt, stellt sich meist raus, dass Kritik und Widerspruch mit Meinungsverbot gleichgesetzt wird“, twitterte die Soziologin Franziska Schutzbach. Laut unserem Grundgesetz können wir alles sagen, was nicht die Würde eines anderen Menschen verletzt. Und das ist der Punkt: Man sollte nicht alles sagen, wenn man kein Arschloch sein will.

Wenn man das nicht sein will, ist es eigentlich gar nicht so schwer: Es braucht keinen besonderen Bildungsabschluss, kein Hochschulstudium und keinen Doktortitel, es braucht einfach nur eine Frage: „Wie ist es gut für dich?“ Und dann die Offenheit, die Antwort wirklich hören zu wollen und sich dementsprechend zu verhalten.

Das ist die Grundlage dafür, diskriminierungsfreie Sprache zu nutzen. Übrigens: Arschloch ist zwar eine Beleidigung, dabei aber nicht diskriminierend. Diskriminierende Sprache erkennt man daran, dass sie eine bestimmte Gruppe mit negativen Eigenschaften belegt. Meist sind das Gruppen, die eh schon von Benachteiligungen betroffen sind. Eine benachteiligte Gruppe von Arschlöchern gibt es meines Wissens nach nicht. Schade eigentlich.

Ich war vielleicht zehn Jahre alt und mir wäre überhaupt nicht in den Sinn gekommen, Anikas zweite Mutter nicht als solche anzusprechen. Klar, am Anfang war das ungewohnt, ich stolperte noch manchmal über den alten Namen oder sagte, wenn ich mit Anika sprach,„dein Papa“ statt „deine Mama“. Aber dann entschuldigte ich mich dafür. Nach kurzer Zeit hatte ich mich daran gewöhnt. Meine Sprache hatte sich angepasst. Genau wie es unsere Sprache macht, wenn wir versuchen, diskriminierungsfreier zu sprechen.

Immer mehr Stimmen werden in den Medien und der Politik sicht- und hörbar, die lange Zeit nicht gesehen und gehört wurden. Diesen Stimmen haben wir es zu verdanken, dass wir immer mehr und immer weiter nachdenken können, wie wir sprechen wollen. Menschen, die von Rassismus betroffen sind, Menschen, die von Behindertenfeindlichkeit betroffen sind, Menschen, die von Sexismus betroffen sind. Sie sagen: So wollen wir nicht bezeichnet werden, das tut uns weh. Oder auch: Wir kommen in den Wörtern nicht vor, wir brauchen neue.

Die sich daraus ergebene neue Vielfalt der Sprache ist für uns alle eine große Chance. Wir können mit der Entwicklung unserer Sprache mit mehr Menschen kommunizieren als bisher. Unsere Welt wird größer und auch die der anderen. Wir schließen nicht mehr aus, sondern schließen Menschen ein. Wir haben die Möglichkeit, Menschen sicht- und hörbar zu machen. Dadurch, dass wir Worte verwenden – und auf andere verzichten.

Quelle          :            TAZ            >>>>>          weiterlesen

———————————————————————–

Grafikquellen        :

Oben       —            Idyllischer Ortskern von Berkhof

Author Jürgen Friede       —         Source   :  Own work
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

———————-

Unten       ––     Urheber Sampix

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Bildung, Kultur, Mensch, Positionen | Keine Kommentare »

Angriff auf Zivilgesellschaft

Erstellt von DL-Redaktion am 27. November 2019

Wohin treibt die Republik?

2019-04-11 Plenum des Deutschen Bundestages-8085.jpg

Erfolgt jetzt der Angriff von Parasiten aif die Zivilgesellschaft ?

Ein Schlagloch von Jagoda Marinic

Der VVN/BdA soll die Gemeinnützigkeit aberkannt werden. Es geht aber nicht nur um diesen Verein. Es scheint, als solle die Zivilgesellschaft gezähmt werden.

Ich dachte, ich lese nicht richtig: Esther Bejarano, diese würdevolle Frau und Schoah-Überlebende, schreibt einen offenen Brief an Bundesfinanzminister Scholz, in dem sie ihm erklären muss, was Antifaschismus in Deutschland bedeutet. „Wohin steuert die Bundesrepublik?“, fragt sie ihn. Zu Recht.

Esther Bejarano ist Überlebende, die uns das Geschenk, das ihr gemacht wurde, zurückgeschenkt hat: Sie hat überlebt und durfte dieses Leben noch einmal füllen, wirklich füllen, will heißen: In Fülle Leben, mit Freude trotz Schmerz, mit Leichtigkeit trotz dieses historischen Gewichts in ihrem Leben. Sie ist unglaubliche 94 Jahre alt, und alle Demokrat*innen sollten ihr Möglichstest dafür tun, dass Esther Bejarano nie wieder einen solchen Brief schreiben muss. Der Verein, dessen Ehrenvorsitzende sie ist, wird sperrig abgekürzt mit VVN-BdA.

Schreiben wir den Vereinsnamen also aus: „Vereinigung der Verfolgten des Nazi-Regimes – Bund der Antifaschistinnen und Antifaschisten.“ Diesem Verein soll nun die Gemeinnützigkeit durch das Finanzamt Berlin aberkannt werden. Hat Finanzminister Scholz es wirklich nötig, in seinen grundsätzlichen Überlegungen zur Förderung von Vereinen eine Überlebende dazu zu zwingen, ihm persönlich Geschichtsunterricht zu erteilen? Für Herrn Scholz muss Esther Bejarano persönlich noch einmal schreiben: Unser Verein wurde gegründet 1947, von Überlebenden der Konzentrationslager und Nazi-Verfolgten. Ich weiß nicht, ob das Wort Scham hier noch reicht. Vielleicht, wenn der Boden grundlos wäre.

Ich möchte nicht tatenlos dabei zusehen, wie Überlebende, denen ein langes Leben gegönnt wurde, als gäbe es eine ausgleichende Kraft auf dieser Erde, zunehmend im hohen Alter dazu gezwungen sind, für unsere Demokratie einzustehen. Weshalb müssen sie ihre Narben aufreißen, damit Politiker wie Olaf Scholz sich daran erinnern, was Demokratie ist? Oder all jene, die gebildet genug wären, die deutsche Geschichte zu kennen und die demokratische Lebensleistung der Engagierten zu respektieren.

Es geht hier jedoch nicht nur um diesen Verein. Es scheint hier strukturelle Aktivitäten zu geben, die Zivilgesellschaft zu einem Haustierchen zu zähmen, mit dem man sich zwar schmückt, mit der man sich aber nicht auseinandersetzen möchte. Fördergelder werden inzwischen vergeben, als seien Vereine die Bittsteller der Demokratie und nicht ihr Knochenmark. Ministerien haben einen politischen Auftrag, Vereine in ihrer Arbeit zu unterstützen. Doch die Auflagen werden immer absurder, die Projekte immer bürokratischer. Die Abwicklung der meisten Projekte ist ehrenamtlich nicht mehr zu stemmen. Vereine müssen sich zunehmend professionalisieren.

Esther Bejarano, 70 Joer Befreiung vum Faschismus-121.jpg

 

Das hört sich auf den ersten Blick nicht schlecht an. Heißt aber auch: Man macht sich die Vereinsmitarbeiter abhängig. Wer Angst hat, in der nächsten Förderrunde auszuscheiden, weil er so auch seinen Lebensunterhalt verlieren würde, der wird nicht auffallen durch Kritik. Doch ohne Raum für Kritik wird die Zivilgesellschaft zur Karikatur ihrer selbst.

Quelle       :           TAZ           >>>>>           weiterlesen

—————————————————————-

Grafikquellen        :

Oben       —         Abstimmung im Plenum des Deutschen Bundesatges am 11. April 2019 in Berlin.

———————————–

Unten          —      Den 29. Abrëll 2015 hat d‘Kommunistesch Partei Lëtzebuerg op en Owend zum Thema 70 Joer Befreiung vum Faschismus agelueden. Am Kulturzentrum Marcel Noppeney zu Uewerkuer ass déi bekannt antifaschistesch Aktivistin Esther Bejarano zesumme mat hirem Jong Joram a mam Rapper a Sozialaarbechter Kutlu Yurtseven vu Microphone Mafia opgetrueden. D’Esther Bejarano, mat 91 Joer eng mat de leschte bekannten Auschwitz-Iwwerliewenden.

Abgelegt unter Bildung, Kriegspolitik, Kultur, Regierung | Keine Kommentare »

Telematik-Infrastruktur (TI)

Erstellt von DL-Redaktion am 22. November 2019

Patientendaten zu verkaufen

File:Airport Thermographic Camera.jpg

Quelle        :       untergruns-blättle CH.

Von Joseph Steinbeiss / Artikel aus: Graswurzelrevolution Nr. 443, November 2019, www.graswurzel.net

Zur drohenden Einführung der Telematik-Infrastruktur (TI) im deutschen Gesundheitswesen. Der Widerstand gegen eine lebensbedrohliche Klimapolitik hat weltweit gewaltige Ausmasse angenommen und begonnen, die politische Agenda in vielen Ländern tatsächlich zu verändern.

Interessanterweise regt sich gleichzeitig gegen die Digitalisierung sämtlicher Lebensbereiche so gut wie gar kein Widerstand. Dabei sind die Zusammenhänge zwischen beiden Bedrohungen augenfällig und längst allgemein bekannt.

Da jedoch im Allgemeinen über einem Bildschirm kein Schornstein qualmt und unter der Schreibtischplatte kein stinkender Dieselmotor knattert, ist es noch immer erstaunlich leicht, vielen Menschen weis zu machen, die Digitalisierung sei eine Antwort auf die Klimakatastrophe, und nicht Teil des Problems. So ist der jährliche CO²-Ausstoss des Internets, verursacht durch die notwendige Kühlung zahlloser Grossrechner auf sogenannten Computerfarmen, inzwischen genauso hoch wie der des Flugverkehrs – des Flugverkehrs weltweit, wohlgemerkt. Zehn Minuten im Internet zu surfen verbraucht in etwa soviel Energie, wie sich eine Tasse Kaffee zu kochen. Und seriöse Schätzungen vermuten, dass, sollte die Entwicklung in gleichem Tempo weitergehen, in absehbarer Zeit ein Viertel (!) der weltweiten Energiereserven für die Verwaltung von Daten aufgewendet werden wird. Ein in der Tat bedrohliches Szenario.

Aber selbst wenn man – unzulässigerweise – die Gefährdung der natürlichen Lebensgrundlage auf diesem Planeten einmal aussen vor lassen wollte, bliebe noch immer nichts, was einen angesichts der Digitalisierung in Jubelschreie ausbrechen lassen müsste. Denn wo auch immer die neue technologische Infrastruktur eingeführt wird, geht es, bei genauerem Hinsehen, um die gleichen zwei Dinge: Überwachung und Profit. Alles andere sind (meist marginale) Zugewinne an Bequemlichkeit, bunte Marketingversprechen – und Lügen.

Wer Studien wie „Das Zeitalter des Überwachungskapitalismus“ der US- Wirtschaftswissenschaftlerin Shoshana Zuboff liest (ein ansonsten durchaus klarsichtiges und empfehlenswertes Buch übrigens), muss zwangsläufig den Eindruck gewinnen, ein idyllischer, sozial gerechter und nachhaltiger Kapitalismus sei durch böswillige Wühlarbeit von Firmen wie Google, Facebook und Twitter in Gefahr gebracht worden und müsse nun eilends verteidigt werden. Dabei wollen längst auch nationalstaatliche Regierungen von der grossen Daten-Bonanza profitieren. In Deutschland zeigt sich dies gegenwärtig an Plänen des Gesundheitsministeriums, die sogenannte Telematik-Infrastruktur (1) zwangsweise im Gesundheitssektor einzuführen.

Patientendaten gehörten bisher zu den bestgeschützten persönlichen Informationen dieses Landes. Die ärztliche Schweigepflicht, die in gleichem Masse für Sprechstundenhilfen, ja sogar für Putzkräfte gilt, die in Praxen arbeiten, verhindert, dass sie in falsche Hände geraten. Sollen Patientendaten doch einmal weitergegeben werden – etwa an andere behandelnde Ärzte – muss dies vom Patienten ausdrücklich genehmigt werden und unterliegt strengen Auflagen. Verstösse werden nach dem Strafgesetzbuch geahndet.

Das alles soll nach dem Willen von Bundesgesundheitsminister Jens Spahn (CDU) nun offenbar anders werden: Er holt mit der Telematik-Infrastruktur bei der Digitalisierung des Gesundheitswesens zum grossen Wurf auf. Zum grossen Wurf vor leeren Rängen freilich, denn es ist mehr als deutlich, dass sein Ministerium öffentliches Interesse für das TI-Projekt nicht wünscht. Aus seiner Motivation dagegen macht Spahn keinen Hehl: Es geht ihm nicht um Patientinnen und Patienten oder Ärztinnen und Ärzte, sondern darum, dass Deutschland bei der Digitalisierung „den Anschluss nicht verpassen“ dürfe. Bundeskanzlerin Angela Merkel wurde sogar noch deutlicher. Big Data, also das massenhafte Sammeln und Speichern sämtlicher personenbezogenen Daten, derer man habhaft werden kann, sei der gewinnbringendste Markt der Zukunft: „Daran muss Deutschland teilhaben!“.

Alle Ärztinnen, Ärzte, Psychotherapeutinnen und Psychotherapeuten, die Kassenpatienten behandeln, werden durch den Gesetzgeber unter Androhung von Geldstrafen gezwungen, ihre Praxiscomputer, in denen Patientendaten gespeichert sind, an das Internet anzuschliessen. Perspektivisch soll die TI alle Praxen, Krankenhäuser, ja sogar Apotheken (!) des Landes miteinander vernetzen und mit den Krankenkassen verbinden. Die Geldstrafen sind durchaus empfindlich: Ärztinnen und Ärzte sowie Therapeutinnen und Therapeuten, die sich dem Grossangriff auf das Arztgeheimnis entgegenstellen, bekommen im ersten Jahr 1% ihrer Einnahmen abgezogen. Zeigen sie sich weiterhin uneinsichtig, werden es 2,5% Prozent.

Auch die nötigen technischen Geräte sind teuer: Um die Verbindung zur „Cloud“, in der die Daten gespeichert werden sollen, herzustellen, braucht es in jeder Praxis einen sogenannten „Konnektor“, einen Mini-Computer. Gerät und Installation kosten 3500.- Euro. Bezahlen tut dies die Krankenkasse, die die Kosten mit ziemlicher Sicherheit auf die eine oder andere Weise an die Versicherten weiterreichen wird. Selbst trübe Mathematikerinnen und Mathematiker sollten dagegen in der Lage sein, auszurechnen, was für Gewinne der IT-Branche winken, die diese Konnektoren verkauft und einbaut – bei ca. zwei Millionen medizinischen Profis in Deutschland.

Es ist, als sollten die Betroffenen auch noch selber zahlen dafür, dass man sie ausspäht, überwacht und ihre Daten auf dem Markt feilbieten könnte. Denn der Konnektor hat Lese- und Schreibzugriff auf den Kartenleser, kann eigenständig Internetverbindungen aufbauen und Daten aus der Praxis-EDV an den Server der TI übertragen. Er wird dabei einzig und allein von aussen konfiguriert und gewartet, kein Arzt kann kontrollieren, welche Daten in die TI weitergeleitet werden. In einem ersten Schritt gleicht der Konnektor die Stammdaten der Patientinnen und Patienten (also Name, Adresse, Kartengültigkeit etc.) mit den Servern der Krankenkassen ab, was gleichbedeutend ist mit dem upload der Daten in die Cloud. Wer diese Daten anschliessend verwaltet, ist völlig unklar. Ebenso unklar ist, wer faktisch Zugriff haben wird: Krankenkassen? Andere Ärzte? Patientenvereinigungen? Apotheken? Arbeitgeber? Die Privatwirtschaft? Die Polizei?

Fest steht, dass zumindest für Mitarbeiterinnen und Mitarbeiter des Gesundheitswesens der Zugriff nahezu unbegrenzt und völlig unkontrolliert sein wird. Mittelfristig geht es um eine dauerhafte, zentrale Speicherung der Gesundheitsdaten aller gesetzlich Versicherten, die Bundesgesundheitsminister Spahn bis 2021 ebenfalls gesetzlich vorschreiben will: die sogenannte elektronische Gesundheitsakte. Es entbehrt nicht einer gewissen Ironie, dass erst vor kurzem der EDV-Riese Microsoft seine Pläne für eine elektronische Gesundheitsakte für gescheitert erklärt hat.

Deren Sicherheit vor Eingriffen von aussen sei nicht zu gewährleisten. Craig Federighi, Manager des Microsoft-Konkurrenten Apple, erklärte ebenfalls öffentlich, die Privatsphäre lasse sich nur schützen, wenn Nutzerdaten gar nicht erst in einer „Cloud“ gesammelt würden. All das ficht Herrn Spahn nicht an: Er phantasiert sogar davon, in Zukunft hochsensible persönliche Gesundheitsdaten mit Hilfe einer Smart-Phone-App auf dem Handy abrufen zu können. Er könnte sie auch gleich an die Wände malen und von den Dächern herunterschreien lassen.

In vielen Ländern, in denen ähnliche Systeme eingeführt wurden, kam es bereits zu zum Teil massiven Datenskandalen: Gesundheitsdaten wurden gehackt und illegal verbreitet, beispielsweise in den USA (dem Mutterland von Big Data), Schweden, Dänemark, Australien und Singapur. Ebenso leicht vorstellbar ist, dass medizinische Profis mit Zugriffsrecht dem Ruf des grossen Geldes folgen und die Daten ebenfalls illegal feilbieten. Es wäre ihnen, angesichts des grossen Kompetenz-Kuddel-Muddels rund um TI, kaum nachzuweisen. Auch die erwähnte, von einigen Krankenkassen bereits erprobte Gesundheits-App erwies sich als datenschutztechnische Katastrophe.

Wie anfällig grosse Datenmengen sind, wird immer wieder deutlich. Erst vor wenigen Monaten wurden erneut tausende von Passwörtern gehackt und Daten illegal abgerufen. Eines der Opfer war, pikanterweise, Jens Spahn. Kosten und Risiken der TI sind unkalkulierbar. Was dagegen als sicher gelten darf, ist, dass die Einführung der TI das faktische Ende der Rechtssicherheit für persönliche Gesundheitsdaten bedeutet. Diese werden, eher früher als später, zur gängigen Münze auf dem Markt der datenschutzrechtlichen Unmöglichkeiten werden. Und das, wohlgemerkt, nachdem mit viel Tamtam, Lametta und blumigen Festreden ein neues Datenschutzgesetz aufgelegt wurde – von eben jener Regierung, die nun Schweigepflicht und Arztgeheimnis auf den Müllhaufen der Geschichte werfen will. Denn was wäre zum Beispiel, wenn jemand sich bei einer Krankenkasse versichern wollte, der schon einmal – heutzutage eher die Regel als die Ausnahme – an einer Depression gelitten hat?

Ein Blick in die „Cloud“, und der Betreffende dürfte es schwer haben, einen Versicherer zu finden. Denn psychische Erkrankungen sind sowohl für Versicherungen als auch für den Staat ein hohes Risiko: Immer mehr Krankentage und Frühverrentungen gehen auf ihr Konto. Auch gesellschaftlich sind sie nach wie vor ein Stigma, und wenn sie noch so sehr zur Volkskrankheit werden. Für derart unsoziale Mauscheleien bräuchte es gar keinen Hacker-Angriff. Sie sind, darf man annehmen, der eigentliche Zweck der Übung. Es ist offensichtlich, dass eine zentrale Speicherung von Gesundheitsdaten für Versicherungen, Kreditbanken, Arbeitgeber, Handyprovider oder die Polizei reizvoller und gewinnträchtiger ist als für Ärztinnen und Ärzte oder Patientinnen und Patienten.

Gegen die Einführung der TI organisiert sich im Gesundheitssektor der Widerstand. Viele Ärztinnen, Ärzte, Therapeutinnen und Therapeuten nehmen die angedrohten Geldbussen in Kauf, um ihr medizinische Ethos zu verteidigen und ihre Patienten zu schützen. Der Versuch des Gesundheitsministeriums, die TI an der Öffentlichkeit vorbei in einer Nacht- und Nebelaktion einzuführen, ist bereits gescheitert. Auch Patientinnen und Patienten können sich zur Wehr setzen, zum Beispiel, indem sie in ihren Arztpraxen fragen, ob diese bereits an die TI angeschlossen sind, und dann rechtsgültig verfügen, dass ihre Daten nicht eingespeichert werden dürfen. Noch besitzen sie in diesem Lande dieses Recht.

Damit das auch so bleibt, muss der Widerstand gegen TI unterstützt und müssen dessen Hintergründe öffentlich gemacht werden. Denn die Digitalisierung ist keineswegs, um Edmund Stoiber (CSU) zu paraphrasieren, „wie das Wetter“: Man kann sie durchaus aufhalten.

Fussnoten:

[1] Der Begriff „Telematik“ ist eine Kombination der Wörter „Telekommunikation“ und „Informatik“. Als Telematik wird die Vernetzung verschiedener IT-Systeme und die Möglichkeit bezeichnet, Informationen aus unterschiedlichen Quellen miteinander zu verknüpfen.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquelle         :

Oben          —         Thermographic camera & screen, photographed in the airport terminal of Ioannina, Greece. Thermal imaging can detect elevated body temperature, one of the signs of the virus H1N1 (swine influenza).

Author איתן טל Etan Tal
This file is licensed under the Creative Commons Attribution 3.0 Unported license.

——————————-

2. von Oben       —    Image of a Pomeranian taken in mid-infrared („thermal“) light (false-color)

—————————-

Unten       —       Thermal image of steam locomotive

Abgelegt unter Bildung, Gesundheitspolitik, International, Regierung | Keine Kommentare »

Mit rechts gegen rechts

Erstellt von DL-Redaktion am 18. November 2019

»Bild«: Mit rechts gegen rechts 

von Jan Kursko

Die Verlegerwitwe Friede Springer hat es schwer: Seit Jahren schreibt „Die Welt“ schon rote Zahlen, doch seit geraumer Zeit brechen auch die Abozahlen der Cashcow „Bild“ ein. Erst verkaufte man daher traditionsreiche Regionalzeitungen wie das „Abendblatt“ und die „Berliner Morgenpost“, woraufhin Friede Springer „bereits ein paar Tränchen geweint“ hat, wie sie der „Süddeutschen Zeitung“ gestand, und nun holte man sich mit KKR sogar einen amerikanischen Finanzinvestor als größten Anteilseigner ins Haus. Und der strebt gleich, mächtig ambitioniert, nach der Weltmarktführerschaft.

Damit sich die Sache aber richtig lohnt, heißt es erst einmal gesundschrumpfen. Und dafür müssen Köpfe rollen. Nach dem Willen von Springer-Chef Mathias Döpfner sollen es diesmal nicht nur „Indianer“ sein, sondern auch ein paar „Häuptlinge“. Als Ersten traf es – natürlich ganz einvernehmlich – „Bild“-Politik-Chef Nikolaus Blome. Das allerdings ist eine rundum zu begrüßende Sache, schließlich macht sich die Zeitung damit noch ein wenig „ehrlicher“. Nach der Entlassung der moderaten Bild.de-Chefin Tanit Koch, jetzt bei „ntv“, geht mit Blome der letzte „Wanderer zwischen den Welten“. Zwei Jahre lang werkelte er beim „Spiegel“ und nach seiner Rückkehr zu „Bild“ gab er in den Talkshows das bürgerliche Gesicht für einen angeblich ganz normalen Medienkonzern.

Doch tempi passati, nun kann „Bild“-Allein-Regent Julian Reichelt so richtig durchregieren. Und der macht prompt klar, was er darunter versteht. Nach dem Attentat von Halle setzt „Bild“ nun umso mehr auf „Kampf dem Antisemitismus“ – was ja eigentlich eine gute Sache ist. Allerdings wird Antisemitismus von „Bild“ – ganz im Sinne des Springer-Codex – pauschal mit Kritik an der israelischen Regierungspolitik gleichgesetzt. Prompt hat das Revolverblatt ein regelrechtes Netzwerk von „deutschen Politikern, Verbänden und Journalisten“ ausfindig gemacht, die „den Antisemitismus salonfähig machen“, indem sie es unter anderem wagen, Israel zu kritisieren. Das reicht vom Vorsitzenden des Zentralrats der Muslime Ayman Mazyek über FAZ-Journalist Patrick Bahners bis zu Claudia „Alarmstufe Roth“, den Bundespräsidenten und das Zentrum für Antisemitismusforschung der TU Berlin, das – böse, böse – sogar mit einem Aktivisten der besatzungskritischen Boykott-Kampagne BDS kooperiert, obwohl es diese grundsätzlich ablehnt.

Quelle         :            Blätter           >>>>>          weiterlesen

————————————————————-

Grafikenquelle     :         Grafikquelle: DL/Redaktion/privat

Abgelegt unter Bildung, Feuilleton, Medien, Positionen | Keine Kommentare »

Spesenritter in Afrika

Erstellt von DL-Redaktion am 14. November 2019

Was machen die da?

Lustige Geschichten und drollige Bilder für Kinder von 3 bis 6 Jahren 10.jpg

Von Katrin Gänsler

Deutsche Politiker*innen haben Westafrika als Reiseziel entdeckt. Für ein erhöhtes Interesse an der Region sprechen ihre Kurztrips leider nicht.

Gesundheitsminister Jens Spahn ist kürzlich durch Äthiopien, Ruanda, den Kongo und Nigeria gereist. Die Vierländertour dauerte gerade einmal vier Tage. Am Ende sagte er in der nigerianischen Hauptstadt Abu­ja, dass Afrika mehr als nur Krise – im Mittelpunkt der Reise stand der Ebola-Ausbruch im Kongo – sei. Man habe Start-ups gesehen, Innovationskraft, junge Menschen, die einen Unterschied, auch für ihr Land, machen wollen. „Da wird deutlich, welche Dynamik in diesem Kontinent steckt.“ Dabei ist Nigerias Start-up-Szene hinlänglich bekannt, auch wenn sie mitunter etwas zu sehr gehypt wird. Als der Gesundheitsminister längst wieder im Flieger nach Berlin saß, fragte eine nigerianische Journalistin kopfschüttelnd: „Warum ist er nach Nigeria gekommen? Was hat er hier gemacht?“ Die Frage klang nicht zynisch, sondern ratlos.

Zeichnung: Jens Spahn sagt "Hartz 4 bedeutet nicht Armut"; in seiner Hand ein Bündel Scheine (Monatsgehalt), im Hintergrund sind Dienstwagen und freies Zugfahren angedeutet.

Im Fall von Spahn ist die Antwort recht klar: Werbung in eigener Sache. Wenn sich eine Reise im Kern um Ebola drehen soll, muss man nicht nach Nigeria fahren. Dort wurden zwar vor fünf Jahren 20 Ebola-Fälle registriert, die das Land aber überraschend gut und schnell in den Griff bekam. Spahn wollte hingegen zeigen, dass er sich mehr als nur das Amt des Gesundheitsministers zutraut. Er kann auch Kanzler und international auftreten – das hatte er in den vergangenen Monaten schon in Kosovo und Mexiko getan. Bei der Afrika-Tour kamen immer wieder Themen zur Sprache, die weit über sein Ressort hinausgehen. Mi­gra­tion etwa, die mit Gesundheit zusammenhänge, wie er mehrfach betonte. Die afrikanische Kulisse sollte für zusätzliche Aufmerksamkeit sorgen.

Spahn ist jedoch nicht der einzige, der Afrika im Schnelldurchlauf macht. Dafür ist auch Bundeskanzlerin Angela Merkel bekannt. Nigeria, die größte Volkswirtschaft des Kontinents und mit 200 Millionen der einwohnerreichste Staat, besuchte sie zwar zweimal, aber immer nur für wenige Stunden. Dabei wird kolportiert, dass sie sich gut mit Präsident Muhammadu Buhari versteht. In Nigeria ist sie zudem außerordentlich beliebt. Beim letzten Mal im August 2018 hatte Merkel allerdings nur zwei Grundsatzvereinbarungen im Gepäck. Im Vergleich zu anderen Besucher*innen oder Gastgeber*innen ist das wenig. Nur zwei Tage zuvor hatte die damalige britische Premierministerin Theresa May ein Sicherheitsabkommen im Kampf gegen Boko Haram unterzeichnet und Unternehmer Aliko Dangote, der sein Imperium unter anderem auf Zement und Zuckerrohr gebaut hat, getroffen. Auch war Buhari nach dem Merkel-Besuch für mehrere Tage zum China-Afrika-Gipfel nach Peking eingeladen worden.

File:GarbageLibreville.JPG

Das haben deutsche Hohlköpfe mit Sicherheit nicht sehen wollen. Hätten sie aber können.

Kaum besser glückte der erste Besuch von Verteidigungsministerin Annegret Kramp-Karrenbauer in Mali, der fast zeitgleich zu Spahns Reise stattfand. Soldat*innen klagten über die Verschiebung ihres Heimatflugs. Zudem sollen „Vorübungen“ für den Empfang den Betrieb lahmgelegt haben. Nach der Reise habe es dann auch „gekracht“, wird AKK zitiert. Ein politischer Beobachter aus Mali lächelt über die Frage, ob solche Besuche überhaupt etwas bringen. „Es ist Routine, die viel Geld kostet.“ Höchstens inoffizielle Gespräche am Rande könnten für einen differenzierteren Diskurs sorgen. Doch dazu bleibt keine Zeit, da die Kurztrips minutiös getaktet sind, besonders bei den Afrika-in-vier-Tagen-Reisen. Dem Zufall bleibt nichts überlassen.

Quelle          :          TAZ            >>>>>           weiterlesen

—————————————————————–

Grafikquellen          :

Oben           —            Lustige Geschichten und drollige Bilder für Kinder von 3 bis 6 Jahren 10

———————————–

2.) von Oben        —         Twitter    –  Darth Wutze (@HuWutze)     Wikimedia – Commons

—————————

Unten     —             Müllproblem in Libreville, der Hauptstadt des Gabun (2013)

Author Oshilumbu5 at German Wikipedia

This work has been released into the public domain by its author, Oshilumbu5 at German Wikipedia. This applies worldwide.

Abgelegt unter Afrika, Bildung, Kultur, Regierung | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle  streifzuege.org

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.

Keep-it-in-the-ground.jpg

Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.

—————————–

2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.

—————————-

3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.

——————————–

Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

Überfälliger Denkmalssturz

Erstellt von DL-Redaktion am 8. November 2019

Ein Profiteur der Nazis

Bundesarchiv B 145 Bild-F004204-0003, Ludwig Erhard mit seinem Buch.jpg

Von Ulrike Herrmann

Ludwig Erhard wird bis heute gefeiert – dabei hat er eng mit Gauleitern und NS-Behörden kooperiert. Und bestens daran verdient.

 Die Nachkriegszeit hat ein Gesicht: Ludwig Erhard. Vor siebzig Jahren wurde die erste Bundesregierung vereidigt und vor allem ihr Wirtschaftsminister ist unvergessen. In Deutschland sind Straßen, Festsäle und Schulen nach Erhard benannt. Erhard bediente, wonach sich viele Westdeutsche sehnten: Er inszenierte sich als politikferner „Professor“, der über den Parteien stand. Zugleich suggerierte Erhard, dass er zu NS-Zeiten eine Art Widerstandskämpfer gewesen sei. Doch diese Legenden sind falsch. Erhard war ein Profiteur des NS-Regimes und hat hochbezahlte Gutachten für Gauleiter und Himmler-Behörden verfasst.

Erhards NS-Vergangenheit ist historisch bestens dokumentiert, wird aber bis heute tatkräftig verschwiegen. Das neue Ludwig-Erhard-Museum in Fürth behauptet etwa, dass er die NS-Diktatur „in einer Art Nische“ überstanden hätte. Dieser ungebrochene Erhard-Kult zeigt beispielhaft, dass die Deutschen die NS-Vergangenheit noch immer nicht vollständig aufgearbeitet haben.

Erhard hat die meisten seiner Lügen wahrscheinlich selbst geglaubt, denn sie halfen ihm, schwere Niederlagen zu verbrämen. Dies begann bereits mit seiner Habilitation. Später hat Erhard behauptet, er hätte auf eine „akademische Laufbahn verzichten“ müssen, weil er kein Nazi gewesen sei. Dem italienischen Premier Aldo Moro erzählte Erhard beispielsweise, er sei zu Hitlers Zeiten „verfemt und geächtet“ gewesen und habe „seine Professorentätigkeit nicht ausüben dürfen“.

Die Wahrheit ist weniger schmeichelhaft: Erhards Habilitation scheiterte nicht am NS-Regime, sondern an seiner eigenen Unfähigkeit. Er brachte zwar 141 Seiten zu Papier, aber der Inhalt war so dürftig, dass Erhard das Werk lieber nicht einreichte. Die NSDAP war jedenfalls nicht schuld, dass Erhard nicht zum Professor aufrückte. Nürnbergs NS-Bürgermeister Eickemeyer wollte ihn sogar ohne Habilitation mit dem Titel ehren, stieß jedoch auf den Widerstand des standesbewussten bayerischen Kultusministeriums: Es fehle „ein umfangreiches wissenschaftliches Werk“, wurde aus München beschieden.

Erhard war damals Geschäftsführer beim Nürnberger Institut für Wirtschaftsbeobachtung der deutschen Fertigware, das eigentlich Marktforschung betrieb. Aber ab 1938 tat sich ein neues Thema auf, weil sich das Hitler-Reich Gebiete einverleibte – ob Österreich, das „Sudetenland“, das „Protektorat Böhmen und Mähren“, Lothringen oder das „Warthegau“: Es gab kaum ein Gebiet, über das Erhard keine Studie erstellte.

Aufträge von Gauleiter Bürckel

Besonders eng arbeitete Erhard mit Josef Bürckel zusammen, der erst Gauleiter in Wien und dann in Lothringen war. Zwei Expertisen stechen heraus: Anfang 1942 sollte Erhard die „Gesichtspunkte“ untersuchen, die bei der „Verwertung des volksfeindlichen Vermögens zu beachten“ seien. Damit war das Eigentum von deportierten Juden und missliebigen französischen Politikern gemeint.

Konrad Adenauer - Im Gespräch mit Ludwig Erhard-kasf0104.JPG

Beide kämpfen um ihre Vergangenheit .

Auch die zweite Expertise hatte mit diesem Themenkomplex zu tun: In den enteigneten Betrieben waren NS-Manager eingesetzt worden, die sich oft als extrem korrupt und unfähig erwiesen, so dass Erhard nun die „Problematik der kommissarischen Verwalter“ beleuchten durfte. Erhard war also bestens über die Judenverfolgung informiert – und gedachte davon zu profitieren, indem er Gutachten einwarb. Nach dem Krieg verbreitete Ludwig Erhard die Legende, er habe in Lothringen nur die Glasindustrie untersucht.

1940 tat Erhard zudem einen weiteren Großkunden auf – die „Haupttreuhandstelle Ost“, die im annektierten Polen tätig war. Mehrfach bereiste Erhard diese Gebiete und sprach dort mit den „verschiedensten und maßgebendsten Stellen“, wie er in einem Brief an Nürnbergs NS-Bürgermeister Eickemeyer herausstrich. Erhard kannte also das Grauen, das sich in Polen abspielte.

Massenmord als „Evakuierung“

Die polnische Elite war bereits im Herbst 1939 ermordet worden, um jeden Widerstand zu brechen: 20.000 Politiker, Priester, Professoren, Lehrer und Adlige wurden als Geiseln erschossen oder bestialisch niedergemetzelt. Diesen Massenmord umschrieb Erhard später in einem Gutachten euphemistisch als „Evakuierung der sogenannten polnischen Intelligenz“.

Die restliche Bevölkerung wurde ausgehungert und teilweise deportiert, weil die Gebiete möglichst schnell „eingedeutscht“ werden sollten. Bis Mai 1941 wurden 320.000 Polen aus dem Warthegau und aus Westpreußen in Züge gepfercht und in den Osten Polens abtransportiert, wo es für sie weder Nahrung noch Unterkünfte gab. Gleichzeitig wurden 160.000 Juden in das Ghetto von Lodz gezwängt und später ermordet.

Maischberger - 2019-03-06-6426.jpg

Erhards neuer Großkunde, die „Haupttreuhandstelle Ost“, war Teil dieser brutalen Gewaltherrschaft: Sie sollte die konfiszierten polnischen Betriebe verwalten, verwerten und an Deutsche übertragen. Allerdings zogen gar nicht genug qualifizierte „Volksdeutsche“ ins Warthegau um, so dass es mehr enteignete Firmen als deutsche Interessenten gab. Erhard sollte daher ein wirtschaftspolitisches Gesamtkonzept entwerfen, wie sich der „neue deutsche Ostraum“ entwickeln ließe.

Rassistische Klischees

Im Sommer 1941 war der Vorbericht fertig, in dem es nicht an rassistischen Klischees fehlte. So schrieb Erhard beispielsweise: „Der polnische Arbeiter hat sich ja als willig und fleißig erwiesen, wenn auch seine Leistung nicht an reichsdeutschen Maßstäben zu messen ist. Dies ist der Ausfluss mangelnder Erziehung und rassisch bedingter Eigenschaften.“ Erhard stellte daher fest: „Das polnische Volk hat weder die Gestaltungskraft noch den Gestaltungswillen, die es zu so wahrhaft kultureller Leistung befähigt.“ Erhards implizite Botschaft: Die Polen konnten froh sein, dass sie von den Deutschen unterworfen und enteignet worden waren, denn nun übernahm der germanische Sachverstand.

Quelle          :          TAZ           >>>>>          weiterlesen

———————————————————————–

Grafikquellen         :

Oben      —       For documentary purposes the German Federal Archive often retained the original image captions, which may be erroneous, biased, obsolete or politically extreme. Herr Dr. Wehrenkamp (Ukon Verlag) überreicht Dr. Ludwig Erhard sein Buch „Wohlstand für Alle“

—————————–

Unten       —          MAISCHBERGER am 6. März 2019 in Köln. Produziert vom WDR. Thema der Sendung: „Attacke auf die Reichen: Beschimpfen, besteuern, enteignen?“ Foto: Ulrike Herrmann, Journalistin

Abgelegt unter Bildung, Bücher, Deutschland, Finanzpolitik | Keine Kommentare »

Nach dem Untergang

Erstellt von DL-Redaktion am 8. November 2019

Knappe Nachricht von den Deutschen

File:Die Gartenlaube (1871) b 672.jpg

Heim ins Reich und wo findet wer die Karrenbauer ?

Quelle         :     untergrund:blättle CH.

Von Eckharh Mieder

Was haben die Deutschen erfunden?
Das Auto und die Kriege,
Die nach dem Untergang
Als Weltkriege in den Büchern
Der Überlebenden und sonstigen Aliens
Eingetragen sind.

Die Deutschen sind freundliche Menschen.
Sie fassen alles korrekt an. Messer und
Gabeln beherrschen sie. Und das Auslöffeln auch.
Niemand von ihnen hat die Absicht,
Mauern zu bauen oder Flughäfen
Oder Gräben zwischen Mensch und Mensch
Auszuheben.

Das haben die Deutschen noch erfunden: zum einen
Den Kommandoton, zum anderen
Das Winseln vor den Stiefeln, die sie
Selber tragen oder vor denen sie sich
Verneigen dürfen. Aber
Sind die Deutschen damit speziell?

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————

Grafikquelle         :      Die Gartenlaube. / Ernst Keil (PD)

Abgelegt unter Bildung, Deutschland, Feuilleton, Regierung | Keine Kommentare »

10 Gebote via Klimasünden

Erstellt von DL-Redaktion am 1. November 2019

Was tun gegen die Erderwärmung

File:Cloudeffects.svg

Von Daphne Weber

Extinction Rebellion hat Recht: die Erderwärmung ist besorgniserregend, Endzeitstimmung ist angesagt. Aber wer ist der Adressat des Jüngsten Gerichts?

In wallende rote Gewänder gekleidet schreiten schweigende Gestalten durch die Straßen. Einige von ihnen tragen rote Fahnen, auf ihnen eine stilisierte Sanduhr. Hamburg: Über die neue Promenade ergießt sich rotes Kunstblut, inmitten der Lake ein weißer Sarg, ebenfalls mit einer Sanduhr versehen. Nein, wir sind nicht versehentlich in der Karwoche in Sevilla gelandet, bei der Hunderte in violetten Büßergewändern durch die Stadt prozessieren und um die Vergebung ihrer Sünden bitten. Es handelt sich um Protestformen der Gruppe Extinction Rebellion (XR), die unter anderem Anfang Oktober einige Straßenblockaden in Berlin organisiert hat, um auf das globale Artensterben aufmerksam zu machen.

Nichtsdestotrotz ist der Vergleich mit Büßerprozessionen nicht ganz weit hergeholt. XR bemüht die martialische Bildwelt gern, zum Beispiel, wenn Galgen aufgestellt werden, unter denen Demonstranten auf schmelzenden Eisblöcken stehen. So weit, so mittelalterlich. Mit dem Unterschied, dass das Ganze in High-Quality-Videoclips voller hoch emotionalisierter Affektbilder auf Instagram zu sehen ist. Der Social-Media-Auftritt? Maximal professionell. Die Bildsprache? Maximal messianisch-religiös. Die Inhalte? Ihr werdet alle sterben.

Es kann sein, dass vor Ort alles sehr nett ist, es kann sein, dass die Initiative noch jung ist und sich erst finden muss. Aber es darf gefragt werden, wohin sie steuert.

Bei XR kann jeder mitmachen, der sich einem Konsens von 10 Geboten verpflichtet, unter anderem dem Gebot der „Gewaltfreiheit“. Welchen Gewaltbegriff XR hat, bleibt dabei schleierhaft. Parolen wie „The day of reckoning will come“ oder „Stand with the earth“ erinnern an die biblische – sehr gewaltvolle – Apokalypse des Johannes. Wer nicht für mich ist, ist gegen mich, und der Tag des Jüngsten Gerichts wird kommen. Die Sanduhr läuft ab, und zwar zwingend. Damit inszenieren sich die Aktivisten als Propheten eines nahenden Endes der Welt. Die Natur ist Gott, und ihr muss man sich beugen.

Mutter-Erde-Metaphern

Die Rebellion gegen das Artensterben mag ehrenhaft sein. Sie gleitet allerdings mitunter ins Esoterische ab. Bei den Blockaden in Berlin gibt es die Möglichkeit, für die Erde zu meditieren. Alte Mutter-Erde-Metaphern treten an die Stelle eines kritischen Feminismus, der uns vor allem eines gelehrt hat: Was Natur ist, ist menschliche Kons­truk­tion. Welche Natur will XR schützen? Rebellion gegen das Artensterben um ihrer selbst willen? Oder Rebellion gegen das Artensterben, weil die Lebensgrundlage des Menschen vernichtet wird?

Dass der Mensch die Natur in Ansätzen beherrschen gelernt hat, ist ein Fortschritt, hinter den eine progressive Bewegung nicht zurückfallen sollte. Und ohne technischen Fortschritt ist die gerechte, klimafreundliche und ausbeutungsfreie Gesellschaft auch nicht zu denken. Wer das infrage stellt, sehnt einen Steinzeitkommunismus herbei, in dem wir uns wieder selbstversorgend vom Schweiß des Ackers ernähren und eine Lebenserwartung von knapp vierzig Jahren haben, Säuglingssterblichkeit inklusive. In manchen Teilen der Umweltbewegung wirkt es, als seien der technische Fortschritt und der Mensch an sich das Problem, da sie das Artensterben verursachen würden. Hier muss letztlich der emanzipierte Mensch unsichtbar werden, er muss verschwinden, so wie die sündigen Büßer unter ihren Gewändern.

Ja, die Erderwärmung ist besorgniserregend, Endzeitstimmung scheint angebracht. Aber wer ist der Adressat des Jüngsten Gerichts? Die Bilder, die die Anti-Kohlekraft-Bewegung Ende Gelände produziert, scheinen ebenfalls der Apokalypse zu entstammen: Aktivisten in weißen Anzügen schlittern durch sandige Wüsten, über ihnen bäumen sich gigantische Kohlebagger auf, umringt von Robotercops. Das ist die Realität 2019, auf die Ende Gelände den medialen Fokus richtet: Eine Marslandschaft, geopfert dem Konzernprofit. Ende Gelände legt den Finger in die Wunde und adressiert einen sorgfältig abgeschirmten konkreten Akteur der Klimakrise: RWE. Der Kampf um Klimaschutz ist kein individueller Ablasshandel. So erscheint er aber oft bei Gruppen wie XR.

Climate change protests, Melbourne.jpg

Der einzelne Mensch an sich ist nicht der Hauptverursacher der Klimakrise. Anders gefragt: Wo soll eine Hartz-IV-Mama den Gürtel noch enger schnallen? Wie soll der Pendler in die Stadt, um Lohn zu erarbeiten, wenn der ÖPNV so miserabel ist? Die Verzichtslogik bei Umweltgruppen wie XR kommt im Büßergewand daher, und das passt auch zur Inszenierung der Proteste.

„Sagt die Wahrheit“

Die Aktivisten weisen zwar darauf hin, dass der Kollaps von Ökosystemen auch das Aussterben des Menschen zur Folge haben wird. Die Klimakrise wird aber nicht gelöst werden, wenn man so tut, als seien alle Menschen in gleicher Weise „Klimasünder“ und müssten einfach nur Abbitte leisten. Die Klimakrise wird nicht überwunden werden, wenn Wirtschaft und Verteilung des Reichtums unangetastet bleiben. Das gehört zur Wahrheit, und „Sagt die Wahrheit“ ist schließlich eine der drei Kernforderungen von XR.

Quelle          :       TAZ           >>>>>          weiterlesen

————————————————————————-

Grafikquellen         :

Oben         —       Hohe Wolken sind oft dünn und nicht sehr reflektierend. Sie lassen einen Großteil der Sonnenwärme durch, und da sie in großen Höhen liegen, wo die Lufttemperatur sehr niedrig ist, strahlen diese Wolken nicht viel Wärme ab. Die Tendenz hoher Wolken ist, die Erde zu erwärmen. Niedrige Wolken sind oft dicht und reflektieren viel Sonnenlicht zurück in den Weltraum. Sie liegen dabei auch niedriger in der Atmosphäre, wo Temperaturen wärmer sind, und strahlen deshalb mehr Wärme ab. Die Tendenz niedriger Wolken ist, die Erde zu kühlen.

Author Christoph S.    /     Source    —    original image, freely redrawn with Inkscape by User:Gissi

I, the copyright holder of this work, release this work into the public domain. This applies worldwide.
In some countries this may not be legally possible; if so:

—————————-

Unten           —         Thousands of Cyclists in Melbourne for 350 Climate Protest

Abgelegt unter Bildung, International, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Steinmeiers Meinung

Erstellt von DL-Redaktion am 27. Oktober 2019

Meinungsfreiheit mit zweierlei Maß gemessen?

Bundespräsident Frank-Walter Steinmeier bei der Eröffnung der Sonderausstellung im Kloster Dalheim.jpg

An wievielen Fäden zieht er? Oder wird er gezogen ?

Quelle       :        Scharf  —  Links

Von systemcrash

Jetzt erregt man sich gerade medial über die Einschränkung der Meinungsfreiheit bei Lucke und de Maiziere. Sicherlich kann man sich darüber streiten, ob die Aktionen gegen beide Sinn mach(t)en. Aber irgendwie wird man das Gefühl nicht los, dass diese Debatte mit einer gehörigen Portion Heuchelei geführt wird. Wenn Steinmeier sagt:

„Andere zum Schweigen bringen zu wollen, nur weil sie das eigene Weltbild irritieren, ist nicht akzeptabel.“

Dann frage ich mich unwillkürlich, ob diese Aussage auch für die online-Plattform linksunten gilt. (Pikanterweise war de Maiziere auch für das Verbot dieser online-Plattform zuständig). Polemisch könnte man Steinmeier noch fragen, ob seine Aussage auch für Nazis und Holocaust-Leugner gilt, aber das würde dann wieder eine Debatte über die Grenzen der Meinungsfreiheit erfordern. Grundsätzlich würde ich sagen, dass die Meinungsfreiheit unteilbar sein muss, wenn sie ihren Sinn erfüllen soll[1], dass es aber Rechtsgüter gibt, die über der Meinungsfreiheit stehen. Tatsächlich würde ich das Holocaust-Leugnen nicht unter Meinungsfreiheit subsumieren. Wenn aber jemand sagt, die Erde sei eine Scheibe, dann tut er zwar den wissenschaftlichen Bemühungen Gewalt an, aber er schadet damit niemanden. Hingegen tritt der Holocaust-Leugner das Andenken von millionen Menschen mit Füssen. Hier müsste also eine gesetzliche Schutzfunktion greifen (vermutlich liefe die Argumentation über Art. 1 GG)

Natürlich wird man sagen, dass Gewaltaufrufe sich aussserhalb des legitimen (legalen) Diskurses befinden. Aber Aufrufe (Texte) sind etwas anderes als Taten (hinzu kommt das Problem, ob man Texte von Lesern einer Redaktion/Moderation zurechnen kann. Ich denke nicht). Und wer definiert eigentlich, welcher Diskurs legitim ist und welcher nicht? Selbst das Gewaltmonopol des Staates ist immerhin ein Monopol auf Gewalt!

Tatsächlich berühren wir hier das Kernproblem jeglicher Staatstheorie. Jede staatliche Herrschaft beruht auf eigener Machtsetzung[2]; d. h., der Erhalt der eigenen Macht ist die höchste Handlungsmaxime (Staatsräson). Allerdings ist diese Handlungsmaxime nicht völlig willkürlich (hier scheint mir ein Fehler so mancher ‚anarchistischer‘ oder ‚autonomer‘ Staatskritik zu liegen), vielmehr ist die Verteidigung des bestehenden Gemeinwesens ein durchaus sinnvolles Interesse. eine Gesellschaft, die sich ständig in Krisensituationen befinden würde, könnte niemals eine gewisse Kontinuität und Stabilität entwickeln; und beides ist aber wichtig für wirtschaftlichen, wissenschaftlichen und kulturellen Fortschrittt. (Das Problem, dass bürgerliche Gesellschaften eo ipso selbst immer schon strukturelle Gewaltverhältnisse zum Ausdruck bringen, scheint diese Stabilitätsbemühungen zwar schwieriger aber sicher nicht völlig vergeblich  zu machen.)

Das würde aber im Umkehrschluss bedeuten, dass sich die ‚Machtfrage‘ (die Frage nach der Legitimität der staatlichen Macht) nur in Umbruchzeiten (Kriege und Revolutionen) stellen würde. Solange aber die Verhältnisse so stabil sind wie bei uns, kann es doch nicht schaden, wenn die Leute sich aus allen möglichen Quellen informieren können (Art. 5 GG), solange nicht übergeordnete Interessen tangiert sind (siehe das Beispiel mit dem Holocaust-Leugnen).

Tatsächlich scheinen mir für das Verbot der internet-Plattform linksunten keine übergeordneten Gründe vorzuliegen. Es war ein aus der Entwicklung der Ereignisse um G20 hervorgegangener Exzess der ‚wehrhaften Demokratie‘. Ein klassischer Fall davon, das Kind mit dem Bade auszuschütten:

Das was eigentlich geschützt werden sollte, die ‚freiheitliche Demokratie‘, wurde im Gegenteil beschädigt.

Ob die Gerichte da gegensteuern können? – Da können wir nur abwarten, aber letztlich sind auch Gesetze und Gesetzesauslegungen Teil der gesellschaftlichen und politischen Kräfteverhältnisse.

Und da siehts im Moment (und auch schon länger) für die linke eher mau aus.

 [1] „Freiheit nur für die Anhänger der Regierung, nur für Mitglieder einer Partei – mögen sie noch so zahlreich sein – ist keine Freiheit. Freiheit ist immer nur Freiheit des anders Denkenden. Nicht wegen des Fanatismus der ‚Gerechtigkeit‘, sondern weil all das Belehrende, Heilsame und Reinigende der politischen Freiheit an diesem Wesen hängt und seine Wirkung versagt, wenn die ‚Freiheit‘ zum Privilegium wird.“ — Rosa Luxemburg 

[2] Siehe dazu meine vierteilige Artikelreihe zur Gewaltdiskussion bei scharf links: https://systemcrash.wordpress.com/2017/07/18/lesehineis-dreiteilige-artikelreihe-zur-gewaltdiskussion-bei-scharf-links/

„In einem Staat hängt die Auslegung des Naturrechts nicht von den Gelehrten und Schriftstellern der Moralphilosophie, sondern von dem Staat selbst ab. Deren Lehren sind vielleicht wahr; aber nicht durch Wahrheit, sondern durch Machtvollkommenheit wird etwas zum Gesetz.“ — Thomas Hobbes, Leviathan 

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————–

Grafikquellen      :       Bundespräsident Frank-Walter Steinmeier bei der Eröffnungsfeier zur Sonderausstellung „Verschwörungstheorien – früher und heute“ im Kloster Dalheim. (Foto: LWL/photothek.de/Xander Heinl)

Abgelegt unter Bildung, Bundespräsident, Positionen, Regierungs - Werte | Keine Kommentare »

Karliczeks Batteriezentrum

Erstellt von DL-Redaktion am 25. Oktober 2019

Ein Forschungsinstitut für Münster

Recke CDU Politischer Aschermittwoch 2014 Anja Karliczek Markus Pieper Karl Josef Laumann 01.jpg

Hoch auf den gebräunten Podest

Von Manfred Ronzheimer

Es wurde eine Kommission gegründet, um den besten Standort für das Institut zu finden. Dann entschied das Forschungsministerium ganz anders. Den Zuschlag bekam die Heimatregion der Ministerin.

Bundesforschungsminis­te­rin Anja Karliczek musste an diesem Mittwoch zum zweiten Mal im Forschungsausschuss des Deutschen Bundestags antreten, um Auskunft in der sogenannten Batterieaffäre zu geben. Seit drei Monaten wird der Politikerin vorgehalten, dass ihr Bundesministerium für Bildung und Forschung (BMBF) in der Standortentscheidung über die Errichtung einer Forschungsfabrik für Batteriezellen die NRW-Stadt Münster bevorzugt hatte, unmittelbar neben dem Wahlkreis der CDU-Bundestagsabgeordneten Karliczek. Zuletzt standen sogar Rücktrittsforderungen im Raum, sogar von der CDU-Kultusministerin Susanne Eisenmann aus dem unterlegenen Baden-Württemberg, ein ungewöhnlicher Vorgang – „friendly fire“.

Die Batterieaffäre hat in den letzten Wochen die Kommunikationsfähigkeit des deutschen Forschungsministeriums – mit 18 Milliarden Euro immerhin der viertgrößte Einzelplan im Haushalt der Bundesregierung – bis an die Grenzen belastet. Hintergrundgespräche und Briefings in Folge, eine außerplanmäßige Anhörung des Ausschusses in der Sommerpause, durchgestochene Dokumente aus den Beratungen – auf den Ministeriumsneubau am Rande der Spree rollte offenbar ein Polit-Tsunami zu.

Oder doch nur ein Sturm im Wasserglas? Am Dienstag dieser Woche trifft die Ministerin im Morgengrauen mit zwei Journalisten der Süddeutschen Zeitung zusammen, um Fehler einzugestehen, was sie tags darauf auch im Parlamentsausschuss wiederholen wird. Aber die Schuldeingeständnisse sind eher banal. So hätte die „Gründungskommission“ der Zellenfabrik aus ihrer Sicht einen weniger missverständliche Namen tragen müssen.

Tatsächlich aber ist die fragwürdige Vergabepraxis für die Forschungsfabrik nur die innere Puppe einer Art russischer Matroschka, die tiefer reichende Defizite der deutschen Innovations- und Industriepolitik in größeren Zusammenhängen symbolisiert. Puppe 2: Die innovative Fehlentwicklung der deutschen Automobilwirtschaft, die jedes Jahr Abermilliarden an Forschungsgeldern in die Fortentwicklung auslaufender Verbrennungstechnologien investiert und den Epochenübergang zur Elektromobilität verschlafen hat, zum Schaden des gesamten deutschen Volkswirtschaft.

Puppe 3: Der widerstandslose Abbau der Elektrochemie – einst ein Paradefeld deutscher Grundlagenforschung – in den Hochschulen der 80er und 90er Jahre, mit dem Nebeneffekt, dass der einst führende Batteriehersteller Varta in diesen Jahren zerlegt wird. Ausstieg aus einem Zukunftsfeld, auch durch Fehleinschätzungen der damaligen Wissenschaftspolitik. Der diesjährige Chemie-Nobelpreis 2019 für die Lithium-Ionen-Batterie geht logischerweise an keinen deutschen Forscher.

Ein internationales Wettrennen

Nun muss sich Deutschland sputen, um im internationalen Wettrennen um die Stromspeicher von morgen nicht abgehängt zu werden. Batterien unterschiedlicher Bauart werden nicht nur für die Elektromobilität auf der Straße oder die mobile Kommunikationstechnik, sondern vor allem als Puffer für die erneuerbaren Energien benötigt. In den letzten Jahren hat das BMBF rund 500 Millionen Euro in den Aufbau neuer Strukturen für die Batterieforschung investiert. Am stärksten profitiert hat davon der Standort Ulm in Baden-Württemberg.

Im vorigen Jahr reiften im BMBF die Pläne zum Aufbau einer Forschungsfabrik für neue Verfahren zur Produktion von Batteriezellen, die mit 500 Millionen Euro aus dem Forschungsetat finanziert wird. Als Träger wurde die Fraunhofer-Gesellschaft ausgewählt. Vorbild ist die vor einigen Jahren installierte „Forschungsfabrik Mikroelektronik“, die von Fraunhofer zusammen mit der Leibniz-Gemeinschaft realisiert wurde.

Das BMBF-Vorhaben läuft parallel zum Aufbau einer konventionellen Fabrik zur Produktion von Batteriezellen, die das Bundeswirtschaftsministerium (BMWi) aus seinem Etat mit einer Milliarde Euro bezuschusst. Den Antrag eines europäischen Industriekonsortiums hat Wirtschaftsminister Peter Altmaier am 9. Oktober bei der EU-Kommission in Brüssel zur Genehmigung für ein sogenanntes IPCEI (Important Project of Common European Interest) eingereicht. Hauptziel ist es hier, die Abhängigkeit der europäischen Autoindustrie von asiatischen Antriebsbatterien zu verringern.

Anja Karliczek 04.jpg

An dem Interessensbekundungsverfahren des BMWi hatten sich mehr als 30 Unternehmen aus der gesamten Wertschöpfungskette „mit Vorschlägen hoher Qualität beworben“, teilte das Altmaier-Ministerium mit. „Sie kommen aus den Bereichen Rohstoffe und Exploration, Materialgewinnung und Recycling, Kathoden-, Anodenfertigung und mechanische Komponenten, Batteriezellproduktion, -integration und -anwendung.“ Die Standort-Entscheidung soll in den nächsten Wochen getroffen werden.

Datenvernetzte Fabriken

In der Forschungsfabrik des BMBF sollen dagegen neue Wege beschritten werden. Anfang des Jahres 2019 wurde auf einer Veranstaltung des Batterieforums das BMBF-„Dachkonzept Forschungsfabrik Batterie“ vorgestellt, das den „Aufbau und Betrieb einer weltweit einzigartigen Pipeline für Batterieinnovationen“ umriss. Dabei geht es vor allem um die drei Teilbereiche „ Materialkonzepte“, „Zellkonzepte“ – wie sie auch schon in der Forschungsproduktionsanlage am ZSW in Ulm „validiert“ wurden sowie um „Produktionskonzepte“, bei denen die deutschen Stärken im Bereich von „Industrie 4.0“, der datenvernetzten Fabrik, ausgespielt werden sollen.

Quelle       :          TAZ         >>>>>           weiterlesen

——————————————————————-

Grafikquellen        :

Oben      —          The 13th Political Ash Wednesday (Politischer Aschermittwoch) of the CDU-Kreisverband Steinfurt in Recke, Kreis Steinfurt, North Rhine-Westphalia, Germany. Among the CDU politicians on the podium were (from left to right) the member of the Bundestag Anja Karliczek, the member of the European Parliament Dr. Markus Pieper and Secretary of State of Germany Karl-Josef Laumann.

Abgelegt unter Bildung, Nordrhein-Westfalen, P.CDU / CSU, Regierung | Keine Kommentare »

Politiker und Arbeiten ?

Erstellt von DL-Redaktion am 24. Oktober 2019

Schluss mit all der Gratisarbeit!

File:KAS-Ehrenamt-Bild-32965-2.jpg

Menschen arbeiten und Politiker kassieren die Löhne !
Lasst die Specknacken endlich im Regen stehen !!

Quelle        :      untergrund-blättle CH.

Von  pm

Auch in der Schweiz sind die Löhne von Frauen und queeren Menschen zu tief. Ab dem 21. Oktober 2019 arbeiten Frauen und queere Menschen in der Schweiz für den Rest des Jahres gratis und das nicht freiwillig! Das ist empörend!

Deshalb haben heute schweizweit feministische Kollektive auf diese Gratisarbeit von Frauen und queeren Menschen aufmerksam. Die Feministische Bewegung Basel war mit einer Theateraktion in der Freien Strasse unterwegs.

Das Schweizer Bundesamt für Statistik hat 2016 erhoben, dass Frauen und queere Menschen im privaten Sektor rund 18.9% weniger verdienen als Männer und davon sind 8.1% nicht erklärbar, woraus auf eine Diskriminierung aufgrund des Geschlechts geschlossen werden kann.

Gestern wurden neue National- und Ständerät*innen gewählt, heute fordern wir von ihnen unter anderem Folgendes: Mehr Anerkennung für «Frauenberufe» durch Lohnerhöhungen und Lohnklassenanpassungen, im Dienstleistungssektor sowie im Bildungs-, Sozial- und Gesundheitswesen. Bekämpfung der Altersarmut von Frauen und KEINE Erhöhung des AHV-Rentenalters von Frauen bis es eine Lohngleichheit gibt. Einführung einer Elternzeit.

Dies führt zu weniger Diskriminierung von Müttern im Anstellungsverfahren, da somit auch Väter von einer Abwesenheit am Arbeitsort betroffen sind. Erweiterung der familienfreundlichen Steuerpolitik, so dass es sich für Eltern lohnt, Betreuungsarbeit gleichmässig zu verteilen.

Ab dem 21. Oktober arbeiten Frauen, und inbesondere jene im Verkauf für den Rest des Jahres quasi gratis und das nicht freiwillig!

Das Bundesamt für Statistik hat im Jahr 2016 erhoben, dass sie im privaten Sektor rund 18.9% weniger verdienen als Männer und davon sind 8.1% nicht erklärbar, woraus auf eine Diskriminierung aufgrund des Geschlechts geschlossen werden kann. Das ist empörend!

Deshalb machen am kommenden Montag schweizweit feministische Kollektive auf diese Gratisarbeit von Frauen und queeren Menschen aufmerksam.

Hast du deinen Lohn schon mal mit deinen Arbeitskolleg*innen verglichen? Kannst du mit deinen Vorgesetzten über deine Anstellungsbedingungen sprechen? Wie steht es um deine Altersvorsorge, wirst du eine anständige Rente erhalten?

File:KAS-Ehrenamt-Bild-27235-2.jpg

Lässt sich besser zeigen wer die Nutznießer sind ?

Kannst du deinen Beruf mit weiteren Verpflichtungen wie Betreuungsarbeit für Familienangehörige vereinbaren? Der Frauen*streik vom 14. Juni 2019 hat gezeigt, dass wir mehr als eine halbe Million Menschen sind, die sich Ungleichbehandlung aufgrund unseres Geschlechts nicht mehr bieten lassen. Am 20. Oktober 2019 sind Wahlen und am Tag darauf zeigen wir dem neuen Parlament, dass Taten folgen und unsere Forderungen umgesetzt werden müssen. Wir werden am 21. Oktober ab 11.00 Uhr in der Freien Strasse sein und mit Passant*innen das Gespräch über die nach wie vor bestehende Lohnungleich-heit suchen. Wir haben Informations-material und ein Znüni dabei.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————

Grafikquelle       :

Oben       —         Freiwillig ist unbezahlbar! Der CDU-Bürgerpreis: Wir suchen die Ehrenamtlichen des Jahres. Bürger machen Staat … CDU

Author CDU

Lizenz:
KAS/ACDP 10-025 : 378 CC-BY-SA 3.0 DE

———————————-

Unten      —      Ehrenamt stärken – Gemeinschaft fördern. CDU

Author CDU

Lizenz:
KAS/ACDP 10-025 : 32 CC-BY-SA 3.0 DE

Abgelegt unter Bildung, P.CDU / CSU, Regierung, Wirtschaftpolitik | Keine Kommentare »

Das Königskartenspiel

Erstellt von DL-Redaktion am 22. Oktober 2019

Vom Experiment zur Lebensweise

2018-03-12 Unterzeichnung des Koalitionsvertrages der 19. Wahlperiode des Bundestages by Sandro Halank–012.jpg

Quelle       :        Scharf  —  Links

Von Tobias Tripler

Fünf Jahre folgte ich der Idee eines „Neuen Wir“, wie ein verklärender Dokumentarfilm über Gemeinschaften so euphemistisch betitelt ist. Dazu habe ich Gemeinschaften bereist, mich dort durch teils überteuerte Einführungskurse geschleppt, als zahlender Gast freiwillig gearbeitet, um schließlich drei Jahre in der Gemeinschaft meiner Wahl zu leben.

Mein Fazit ist ernüchternd. Ebenso wenig, wie sich aus Einzelhaftkäfigen befreite Hühner plötzlich wie gesunde Vögel verhalten, verhält sich der einem natürlichen Zusammenleben entfremdete Mensch in Gemeinschaft weder natürlich noch sonderlich kooperativ. Der fliegt also nicht etwa frisch, fromm, fröhlich, frei, sondern hackt enthemmt auf den anderen ein. Zumal, und das lässt sich sicher auch über mich sagen, es oft durchaus die schrägeren Vögel sind, die in Gemeinschaften ihre Erfüllung suchen.

Da ließen sich jetzt viele, teils obskure Anekdoten erzählen. Alle aber laufen sie auf das eine grundsätzliche Phänomen hinaus, nämlich eine oft völlig unbewusste Anpassung zur Absicherung der sozialen Position im Rudel. Und daraus, in einer in sich geschlossenen Welt ohne Betriebsräte oder externe Berater, resultiert letztlich Konformismus.

Da stellte also beispielsweise eines Tages die informelle Leitung in einer als inspirierend gedachten Rede fest, dass man sich doch mehr auch „mit dem Herz verbinden“ müsse. „Gottespunkt“ wurde das genannt. In einer eigentlich aus der linken Bewegung der Siebziger stammenden Gemeinschaft. Und dann, in den „Foren“, ein gängiges Kreisformat zur Gemeinschaftsbildung, hatten auf einmal alle Kontakt zu ihrem „Gottespunkt“. Wobei sich im Alltäglichen freilich wenig änderte, genaugenommen nichts. Das war dann auch das baldige Ende meines Versuches, nämlich als ich dann in der Mitte sagte, dass dort, wo die anderen nun angeblich ihren Gottespunkt entdeckt hätten, bei mir ein schwarzes Loch zu finden sei. Das Ausmaß der subtilen Ausgrenzung, die folgte, spottet wirklich jeder Beschreibung.

Ähnliche Strukturen erkenne ich überall, ob nun im florierenden Seminarbetrieb oder in vielen politischen Bewegungen. Da sind dann alle für ein Wochenende plötzlich alle Schamanen, Indianer oder gar Heilige. Die Bourgeoisie trinkt Bionade und mampft fair-trade Avocados und definiert sich so als umweltbewusst. Die rigorose Selbstinszenierung, die ewige Einteilung in In- und Outgroup, all das bleibt herzlich unentdeckt. Am Ende werden auch hier wie üblich die Falschgläubigen bekämpft, Fridaysforfuture vs. Extinction Rebellion, man kennt das. Und am Montag ist für gewöhnlich dann alles back to normal. Der Banker traktiert weiter die zahlungsunfähigen Schuldner, ebenso wie der motivierte Umweltkämpfer seinen nächsten Urlaub mit Ryanair bucht. Der als hehrer Verfechter der Arbeitnehmerrechte verkleidete Lohnsklave bestellt seine Bücher weiter bei Amazon. Und der Ultrarechtgläubige Off-Grid-Punk verurteilt sie alle.

Zumindest ich habe weder im Kontext von Gemeinschaft, noch im Seminarbetrieb oder der politischen Gegenbewegung, so etwas wie Nachhaltigkeit entdecken können. Vielmehr scheint mir Dante Recht gehabt zu haben: Der Weg zur Hölle ist gepflastert mit guten Absichten. Und die, vom Despoten bis hin zum festgeketteten Extinction-Rebellen, hat ja schließlich jeder. Nicht wahr?

Um mir Luft zu verschaffen schrieb ich ein dreißigseitiges Pamphlet zusammen, zusammengeklaubt aus meinen Erfahrungen und dem, was ich so aus der Psychologie kenne. In etwa entlang der Gedanken Erich Fromms, dass also der gut an eine kranke Gesellschaft angepasste Mensch ja keineswegs zwingend ein gesunder Mensch sei. Und einem Grundverständnis der Systemik, wo dann ja womöglich der scheinbar kranke Mensch einfach nur Symptomträger einer kranken Gesellschaft wäre, populärwissenschaftlich und recht oberflächlich zuletzt eingefangen von Manfred Lütz unter dem griffigen Titel „Wir behandeln die Falschen“.

Es ergab sich irgendwie ein Bild: Eine Kombination aus einer grundsätzlichen Opferhaltung, die letztlich eine Angstvermeidungsstrategie ist, weil sie innerhalb sozialer Kontexte Orientierung und sichere Positionierung gewährt, gepaart mit einem grundsätzlichen Gefühl des Mangels, führt zwangsläufig zu einer ungewollten Hierarchiebildung. Einer Hierarchie, deren Spitze, eben wegen der Opferhaltung, wenig bis gar nichts mehr weiß von dem, was eigentlich los ist an der Basis. Ein antiemanzipatorisches System von Anfängern und Fortgeschrittenen, das sich quasi von selbst herausbildet und dann perpetuiert.

Wie wäre das zu unterbinden? Welche Weichenstellungen müssten den Rahmen gruppendynamischer Prozesse bilden, innerhalb derer Authentizität und Emanzipation jederzeit möglich ist, ohne die Furcht vor Sanktion und Ausgrenzung? Wo jeder jederzeit ohne Geschacher und Seilschaften legitim die Führung übernehmen könnte?

Als ich dann so also auf die Idee des Königskartenspiels kam, war mir nicht klar, dass dies in einem organischen Prozess zu dem führen würde, was wir als Autorenkollektiv jetzt auf der Frankfurter Buchmesse als „Das Guruparadox“ präsentieren konnten.[1]

Dabei ist die Grundidee simpel: Jede hat eine Ermächtigungskarte, mit der sie jederzeit für einen zuvor bestimmten Zeitraum die absolute Führung beanspruchen kann. Der eigentliche Clou, ich bin Doppelkopfspieler, die zweite Karte sticht die erste. Eine Regentschaft kann also jederzeit von einem anderen Teilnehmer abgetrumpft werden. So entsteht quasi instantaner Konsens.

Das, so sollte sich in der Folge zeigen, ermöglicht Handeln. Vor allem aber macht es die Opferrolle sichtbar, denn niemand kann mehr Opfer eines Prozesses sein, den er selbst in die Hand nehmen kann. Oder, erste Zusatzregel, jemand anderen dazu ermächtigen kann. Die oft genug von Verletzlichkeits- und Bedürfnisanmeldungen langatmig dominierten Diskussionen, der Verteilungskampf im Innern, wird so entweder verhindert oder offizieller Teil des konsensuellen Prozesses.

Aber wer würde denn an so einem experimentellen Raum teilnehmen wollen?

Die „Neophilen“ -ein Begriff entlehnt von Robert Anton Wilson- also die Neugierigen. Diejenigen, die die Nase voll haben vom immer gleichen Puppenspiel, bei dem die angeblich Verletzlichste letztendlich die Bremserrolle einnimmt. Denn die, das ist wichtig, dient allen. Das immer Gleiche ist dadurch voraussagbar und damit für alle Angst reduzierend.

Diesen recht polemischen Text, der heute kurz „Das Essay“ genannt wird[2], schickte ich also an einige Emailkontakte. Und vergaß ihn selbst alsbald.

Ähnlichkeiten mit Deutschen Politiker-Innen sind rein zufällig.

Mit einiger Überraschung erfuhr ich dann, dass sich eine Gruppe junger Menschen für ein Wochenende zusammengefunden hatte, um sich mit den „Thesen“ des Essays auseinanderzusetzen. Der Organisator teilte mir mit, dass ein Folgetreffen geplant sei, bei dem man nun meine Anwesenheit wünsche.

Solche Treffen, in weitaus heterogeneren Gruppen, gab es dann eine ganze Reihe, wobei erst beim Zweiten erstmals das Königskartenspiel gespielt wurde.

Schon hier wurden Erweiterungen eingeführt: Eine Schweigekarte, die jeder einmalig spielen konnte, sowie ein spontanes Vetorecht von mindestens drei Personen, das einen Königsbefehl aushebeln kann.

Beide Zusatzregeln wurden als emanzipatorisch erlebt: Das spontan ausgesprochene Veto bringt die Gruppe stärker in die Verantwortungsübernahme für den Einzelnen, beispielsweise als ein König einen provokanten Befehl erteilte. Dieser König erfand dann auch die „deligierte Regentschaft“, indem er jemanden ernannte, der so lange regierte, wie es dem König beliebte.

In den gemeinsamen Nachbetrachtungen wurde dann auch immer deutlicher, wie wesentlich das subjektive Erleben von den eigenen paradigmatischen Annahmen abhängt.

Als Beispiel kann hier die Schweigekarte dienen. Die würde man auf den ersten Blick wohl eher als ein sehr restriktives Werkzeug auffassen. Aber, verordnetes Schweigen kann Unterstützung sein:  Als „Erfinder“ trug ich gefühlt eine große innere Verantwortung. Als dann jemand mir in einer äußerst schwierigen Situation die Schweigekarte spielte, war ich verblüfft, welche unheimliche Entlastung mir das brachte. Ich konnte dadurch in einer Art zuhören und beobachten, die mir sonst kaum möglich gewesen wäre, ich war ja nun offiziell gar nicht mehr zum Beitragen gefordert.

Die anschließenden Spiele, das Längste volle drei Monate, förderten dann eben mehr solcher „Paradigmenwechsel“ zutage. Die sind notwendig, um das Spiel sinnvoll einzusetzen. Etwa so, wie bei Gewaltfreier Kommunikation nach Rosenberg, geht es auch hier um eine bestimmte innere Haltung. Auch das Königskartenspiel ist also kein rein mechanisches Werkzeug.

Da ist dann also das, was üblicherweise die Agenda bildet, nämlich dass die Gruppe insgesamt zusammenbleibt und am Ende möglichst ein Konsens gefunden ist, nicht das Maß. Im Gegenteil, wer an einem Spiel teilnimmt, will eben wissen, wohin eine Gruppe steuert, wenn man genau das aushebelt.

Entsprechend sind Königskartenspiele innerhalb von Gruppen, denen letztlich der Zusammenhalt das Hauptanliegen war, regelmäßig verfrüht abgebrochen worden. Eben immer dann, wenn der Bremser die Notbremse gezogen hat.

Das ist ein wichtiger Paradigmenwechsel: das Königskartenspiel ist nicht ergebnisorientiert, sondern prozessoffen. Es handelt sich um einen Erfahrungsraum ohne Heilsversprechen. Das darf man einfach wollen.

Ich kann heute mit einiger Überzeugung sagen, dass durch diesen Rahmen die Dynamik von Gruppen so verändert wird, dass sowohl emanzipatorische Wachstumsschritte Einzelner als auch kreative Gruppenprozesse möglich werden, die ich in konventionellen Settings so nicht erwarten würde. Letztere reproduzieren eben oft gängige Systeme. Dazu gehört, dass letztlich die informelle oder formalisierte Leitung oft ungewollt den Rahmen des Möglichen begrenzt. Zu selten jedenfalls führen hierarchische Konstellationen dazu, dass es im Rahmen von Anfängern, Fortgeschrittenen und Leitung zu fundamental neuen und nachhaltigen Entwicklungen kommt oder gar Gruppen zu kollektiver Intelligenz befähigt würden. Das nennen wir das Guruparadox.

Für das Individuum, Gemeinschaftsbildung wie für das menschheitliche Kollektiv als Ganzes  ist aber augenscheinlich Schwarmintellgenz von Nöten, wenn man sich die Komplexität der letztlich aus intrapsychischen Vorgängen hervorgehenden globalen Misere einmal vor Augen hält.

Die Gruppen selbst haben jedenfalls in spontanen Improvisationen eine Reihe neuartiger Werkzeuge entwickelt, die wir im Buch detailliert beschreiben.

In unserem realen Zusammenleben können wir uns beispielsweise die „Dynamische Interaktion“, ein Kreisfomat ohne Führung, heute gar nicht mehr wegdenken. Und eben auch das Buch wurde in einem kollektiven Prozess geschrieben, bei dem sich heute alle Teilnehmer als vollwertige Autoren begreifen, unabhängig von der konkret produzierten Textmenge.

Der Schreibprozess war so kollektiv, wie die Zusammenarbeit der Organe eines Organismus. Da „weiß“ auch das Gehirn, dass Denken nicht die wichtigste Funktion ist. Im Kollektiv gibt es einfach keine Hierarchie von Wichtigkeit. Und diese Haltung kann man lernen.

[1] Das Guruparadox; Integrale Hierarchiekompetenz und Gemeinschaftsbildung. Edition-AV, 2019.

[2] Den Text gibt es zum kostenlosen Download auf http://conscious-evolution.xyz.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen      :

Oben      —        Unterzeichnung des Koalitionsvertrages der 19. Wahlperiode des Bundestages: Lars Klingbeil; Andrea Nahles; Olaf Scholz; Angela Merkel; Horst Seehofer; Alexander Dobrindt; Volker Kauder; Annegret Kramp-Karrenbauer; Andreas Scheuer

Abgelegt unter Bildung, P.CDU / CSU, P.SPD, Regierung | Keine Kommentare »

Protest gegen Lucke

Erstellt von DL-Redaktion am 21. Oktober 2019

Danke für die Störung, Hamburg

Bernd Lucke.jpg

Eine Kolumne von Fatma Aydemir

Dass der AfD-Mitgründer seinen Lehrstuhl wieder aufnehmen darf, sollte keine Selbstverständlichkeit sein. Die Proteste sind ein wichtiges Zeichen.

Die einzigen Waffen, die uns in einer Demokratie zustehen sollten, sind unsere Stimmen. Und mit Stimmen meine ich beide Varianten: das Kreuzchen auf unserem Wahlzettel, und das, was wir zu sagen haben. Dass unsere Stimmen mal lauter, mal aggressiver, mal verstörender klingen werden, lässt sich nicht vermeiden. Ja, es ist sogar notwendig.

Gerade in einer Zeit wie dieser, in der Rechtsextreme zu anderen Waffen greifen, um etwa wie kürzlich an Jom Kippur in Halle Jagd auf Menschen zu machen, die in Synagogen beten, in Döner-Imbissen arbeiten oder einfach nur die Straße entlang spazieren.

Nun dürfte es wenig bringen, bewaffnete Terroristen anzuschreien. Sie sollten ja ein Fall für die Sicherheitsbehörden sein, die theoretisch längst alle Möglichkeiten besitzen, rechte Gefährder ausfindig zu machen, bevor diese morden – wenn denn Interesse daran bestünde. Wo wir hingegen unsere lautstarken Zwischenrufe strategisch nutzen können, sind die Orte, an denen jene Politiker sprechen, die den ideologischen Boden für solche Taten bereiten.

2013-06-08 Projekt Heißluftballon DSCF0778.jpg

So etwa letzte Woche an der Uni Hamburg, als AfD-Mitbegründer Bernd Lucke nach fünf Jahren Beurlaubung seine erste Vorlesung in Makroökonomie halten wollte. Zwischenrufe wie „Nazischweine raus aus der Uni“ und „Ganz Hamburg hasst die AfD“ hinderten ihn daran. Einige Journalist_innen, auch in diesem Blatt, verurteilten diesen Protest. Unis seien Orte des Diskurses, dazu gehörten auch „unterschiedliche Meinungen“. Und Lucke sei schließlich nicht Höcke, also kein eindeutiger „Nazi“, zudem sei er aus der AfD ausgetreten.

Abstecher in den Rechtsextremismus

Quelle       :           TAZ          >>>>>          weiterlesen

—————————————————————–

Grafikquellen        :

Oben        —       Bernd Lucke

Abgelegt unter Bildung, Hamburg, Kultur, P.AfD | 1 Kommentar »

Scheiß auf die Kids?

Erstellt von DL-Redaktion am 20. Oktober 2019

Nein – Scheiß auf Merkel !

DBG 22355 (38432661520).jpg

Von Peter Unfried

Wie bekommt die gesellschaftliche Bewegung für Klimapolitik schnell eine Bundesregierung, die handelt?

eit dem großen Septemberstreik frage ich jeden, den ich treffe: Wie geht es weiter mit der von Fridays for Future (FFF) angestoßenen Bewegung für Klimapolitik, die sich auf breite Teile der Gesellschaft ausgedehnt hat? Hier mein Zwischenergebnis.

Die eine Möglichkeit: Demnächst kracht irgendwo irgendwas, die Mehrheits- und Mediengesellschaft beschäftigt sich damit, und FFF laufen freitags ins Leere.

Die zweite Möglichkeit: Die Politik des „Scheiß auf die Kids“ wird durchgewinkt. Die Mehrheitsgesellschaft arrangiert sich mit der Position der Bundesregierung, dass das absurde Missverhältnis zwischen ihrer mickrigen Klimapostwurfsendung und der krassen Problemstellung das letzte Wort ist. Union und SPD lenken sich unter Assistenz der Hauptstadtjournalisten mit schnarchigen Personalfragen (Scholz und AKK) und internen Intrigen (gegen Scholz und AKK) von den Problemstellungen der Wirklichkeit ab. So gehen die nächsten beiden Jahre verloren.

Die dritte Möglichkeit: FFF sind in die gesellschaftliche DNA eingedrungen. Ernsthafte Bekämpfung der Erderhitzung wird eine Grundbedingung für Regieren wie es die Bekämpfung der Arbeitslosigkeit war. Die nächste Bundesregierung wird auf der Grundlage eines Zukunftsplanes durch sozialökologische Wirtschaft und europäische Politik gewählt.

End of the FridaysForFuture demonstration Berlin 29-03-2019 05.jpg

Nachdem von politischen Idioten alles platt gemacht  wurde – helfen nur noch Kinder !

Jetzt ist die Frage: Wer will und kann eine Mehrheit dafür gewinnen? SPD, FDP und Linkspartei helfen dabei nicht. Erstens haben sie kaum noch Wähler. Zweitens haben sie (Achtung, Zusammenhang) die soziale und wirtschaftliche Dimension einer sozial­ökologischen Transformation bisher knallhart ignoriert. Die Union leider auch. Und manche dort scheinen zu hoffen, dass die Leute von der Sache ablassen, wenn man sie wieder mit den handelsüblichen Ängsten füttert. Immerhin hat die CDU aber eine Politikerin, die mit einem entsprechenden Wählerauftrag eine überzeugende Klimakanzlerin geben könnte. Angela Merkel.

Quelle        :       TAZ        >>>>>          weiterlesen

——————————————————————

Grafikquellen            :

Oben       —        DBG 22355 (38432661520)

———————————–

Unten        —        Abschlusskundgebung der FridaysForFuture Demonstration am 29. März 2019 in Berlin.

Abgelegt unter Berlin, Bildung, International, Kriegspolitik | Keine Kommentare »

Terroranschlag von Halle

Erstellt von DL-Redaktion am 18. Oktober 2019

Wie das Netz den Faschismus befeuert

Datei:Skulptur Juedische Opfer des Faschismus (Foto 2008).jpg

Eine Kolumne von

Das Internet ist gefährlich. Dann, wenn es als Radikalisierungmaschine wirkt. Das Fundament dafür liefert die Gesellschaft – im Fall Halle durch die Allgegenwart des Antisemitismus, rechts wie links.

Der antisemitische, rassistische Terroranschlag in Halle ist der jüngste Spross eines so furchtbaren wie fruchtbaren Paares. Zusammengekommen sind eine faschistische Ideologie und das Internet.

Zu den absurden deutschen Ritualen gehört es, in nicht mehr ignorier- oder leugbaren Fällen von Antisemitismus laut „Nie wieder!“ zu rufen, eine der folgenlosesten Äußerungen des Universums. Und zu den gefährlichsten deutschen Ritualen gehört es, die Gründe für alles Schlimme dort zu suchen, wo es einem am besten in den Kram passt. Manchmal geschieht aber noch nicht einmal das.

Der Grund, warum Deutschland über Gaming diskutiert: Das ist für alle Beteiligten die angenehmste Debatte. Gamer können mit großer Geste jede Verbindung zwischen Gaming und menschenfeindlichen Ideologien als absurd abtun. Die restliche Gesellschaft kann empört sein über irgendwas, was sie nicht versteht und das sie deshalb selbst von jeder Reflexion freispricht. Und Horst Seehofer kann sich stellvertretend für die Regierung zerknirscht bis überrascht geben. Oh, radikalisierte Gamer, hatte man wohl nicht auf dem Schirm, ärgerlich!

Der Autor Max Czollek hat es präzise formuliert: „Das hier ist der Sturm, vor dem wir euch gewarnt haben„.

  • Wer diese Warnungen nicht hören wollte, bestand – wie die halbe Union – noch stets darauf, in der Sekunde der Erwähnung von Rechtsextremismus auch Linksextremismus zu sagen. Als sei nicht der Unterschied im 21. Jahrhundert in Deutschland, dass Linksextreme Autos anzünden und Rechtsextreme Menschen.
  • Wer diese Warnungen nicht hören wollte, erklärte – wie Peter Sloterdijk – im Juni 2019, dass „das derzeit in Deutschland beklagte Ansteigen des Antisemitismus“ purer Alarmismus sei und damit „Emotionen, die mit dem eigentlichen Risikopotenzial nichts zu tun“ hätten. Sloterdijk glaube „an diese ganzen Bedrohungen“ nicht. Wörtliche Zitate, das denke ich mir nicht aus.
  • Wer diese Warnungen nicht hören wollte, der ließ – wie Frank Plasberg – einfach einen zutiefst antisemitischen Zuschauerkommentar stehen, als handele es sich um eine ganz normale Meinung: Das „Judenthema“ solle man doch allmählich „zurücknehmen“, es schüre Hass.

Verharmlosung und Beschwichtigung gehört zum Judenhass

Der Attentäter selbst sagte, er habe eine „judenkritische Einstellung“, und wirft damit das Echo einer Gesellschaft zurück, in der Rechtsextreme von Qualitätsmedien als „Flüchtlingskritiker“ bezeichnet worden sind. Verharmlosung und Beschwichtigung gehört schon immer zum Judenhass. In spöttischem Sinne hat der Philosoph Isaiah Berlin das Leitmotiv vorgetragen: „Ein Antisemit ist jemand, der die Juden noch mehr hasst, als es unbedingt notwendig ist.“

Ein junger Piraten-Funktionär hat 2012 ebenso wie viele vor und nach ihm eine ernstgemeinte Variation eines bitteren Klassikers von sich gegeben: „Ich bin also Antisemit, weil ich die israelische Kackpolitik und den Juden an sich unsympatisch finde“. Nun: Ja.

Die Mutter des Attentäters hat erklärt, warum ihr Sohn Juden ermorden wollte. „Er hat nichts gegen Juden in dem Sinne. Er hat was gegen die Leute, die hinter der finanziellen Macht stehen – wer hat das nicht?“

Auf eine verquere Art muss man dieser Frau dankbar sein: Sie entlarvt unwillentlich die Allgegenwart des Antisemitismus in Deutschland. Auf der rechten Seite des politischen Spektrums führt das dazu, dass die AfD grotesk und irreal behaupten kann, sie sei eine „durch und durch pro-israelische und pro-jüdische Partei“, während maßgebliche Mitglieder vor sich hin antisemitieren. Links ist die Konsequenz, dass man – in Deutschland! – gleichzeitig gegen Antisemitismus schwafeln kann und Israel als „Apartheid-Staat“ bezeichnen. Was in jedem Fall absurd ist, aus deutschen Mündern aber eine Ungeheuerlichkeit mit extra judenfeindlichem Käse plus sehr scharfer Soße.

Wp10 20110115 IMG 9974.jpg

Auf einem solchen gesellschaftlichen Fundament des Judenhasses und der Menschenfeindlichkeit wirkt das Netz. Denn eine seiner vielen, komplexen Funktionen ist die, dass es als Radikalisierungmaschine wirken kann. Hier ist nach meiner Einschätzung im Jahr 2019 eine neue Dimension eröffnet worden. Im März ermordete ein Rechtsterrorist in Christchurch über 50 Menschen, seitdem haben sich die Attentäter in El Paso, in Poway, im norwegischen Bærum und jetzt in Halle auf ihn bezogen. Mit 25 weiteren Ermordeten.

Quelle         :          Spiegel-online         >>>>>          weiterlesen

————————————————————————–

Grafikquellen          :

Oben           —          Skulptur „Jüdische Opfer des Faschismus“ (1957) von Will Lammert in der Großen Hamburger Straße, Berlin. Sie steht vor dem Jüdischen Friedhof Berlin-Mitte.

Denkmalplakette Deutschland.svg
Dies ist ein Foto des Berliner Kulturdenkmals mit der Nummer

09035233

Urheber Jochen Teufel

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

——————————

Unten         —          Sascha Lobo; 10 Jahre Wikipedia; Party am 15.01.2011 in Berlin.

Abgelegt unter Bildung, Flucht und Zuwanderung, Mensch, Religionen | Keine Kommentare »

Linke in der Bundeswehr

Erstellt von DL-Redaktion am 18. Oktober 2019

Kritischen Soldaten gehen die Rekruten aus

Bildergebnis für Wikimedia Commons Bilder Bundeswehr in Schulen Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

Wer sich heute als Freiwilliger dem Staatsmob (immer die sich selbst zur Führung eines Staates für fähig gehaltenen Politiker – Innen) unterwirft, ganz egal ob beim Militär, Polizei oder auch Auftrags – Erfüllungsgehilfe einer Behörde, sollte sich ob der zu erfüllenden Aufgaben hin, nicht beschweren. Jeder macht sich selber einer fehlende Zivilcourage schuldig oder nicht.  Red. DL – IE –

Von Tobias Schulze

Im „Darmstädter Signal“ engagieren sich Soldaten gegen Atomwaffen und Auslandseinsätze. Am Freitag könnte sich der Arbeitskreis auflösen.

Gäbe es einen Preis für die unbequemste Soldatenvereinigung, mit denen sich deutsche Verteidigungsminister je herumschlagen mussten, dann wäre das Darmstädter Signal (DS) ein heißer Kandidat. Ein Mitglied weigerte sich einst, den Tornado-Einsatz in Afghanistan zu unterstützen und wurde versetzt. Ein anderes Mitglied ignorierte in Kabul völkerrechtswidrige Befehle und bekam eine Disziplinarstrafe. Und ein drittes Mitglied stellte seine Mitarbeit an einer Logistik-Software der Bundeswehr ein, weil deutsche Soldaten US-Kasernen bewachten, während die Amerikaner im Irak einfielen. Den Major schickten die Vorgesetzten für eine Woche in die Psychiatrie.

Als Arbeitskreis kritischer Soldaten versteht sich das DS, das zu den interessantesten Gruppierungen der Friedensbewegung gehört: Eine Handvoll Offiziere gründeten das Forum 1983, als die Nato gerade neue Atomraketen in Deutschland stationierte. Seitdem engagiert sich das DS gegen Atomwaffen, Rüstungsexporte und Auslands­einsätze, zeitweise mit über hundert aktiven Bundeswehrangehörigen. Am Freitag könnte damit aber Schluss sein – und das gegen den Willen einiger altgedienter Mitglieder.

Das Problem: Dem Arbeitskreis fehlt, genau wie vielen Gruppen der herkömmlichen Friedensbewegung, der Nachwuchs. „Der Großteil der Mitglieder ist überaltert und beteiligt sich nicht an der Arbeit. Im Vorstand sind keine aktiven Soldaten mehr vertreten“, sagt Vorstandssprecher Florian Kling. „Die Kernidee eines Forums für kritische Staatsbürger in Uniform erfüllen wir nicht mehr.“ Kling selbst, Sozialdemokrat, 32 Jahre alt und ehemaliger Jugendoffizier, war der letzte aktive Soldat im Vorstand. Er schied im vergangenen Jahr aus der Armee aus.

Capricorn 2016 (27053491923).jpg

Die Nachwuchssorgen sind lange bekannt. Schon 2018 warnte Kling intern, dass es so wie bisher nicht weitergehen könne. Weil sich die Situation trotzdem nicht geändert hat, wird er der Mitgliederversammlung des Arbeitskreises an diesem Freitag einen Vorschlag unterbreiten: Das DS selbst soll sich auflösen. Der dazugehörige Förderverein, der bislang die Aktivitäten finanzierte, soll neue Aufgaben bekommen. Er soll die Geschichte des DS dokumentieren und als Förderer bereitstehen, falls sich irgendwann doch wieder aktive Soldaten zusammenschließen.

Ein Generationenkonflikt?

Warum es so weit kommen musste? Die Gründe für die Nachwuchsprobleme sieht Kling unter anderem in der Aussetzung der Wehrpflicht. Wer heute zur Bundeswehr gehe, wolle dort Karriere machen und das nicht gefährden, indem er einem kritischen Arbeitskreis beitrete. Dieser Logik zufolge hat die Wehrpflicht früher mehr kritische Geister in die Bundeswehr gespült, die zum Teil über ihren Wehrdienst hinaus hängenblieben.

Quelle        :     TAZ          >>>>>         weiterlesen

Tobias Schulze über die Auflösung des „Darmstädter Signals“

Schade um das Korrektiv

Am Heldenplatz (30540737616).jpg

36 Jahre lang haben sich im „Darmstädter Signal“ kritische Bundeswehrangehörige vernetzt. Vor allem Offiziere aus dem grünen und sozialdemokratischen Milieu haben den Arbeitskreis im Dunstkreis der Friedensbewegung geprägt. Dass sich das Forum am Freitag voraussichtlich wegen Nachwuchsmangel auflösen wird, ist doppelt schmerzlich.

Das „Darmstädter Signal“ ist im sicherheitspolitischen Diskurs zwar nicht immer durchgedrungen, es konnte punktuell aber trotzdem Akzente setzen – vor allem durch Mitglieder, die das Mitwirken an Kriegseinsätzen verweigerten. Zweitens ist das Ende des Arbeitskreises Symptom einer weitreichenderen Entwicklung: Die Zusammensetzung der Bundeswehr hat sich durch die Aufhebung der Wehrpflicht verändert. Staatsbürger, die links der Mitte stehen, sind heute offenbar noch spärlicher vertreten als früher.

Dabei wären sie als Korrektiv gerade heute nötig: Die Bundeswehr mag vielleicht kein generelles Haltungsproblem haben, zumindest Teile der Armee sind aber blind für rechtsextreme Vorfälle.

Quelle         :          TAZ          >>>>>         weiterlesen

—————————————————————–

Grafikquellen        :

Oben      —       Autor   Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

—————————–

2.) von Oben       —          Capricorn 2016 (27053491923)

—————————–

Unten      —        Rund 1.200 Rekruten werden am Heldenplatz angelobt.

Abgelegt unter Bildung, Kriegspolitik, Medien, Regierung | Keine Kommentare »

Experte für Abfallwirtschaft

Erstellt von DL-Redaktion am 16. Oktober 2019

Das Handwerk kämpft um Auszubildende.

Wuppertal - Friedrich-Engels-Allee - Karneval 147 ies.jpg

Von Barbara Dribbusch

Das Handwerk kämpft mit einer Imagekampagne um Auszubildende. Die Unterordnung der „Handarbeit“ unter die „Kopfarbeit“ soll aufgehoben werden. Auch mit neuen Berufsbezeichnungen.

Jimmy Pelka ist ein toller Typ. Er pendelt zwischen Bad Mergentheim und den Arabischen Emiraten hin und her, rüstet Luxusautos von Scheichs und Autofans auf und fährt selbst Porsche. Auf Instagram sieht man den gelernten Kfz-Mechaniker und Firmenchef durch die Gegend düsen, irgendwo in der Wüste, neben ihm ein arabischer Auftraggeber.

Ein aufregendes Leben führt auch Johanna Röh, Tischlerin. Sie hat nach ihrer Lehre die Welt bereist, in den USA, in Südamerika, in Asien gearbeitet. Man sieht sie in Kluft neben einem japanischen Meister, einem Sensei, sitzen. Jetzt führt sie einen ökologisch orientierten Tischlereibetrieb in Deutschland und wirbt in den sozialen Medien für das Handwerk.

HandwerkerInnen sind cool – das ist die Botschaft einer Imagekampagne des Handwerks, die schon länger läuft, aber jedes Jahr immer wieder ein bisschen aufgemöbelt wird. Pelka und Röh sind die neuesten BotschafterInnen in den sozialen Medien. Davor sah man Plakate mit einer Friseurin und dem Spruch: „Ich schneide keine Haare. Ich rette dein nächstes Date“. Oder einen Heizungstechniker mit: „Die Welt war noch nie so unfertig. Heiz ihr ein“.

„Ich halte die Imagekampagne für richtig“, sagt Joachim Gerd Ulrich, Berufswahlforscher beim Bundesinstitut für Berufsbildung (BiBB), „denn die Kampagne richtet sich nicht nur an junge Leute, sondern auch an die Allgemeinheit. Das ist klug, denn die Berufswahl findet stets auf einem ‚sozialen Resonanzboden‘ statt, wird also auch davon beeinflusst, wie Dritte über Berufe denken.“

Der soziale Resonanzboden ist hart geworden für das Handwerk, es gilt vielen als die mindere Variante zu einer intellektuellen, einer technischen, einer kaufmännischen Ausbildung. „Das Problem ist das Abitur, die meisten Schüler wollen heute Abitur machen. Und dann heißt es: ‚Ich mache doch nicht Abitur, um Handwerker zu werden‘“, berichtet Daniela Wilke, Berufsberaterin bei der Bundesagentur für Arbeit in Berlin: „Außerdem herrschen immer noch die alten Vorurteile über das Handwerk.“ Ackerei ohne Ende, kaputte Knie, Staub und Schmutz, wenig Geld und private Auftraggeber, die immer was zu mosern haben und sich toll fühlen, wenn sie dem Handwerker einen Fünf-Euro-Schein als Trinkgeld in die Hand drücken.

Das Imageproblem hat Folgen: Die Zahl der unbesetzten Lehrstellen im Handwerk hat sich innerhalb von zehn Jahren bis zum Jahre 2018 vervierfacht, so das Bundesinstitut für Berufsbildung (BiBB). Ende August 2019 seien im Handwerk noch 30.000 Ausbildungsplätze offen gewesen, heißt es beim Zentralverband des Deutschen Handwerks. Auch bedingt durch die Demografie hat sich der Lehrstellenmarkt gewandelt, „weg von einem Markt für die Betriebe hin zu einem Markt für die Bewerber und Bewerberinnen“, sagt Susanne Eikemeier, Sprecherin bei der Bundesagentur für Arbeit.

Was junge Leute wollen, was sie sich von einem Beruf erwarten, ist daher mehr und mehr in den Fokus der Forschung gerückt. Die Familie nehme großen Einfluss, betont Ulrich. „Eltern wollen in der Regel, dass ihr Kind einen höherwertigen oder zumindest gleichwertigen Bildungsabschluss erlangt, als sie ihn selbst haben“, sagt er. Viele Eltern, die studiert haben, wollen nicht in ihrem akademischen Bekanntenkreis erklären müssen, dass ihr Nachwuchs „nur“ Handwerker lernt, während die Kinder der anderen im Ausland studieren. „Dieses Anerkennungsbedürfnis der Eltern in Hinblick auf Bildung und Beruf der Kinder ist nicht zu unterschätzen“, so Ulrich.

Laut einer Befragung bei Neunt- und Zehntklässlern an zumeist allgemeinbildenden Schulen kam für fast die Hälfte der jungen Befragten eine spätere Arbeit im Handwerk nicht in Frage. Am stärksten ausgeprägt war die Neigung zum Handwerk, wenn zumindest ein Elternteil selbst eine Handwerkslehre durchlaufen hatte oder wenn es im Verwandtenkreis weitere HandwerkerInnen gab. Dabei spielt der Verdienst eine große Rolle. Die gewerkschaftsnahe Hans-Böckler-Stiftung kam in einer Untersuchung zu dem Schluss, das ArbeitnehmerInnen im Handwerk im Schnitt 20 Prozent weniger verdienen als Beschäftigte in der Gesamtwirtschaft, in der AkademikerInnen die Verdienste nach oben ziehen. Auch die Tatsache, dass HandwerkerInnen meist in kleinen Betrieben arbeiten, in denen mancherorts nicht mal Tariflöhne gezahlt werden, drückt das Gehalt.

Bildergebnis für Wikimedia Commons Bilder Bundeswehr in Schulen Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

Als Sölner für den Staat – zwischen Mördern und – Innen

Wer mehr verdienen will, muss nach dem Gesellenbrief den Meisterbrief erwerben und sich selbstständig machen. Der Zentralverband des Deutschen Handwerks weist in einer Erklärung darauf hin, dass Handwerker mit Meisterbrief im Berufsleben „etwa gleich viel oder sogar mehr als Bachelorabsolventen“ verdienen können. Doch der Weg zum Meister erfordert Durchhaltevermögen. Und die Imagefrage bleibt: Nicht nur die Herkunftsfamilie, auch Gleichaltrige, potenzielle PartnerInnen entscheiden über das soziale Ansehen eines Berufes und damit auch darüber, ob junge Leute eine Ausbildung im Handwerk beginnen. „Viele Frauen haben heute höhere Schul- und Studienabschlüsse, sie wollen in der Regel Partner, die einen ebenso hohen Abschluss haben. Wer ein Handwerk erlernt, fürchtet dann möglicherweise um die Chancen auf dem Partnerschaftsmarkt“, sagt Ulrich. Er berichtet von jungen Frauen in der Universitätsstadt Heidelberg, die selbst Einzelhandelskauffrau lernten, ihre berufliche Ausbildung lieber verschwiegen und sich als Studentinnen ausgaben, um für die Jungs von der Uni interessanter zu wirken.

Quelle          :       TAZ           >>>>>          weiterlesen

——————————————————————-

Grafikquellen        :

Oben        —        Vor, während und nach dem Wuppertaler Karnevalszug auf der Friedrich-Engels-Allee am 10.02.13 in Wuppertal. Straßenreiniger der ESW mit einer Tennant Green Machines 636HS.

————————————-

Unten        —          Autor   Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

Abgelegt unter Bildung, Deutschland, Kriegspolitik, Umwelt | Keine Kommentare »

Greta Thunberg Interview

Erstellt von DL-Redaktion am 16. Oktober 2019

Die Frau, die aus dem Himmel kam

Eine kleine Weile noch – der Hintergrund im weißen Shirt, hebt gleich ab.

Interview:

Anfeindungen, Triumphe, seltsame Begegnungen: Wie die Klimaaktivistin Greta Thunberg das Jahr erlebte, vertraute sie Alexandra Urisman Otto an, Reporterin der schwedischen Zeitung „Dagens Nyheter“.

Greta Thunberg gibt nur selten Interviews. Alexandra Urisman Otto ist nah an die Ikone der Klimabewegung herangekommen: Gemeinsam mit dem Fotografen Roger Turesson hat die Reporterin der schwedischen Zeitung „Dagens Nyheter“ Thunberg in den vergangenen Monaten immer wieder getroffen.

Als Greta Thunberg ihren neuen Namen bekommen soll, erhebt sie sich von dem Plastikstuhl und stellt sich auf den Boden der Sporthalle. Chief Arvol Looking Horse steht auf dem Podium hinter ihr. Spricht ihren Namen aus und gibt den Musikern ein Zeichen. Die Feier wird von traditionellen Liedern und Trommeln begleitet.

Über 500 Kinder haben sich in der Standing Rock Community School in South Dakota versammelt, um das Gespräch zwischen Greta Thunberg und der gleichaltrigen Aktivistin Tokata Iron Eyes über die Klimakrise zu verfolgen. Die meisten hier sind Ureinwohner – Sioux, die den Stämmen der Lakota, Dakota und Nakota angehören. Der Ort wurde 2016 durch Proteste gegen die geplante Erdölfernleitung Dakota Access Pipeline bekannt. Aus Angst vor einem verheerenden Leck haben damals Tausende Menschen fast das ganze Jahr lang protestiert. Sie haben verloren, die Leitung wurde gebaut.

„Dieser Ort liegt im Zentrum des Geschehens. Die Menschen hier sind am stärksten betroffen. Sie sind aber auch diejenigen, die den Kampf gegen die Klima- und Umweltkrise anführen. Sie haben noch immer eine Verbindung zur Natur, die viele von uns verloren haben. Sie wissen, wie wir diese Krise überwinden können“, sagt Greta Thunberg nach der Zeremonie. „Außerdem war es ärgerlich, dass die Medien lieber darüber geschrieben haben, dass Kim Kardashian mich verehrt, anstatt über die Sorgen der Menschen hier zu berichten. Nun ja, die Medien treffen manchmal merkwürdige Entscheidungen.“

Jay Taken Alive, ein ehemaliger Häuptling der Sioux, hatte spontan vorgeschlagen, dass Greta Thunberg mit einem Lakota-Namen geehrt werden sollte: „Du weckst die Welt“, sagte er. Der Name: Mahpiya Etahan hi wi – die Frau, die aus dem Himmel kam.

Vor einem Jahr führten der Fotograf Roger Turesson und ich unser erstes Interview mit Greta Thunberg. Wir saßen auf dem kalten, grauen Straßenpflaster am Mynttorget vor dem schwedischen Reichstag. Nur wenige Wochen zuvor hatte sie die erste Rede ihres Lebens über das Klima gehalten. Vor mehreren Hundert Personen im Rålambshovsparken von Stockholm erzählte Greta Thunberg, dass der Schulstreik, mit dem sie drei Wochen vorher angefangen hatte, jeden Freitag fortgesetzt würde, bis die schwedische Klimapolitik dem Pariser Abkommen entspräche.

War sie nervös?

„Situationen, die für andere stressig sind, regen mich nicht auf. Mir fällt es leicht, ruhig zu bleiben“, sagte sie damals.

Greta Thunberg 4.jpg

Als wir uns in der Prärie treffen, ist es zwei Wochen her, dass sie vor den führenden Politikern der Welt im UN-Gebäude in New York gesprochen hat. Jetzt sitzen wir in dem Elektroauto, das ihr der ehemalige Gouverneur Arnold Schwarzenegger geliehen hat.

Wie hast du dich während der Rede vor der UN gefühlt?

Greta Thunberg: Davor war ich nicht nervös. Ich dachte nur daran, dass dies groß sein würde, dass ich mich konzentrieren müsste. Aber das war nicht schwierig. Dann bin ich dort angekommen, und ich habe einige der führenden Politiker der Welt getroffen, die Selfies mit mir machen wollten.

Wer zum Beispiel?

Thunberg: Merkel. Sie hat ein wenig geredet und natürlich gefragt, ob es in Ordnung wäre, wenn sie das Bild in den sozialen Medien verwendet.

Dann ging ich auf die Bühne und hörte den Reden der anderen zu. Als ich anfing zu sprechen, wurde das plötzlich total bewegend. In dem Moment habe ich wohl verstanden, dass dies hier eine wirklich wichtige Rede sein würde.

Wie hast du die Rede vorbereitet?

Thunberg: Ich habe etwa seit Mittsommer über den Inhalt nachgedacht. Eine Botschaft sollte lauten: „How dare you?“ – eine Schuldzuweisung und Beschämung der Machthaber. Danach habe ich das gemacht, was ich immer mache. Ich habe es vor mir hergeschoben. Und einige Tage vorher habe ich angefangen, die Rede zu schreiben.

Bekommst du Hilfe, um in der Rede die richtigen Fakten zu verwenden?

Thunberg: Ja, wenn die Rede einigermaßen fertig ist, schicke ich sie an mehrere Wissenschaftler. Das sind immer unterschiedliche, zum Beispiel ein Experte für ein bestimmtes Gebiet. Und meist bekomme ich innerhalb einiger Stunden eine Antwort. Kommentare wie: Hier solltest du noch das ergänzen, oder so. Wenn es sich um falsche Fakten handelt oder Dinge, die missverständlich sind, ändere ich das.

„Diejenige, die leidet, ist meine Schwester“

Wäre Greta Thunberg Künstlerin, würde man sagen, dass sie ihren internationalen Durchbruch während dieser fünf Minuten in dem Saal hatte, in dem normalerweise die Generalversammlung der UN tagt. Mit vor Wut bebender Stimme richtete sie den Blick auf die eingeflogenen Staats- und Regierungschefs im Saal. „How dare you?“, sagte sie und nannte Fakten des Weltklimarats der UN (IPCC). „Die beliebte Idee, unsere Emissionen in zehn Jahren zu halbieren, gibt uns nur eine 50-prozentige Chance, unter einer Erderwärmung von 1,5 Grad zu bleiben.“

Sie verlas ihre überprüften und bestätigten Zahlen, erzählte den Weltpolitikern, dass diese 50-prozentige Wahrscheinlichkeit auf dem Bericht des Weltklimarats basiere – und dass dieser Faktoren wie Klimagerechtigkeit nicht berücksichtige. Außerdem gehe das Szenario davon aus, dass es Technologien gebe, die große Mengen Kohlendioxid aus der Luft auffangen könnten. Technologien, die es bisher nicht gebe.

„Ein Risiko von 50 Prozent ist für uns einfach nicht akzeptabel. Wir müssen mit den Konsequenzen leben“, sagte sie.

Sie wurde gefeiert. Sie wurde verhöhnt. Und in der darauffolgenden Woche hat sie drei Millionen neue Instagram-Follower gewonnen.

Man muss bedenken, dass Greta Thunberg, bevor sie zu einer der einflussreichsten Personen der Welt wurde, nicht bloß ein ganz normales 15-jähriges Mädchen war. Im Alter von elf Jahren litt sie an einer schweren Depression. Sie sprach nur noch mit ihren engsten Familienangehörigen, konnte nicht mehr zur Schule gehen. Und hörte auf zu essen. Nach zwei Monaten stellte ein Arzt der Kinder- und Jugendpsychiatrie fest, dass Greta aufgrund ihrer Unterernährung demnächst ins Krankenhaus eingewiesen werden müsse. Dies war der Wendepunkt, der Anfang ihres langen Wegs zurück.

Im Sommer äußerte sich Greta Thunberg in einem Interview mit Dagens Nyheter: „Ich war irgendwie total unglücklich. Es war nichts passiert. Wenn es mir gelungen war, rauszugehen zum Supermarkt, habe ich das in meinem Tagebuch festgehalten und war stolz, dass ich das geschafft habe.“ Als sie das Tagebuch später las, habe sie gedacht, „dass ich vor einem oder zwei Jahren von dem Leben, das ich heute habe, nur träumen konnte, ganz unabhängig von dem ganzen Aktivismus und der Bekanntheit“.

Greta Thunberg sitzt auf dem Vordersitz in Arnold Schwarzeneggers Elektroauto, und es scheint ihr gut zu gehen. Die unerfreulichen Folgen ihres Erfolgs sind vor allem zu Hause in Stockholm bemerkbar.

Thunberg: Diejenige, die leidet, ist meine Schwester. Sie ist 13 Jahre alt und muss systematisches Mobbing, Hass und Schikanen ertragen.

Von wem wird sie schikaniert?

Thunberg: Alle, die mir drohen und voller Hass schreiben, richten ihren Hass gegen meine ganze Familie. Der Unterschied ist, dass meine Angehörigen zu Hause sind und ich ständig unterwegs und unerreichbar bin. Die Leute wissen nicht, wo ich wohne, wo ich nachts schlafe, wo ich mich aufhalte. Ich habe keinen Alltag. Aber meine Schwester zu Hause versucht, einen Alltag zu haben. Sie ist also viel leichter zu erreichen.

Was tut ihr gegen die Drohungen?

Thunberg: Wir melden sie der Polizei.

Wie beeinflusst dich das?

Thunberg: Es ist schrecklich. Die Menschen fragen sich, wie sie mir helfen können, aber diejenigen, die wirklich Hilfe benötigen, bekommen sie nicht. Sie werden nur verhöhnt und bekommen Hassbotschaften. Meine Schwester ist dem am stärksten ausgesetzt, aber für sie gibt es keine Hilfe. Stattdessen bekommt sie überall Gegenwind.

Welche Unterstützung wäre nötig?

Thunberg: Freunde, die sie besuchen und fragen, wie es ihr geht, die sich melden. Ich erhalte ständig feine Einladungen von Menschen, die mir helfen wollen. Die beste Art, mir im Moment zu helfen, ist, meine Schwester zu unterstützen. Nicht weil sie meine Schwester ist, sondern weil sie eine wunderbare und starke Person ist. Sie ist meine beste Freundin.

Während ihrer Atlantiküberquerung im Sommer hat Greta Thunberg nach einigen Tagen angefangen, Kinderlieder zu summen, die sie glaubte vergessen zu haben: „Wir haben eine Esche, die ist mindestens 100 Jahre alt. Jedes Jahr wird sie größer, am untersten Zweig hängt meine Schaukel. Dort sitze ich oft und lass die Beine baumeln.“ Majas Buchstabenlied, von A bis Ö. Als sie an Land ging, googelte sie als Erstes den Text der Strophe zum Buchstaben U; die einzige, an die sie sich nicht erinnern konnte.

Hört auf die Wissenschaftler!

Quelle        :          Zeit-online           >>>>>          weiterlesen

——————————————————————–

Grafikquellen         :

Oben      —Berlin (July 2019)

2.) v0n Oben       —    In August 2018, outside the Swedish parliament building, Greta Thunberg started a school strike for the climate. Her sign reads, “Skolstrejk för klimatet,” meaning, “school strike for climate”.

————————-

Unten     —        Greta Thunberg in Berlin, giving a speech in July 2019.

Abgelegt unter Bildung, International, Schicksale, Umwelt | Keine Kommentare »

Urzeitliche Inselbewohner

Erstellt von DL-Redaktion am 4. Oktober 2019

Der Fund stellt die Evolutionsgeschichte auf den Kopf

Blick auf die Tabon-Höhlen

Von Lea Ebeling

Der Fund einer neuen hominiden Spezies auf den Philippinen gilt als einer der wichtigsten archäologischen Funde der letzten Jahre. Er stellt die Evolutionsgeschichte auf den Kopf.

„Als mein Kollege Dr. Piper mich aus dem Labor anrief und mir mitteilte, dass ich menschliche Überreste gefunden hatte, sind wir rausgegangen und haben uns betrunken“, sagt Armand Salvador Mijares, Leiter des internationalen Forschungsprojektes, das für den Fund einer neuen menschlichen Spezies auf den Philippinen verantwortlich ist.

Mijares promovierte in Archäologie und Paläoanthropologie an der Australian National University (ANU) und ist Professor an der University of the Philippines. Bereits 1998 begannen seine Ausgrabungen in der Callao-Höhle in der Region Peñablanca auf Luzon in den Philippinen. Das Team war klein aber international. Mijares wurde unterstützt von Florent Détroit, Paläoanthropologe am Muséum national d’histoire naturelle in Paris, Rainer Grun, Professor der Geochronologie an der Griffith University Queensland und Philip Piper, Archäozoologe und Paläoökologe an der ANU.

Zunächst fanden sie nur tierische Überreste von Rehen, Mäusen, Wildschweinen und Wasserbüffeln, die über 60.000 Jahre alt waren. Doch das menschliche Leben war in ihre Knochen eingeschrieben, denn die Fossilien wiesen klare, v-förmige Schnittstellen auf, die nur durch den Gebrauch menschlicher Werkzeuge entstanden sein konnten. Sie fanden zwar keine Steinwerkzeuge, aber Hornsteinsplitter, die als solche genutzt werden konnten. Also grub das Team weiter.

Inspiration aus Indonesien

Es waren nicht die ersten philippinischen Ausgrabungen. In den 1970er Jahren entdeckte der amerikanische Historiker Robert B. Fox menschliche Überreste mehrerer Individuen in der Tabon-Höhle auf der Insel Palawan. Damals war es unüblich, weiter als zwei Meter tief zu graben, da dies sehr kostspielig und mit erhöhten Sicherheitsrisiken verbunden war.

In den 90er Jahren begann der australische Anthropologe Mike Moorwood Ausgrabungen auf der indonesischen Insel Flores, auf der schon seit den 50er Jahren immer wieder Werkzeuge und tierische Fossilien entdeckt worden waren. 2003 grub er tiefer als gewöhnlich und beförderte in der Höhle Liang Bua eine menschliche Schädelkappe und diverse Knochen zutage.

File:Callao Cave.jpg

Der Fund war eine Sensation. Bisher hatte man geglaubt, dass erst der Homo sapiens die Insel Flores besiedelt haben konnte, da sie nie Teil der asiatischen Kontinentalplatte gewesen war und man seinen Vorgängern eine Seeüberfahrt nicht zugetraut hatte. Der über 60.000 Jahre alte Homo floresiensis widersprach dieser Theorie.

Eine neue Spezies?

Auch Luzon war nie Teil des asiatischen Festlandes und stets von Wasser umgeben. 2007 kehrte Mijares, inspiriert von den indonesischen Funden, in die Callao-Höhle zurück, um tiefer zu graben. Es war in diesem Jahr, als Piper ihn während der Analyse der tierischen Fossilien anrief und ihm mitteilte, dass er den dritten Mittelfußknochen eines menschlichen Lebewesens gefunden hatte.

Ein Rätsel, denn er ließ sich mit keiner bisher bekannten hominiden Spezies vollständig vergleichen. Mijares veröffentlichte den Fund, doch die Wissenschaft wies ihn zurück. Ein einzelner Knochen war noch nicht genug. Mit internationaler Finanzierung setze er seine Ausgrabungen fort und hatte Glück. 2011 fand das Team zwei Handknochen, zwei Fußknochen, mehrere Zähne und Teile des Oberschenkelknochens eines Kindes, 2015 einen weiteren Backenzahn.

Quelle       :          TAZ         >>>>>         weiterlesen

——————————————————————

Grafikquellen     :

Oben        —       Blick auf die Tabon-Höhlen

Alexcooper1 (Diskussion · Beiträge) • CC BY-SA 3.0

—————————

Unten     —            Inside the firth chamber of Callao Cave in Peñablanca, Cagayan. Photo was taken during Schadow1 Expeditions mapping project in Cagayan Valley.

Author Ervin Malicdem

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

Abgelegt unter Asien, Bildung, Kultur, Umwelt | Keine Kommentare »

EU + die Lügengeschichten

Erstellt von DL-Redaktion am 4. Oktober 2019

So schreibt das EU-Parlament die Geschichte Europas um

File:Bundesarchiv Bild 183-J00282, Berlin, Hitler im Sportpalast.jpg

Quelle      :    INFOsperber  CH.

Von   Christian Müller

Auf Antrag von 18 polnischen Mitgliedern hat das EU-Parlament eine Resolution gutgeheissen, die zynischer nicht sein könnte.

Wenn es mit der Umschreibung der Geschichte Europas so weitergeht, steht in zehn Jahren in den Schulbüchern, nicht Hitler und nicht das Deutsche Reich, sondern Stalin und die Sowjetunion hätten den Zweiten Weltkrieg angefangen. An der Neuschreibung der Geschichte beteiligt sich jetzt auch das – demokratisch gewählte – EU-Parlament.

Konkret: Am 19. September 2019 genehmigte das EU-Parlament mit 535 Ja- und 66 Nein-Stimmen bei 52 Enthaltungen (und etlichen Abwesenden) eine Resolution, die jeder historischen Erkenntnis spottet.

Haben die Medien darüber berichtet? Wenig bis gar nicht. Eigentlich erstaunlich. Wenn irgendwo Russland angeschwärzt wird, ist es meist ein willkommenes Thema. Warum ausgerechnet diesmal nicht? (*)

Zu Erinnerung und zur Kenntnis jener, die sich mit dieser Materie nie haben befassen müssen:

Display of Copies of Hitlers Mein Kampf - Documentation Center in Congress Hall - Nuremberg-Nurnberg - Germany.jpg

In Adolf Hitlers Buch «Mein Kampf» – erste Veröffentlichung inkl. 2. Teil 1926 – gibt es das 14. Kapitel über die «notwendige» Politik gegenüber dem Osten: «Ostorientierung oder Ostpolitik» (Ausgabe von 1936 im Eher-Verlag). Dort steht ab Seite 726 auf 32 Seiten für jede Leserin und jeden Leser unmissverständlich, dass Deutschland nicht nur das Recht hat, Russland anzugreifen und ihm Land für die Deutschen wegzunehmen, sondern dass die Deutschen das machen müssen! Die Deutschen brauchen mehr «Grund und Boden», um eine Weltmacht zu werden, und diesen «Grund und Boden» müssen sie sich von Russland holen. Zitat: «Nicht West- und nicht Ostorientierung darf das künftige Ziel unserer Aussenpolitik sein, sondern Ostpolitik im Sinne der Erwerbung der notwendigen Scholle für unser deutsches Volk.» (**)

Das haben bis 1936 nicht nur die über 2 Millionen Besitzer des Buches lesen können (Anm. des Verlags auf Seite VI der Ausgabe von 1936: Bisher verkaufte Auflage 2’250’000 Exemplare), das haben naturgemäss auch einige ausländische Politiker lesen können.

Unter diesen ausländischen und aufmerksamen Lesern war auch Maxim Maximowitsch Litwinow, ein sowjetischer Aussenpolitiker und Diplomat. Aufgrund der in «Mein Kampf» klar angesagten Strategie Hitlers gegen Russland inkl. Krieg versuchte Litwinow vor allem ab 1933 und dann immer intensiver, eine Anti-Hitler-Allianz England/Frankreich/USA mit Russland zu schnüren, allerdings ohne Erfolg. Die Westmächte vertrösteten die Sowjetunion immer wieder oder schickten an die Besprechungen in Moskau untergeordnete Delegierte, die zur Formulierung oder gar Unterzeichnung eines Abkommens gar keine Kompetenz hatten. (Zur politischen Aktivität von Litwinow gibt es eine gute Darstellung des kanadischen Historikers Michael Jabara Carley, hier zum Lesen und/oder downloaden, in Englisch. Einen anderen informativen Artikel zu Litwinow von Michael Jabara Carley – in Deutsch – kann man hier lesen: «Eine kleine Geschichtslektion für Justin Trudeau» .)

Münchner Abkommen und Besetzung der Tschechoslowakei

Am 30. September 1938 kam es zum sogenannten Münchner Abkommen, bei dem Frankreich, England und Italien trotz bestehender gegenseitiger Unterstützungsverträge mit der Tschechoslowakei Hitler erlaubten, Teile der Tschechoslowakei zu besetzen und zu annektieren (Siehe dazu Infosperber «So wäscht Polen die eigene Geschichte weiss»). Die Tschechoslowakei sah angesichts der Übermacht der deutschen Truppen und der vertragswidrig verweigerten Hilfe Frankreichs und Englands keine Chance, sich gegen Hitler-Deutschland wehren zu können, und kapitulierte noch am gleichen Tag. Und Mitte März 1939 besetzte Hitler auch noch den Rest der Tschechoslowakei (von der sich, neben Polen, auch noch Ungarn ein Stück abzweigte). Damit aber war auch für Blinde und Taube klar, dass Hitlers «Mein Kampf» nicht nur ein grossmäuliges Propagandabuch war, sondern dass es jetzt an die Realisierung der dort angekündigten Strategien ging.

File:Bundesarchiv Bild 183-E12359, München, Adolf Hitler vor Feldherrenhalle Recolored.jpg

In dieser Situation und vom Westen nach wie vor im Stich gelassen unterzeichnete der sowjetische Aussenminister Wjatscheslaw Molotow mit dem deutschen Reichsaussenminister Joachim von Ribbentrop am 23. August 1939 einen Nichtangriffspakt mit Hitler-Deutschland, bekannt unter dem Namen «Deutsch-Sowjetischer Nichtangriffspakt» und auch als «Ribbentrop-Molotow-Pakt». Der Pakt garantierte dem Deutschen Reich die sowjetische Neutralität bei einer kriegerischen Auseinandersetzung mit Polen und den Westmächten. Russland war für einen Krieg mit Deutschland alles andere als vorbereitet und musste deshalb Zeit gewinnen, um sich auf einen – schon in «Mein Kampf» angedrohten und angekündigten – Angriff Hitlers auf Russland vorzubereiten. (Ein geheimes Zusatzprotokoll «für den Fall einer territorial-politischen Umgestaltung» gestattete der Sowjetunion, im Ersten Weltkrieg verlorene Territorien des Russischen Kaiserreichs an Polen wiederzugewinnen.)

Und warum sollte die Sowjetunion mit Hitler keinen Nichtangriffspakt schliessen? Auch Polen hatte ja mit Hitler, schon im Jahr 1934, einen Nichtangriffspakt geschlossen.

Und damit zurück zum EU-Parlament

Das EU-Parlament geht im Jahr 2019, 80 Jahre nach dem offiziellen Ausbruch des Zweiten Weltkrieges, über all diese Ereignisse hinweg. Für über 500 der 751 Mitglieder des Parlamentes ist der Verursacher des Zweiten Weltkrieges der Nichtangriffspakt Ribbentrop-Molotow, womit die Hälfte der Kriegsschuld bereits von Deutschland abgewendet und auf Russland verschoben wird. In einer Resolution vom 19. September 2019 – Beschlussergebnis siehe oben – wird unter anderem festgehalten,

  • «dass vor 80 Jahren, am 23. August 1939, die kommunistische Sowjetunion und das nationalsozialistische Deutsche Reich den als Hitler-Stalin-Pakt bekannten Nichtangriffspakt und dessen Geheimprotokolle unterzeichneten, womit die beiden totalitären Regime Europa und die Hoheitsgebiete unabhängiger Staaten untereinander aufteilten und in Interessensphären einteilten und damit die Weichen für den Zweiten Weltkrieg stellten» (Auszeichnung cm).
  • «dass es von entscheidender Bedeutung für die Einheit Europas und seiner Bevölkerung und für die Stärkung der Widerstandskraft Europas gegen die aktuellen Bedrohungen von aussen ist, dass der Opfer totalitärer und autoritärer Regime gedacht wird und dass das gemeinsame europäische Erbe der von kommunistischen, nationalsozialistischen und anderen Diktaturen begangenen Verbrechen anerkannt und das Bewusstsein für dieses Erbe geschärft wird.» (Auszeichnung cm, man beachte die Reihenfolge der Diktaturen.)
  • «dass die russischen Stellen ungeachtet dessen, dass der Kongress der Volksdeputierten der UdSSR am 24. Dezember 1989 die Unterzeichnung des Hitler-Stalin-Pakts und anderer mit dem nationalsozialistischen Deutschland geschlossener Abkommen verurteilte, im August 2019 die Verantwortung für dieses Abkommen und seine Folgen bestritten haben und derzeit die Auffassung vertreten, dass Polen, die baltischen Staaten und der Westen die wahren Initiatoren des Zweiten Weltkriegs sind.»
  • «dass der Zweite Weltkrieg, der verheerendste Krieg in der Geschichte Europas, als unmittelbare Folge des auch als «Hitler-Stalin-Pakt» bezeichneten berüchtigten Nichtangriffsvertrags zwischen dem nationalsozialistischen Deutschen Reich und der Sowjetunion vom 23. August 1939 und seiner geheimen Zusatzprotokolle ausbrach, in deren Rahmen die beiden gleichermassen das Ziel der Welteroberung verfolgenden totalitären Regime Europa in zwei Einflussbereiche aufteilten.» (Auszeichnung cm, man beachte: Der Zweite Weltkrieg als unmittelbare Folge Ribbentrop-Molotow-Pakts!)

    Und die vom EU-Parlament beschlossene Resolution

  • «fordert alle Mitgliedstaaten der EU auf, eine eindeutige und auf Grundsätzen beruhende Beurteilung der Verbrechen und Akte von Aggression vorzunehmen, die von den totalitären kommunistischen Regimen und dem nationalsozialistischen Regime begangen wurden.» (Auszeichnung cm, man beachte die Reihenfolge)
  • «fordert alle Mitgliedstaaten auf, den 23. August (Datum des Ribbentrop-Molotow-Pakts, cm) sowohl unionsweit als auch auf nationaler Ebene als den Europäischen Tag des Gedenkens an die Opfer totalitärer Regime zu begehen und das Bewusstsein der jüngeren Generation für diese Problematik zu schärfen, indem die Geschichte der totalitären Regime und die Untersuchung ihrer Folgen in die Lehrpläne und die Schulbücher aller Schulen in der EU aufgenommen werden.» (Auszeichnung cm, man beachte die Logik: das Datum eines Nichtangriffspakts als Gedenktag für Kriegsopfer.)
  • «fordert ausserdem, dass der 25. Mai (der Jahrestag der Hinrichtung des Helden von Auschwitz, Rittmeister Witold Pilecki) zum Internationalen Tag der Helden des Kampfes gegen den Totalitarismus ausgerufen wird, um damit all jenen Respekt und Achtung zu zollen, die durch den Kampf gegen die Tyrannei Heldenmut und wahre Menschenliebe bewiesen haben, und auch künftigen Generationen ein klares Vorbild für die richtige Einstellung gegenüber der Bedrohung durch totalitäre Versklavung zu bieten.» (Rittmeister Witold Pilecki hat tatsächlich dazu beigetragen, dass die Welt mehr über die Konzentrationslager der Nazis erfahren hat. Als Symbolfigur, um Polen vom Vorwurf des eigenen Antisemitismus und der Kollaboration mit den Nazis zu befreien, taugt Pilecki allerdings nicht. cm)

    Und das EU-Parlament

  • «betont, dass die Länder Mittel- und Osteuropas durch ihren Beitritt zur EU und zur NATO nicht nur in die europäische Familie freier demokratischer Länder zurückgekehrt sind, sondern auch Erfolge bei der – von der EU unterstützten – Durchführung von Reformen und im Bereich der sozioökonomischen Entwicklung vorweisen können.» (Auszeichnung cm, man beachte die Gleichstellung von EU und NATO)
  • «ist der Ansicht, dass Russland noch immer das grösste Opfer des kommunistischen Totalitarismus ist und dass es so lange kein demokratischer Staat wird, wie die Regierung, die politische Elite und die politische Propaganda nicht nachlassen, die kommunistischen Verbrechen zu verharmlosen und das totalitäre Sowjetregime zu verherrlichen; fordert deshalb die russische Gesellschaft auf, ihre tragische Vergangenheit aufzuarbeiten.» (Haben die EU-Mitglieder Ungarn, Rumänien und andere ihre «tragische Vergangenheit» als Verbündete Hitlers schon ausreichend aufgearbeitet? cm)
  • «ist zutiefst besorgt angesichts der Bemühungen der derzeitigen russischen Führung, historische Tatsachen zu verfälschen und die vom totalitären Regime der Sowjetunion begangenen Verbrechen schönzufärben, betrachtet diese Bemühungen als eine gefährliche Komponente des Informationskriegs gegen das demokratische Europa, der auf die Spaltung des Kontinents abzielt, und fordert die (EU-)Kommission daher auf, diesen Bemühungen entschlossen entgegenzuwirken.» (Auszeichnung cm; und was ist mit der aktuellen Neuschreibung der Geschichte durch die Ukraine, durch Polen und andere EU-Mitglieder? Diese Forderung an Russland könnte zynischer nicht sein.)
  • «weist darauf hin, dass es im öffentlichen Raum einiger Mitgliedstaaten (z. B. in Parks, auf Plätzen oder in Strassen) noch immer Denkmäler und Gedenkstätten gibt, die totalitäre Regime verherrlichen, was der Verfälschung historischer Tatsachen über die Ursachen, den Verlauf und die Folgen des Zweiten Weltkriegs Tür und Tor öffnet. (Soll also Paris die Metro-Station Stalingrad umbenennen und sich nicht mehr daran erinnern dürfen, dass Hitler militärisch in Stalingrad besiegt worden ist und anschliessend zum verlustreichen Rückzug gezwungen war? cm)

    Eine skandalöse Geschichtsverfälschung

    Die ganze Resolution des EU-Parlaments vom 19. September 2019 kann hier – in über zwanzig Sprachen, siehe oben rechts – gelesen und/oder downgeloaded werden. Zu beachten gilt es zusätzlich, wer diese Resolution im EU-Parlament eingebracht hat. Es sind 19 Mitglieder des Parlaments: 18 davon aus Polen und eines aus Lettland. (***) Haben die anderen über 700 Mitglieder des EU-Parlaments den Text der Resolution überhaupt gelesen, bevor sie ihm zustimmten?

    Die Absicht der polnischen Antragsteller ist mehr als durchsichtig: In Polen war der Antisemitismus schon vor dem Angriff Hitlers auf dieses Land und auch während des Zweiten Weltkrieges weit verbreitet. Man denke etwa an den Fall jener jüdischen Insassen von Auschwitz, die dem Konzentrationslager entfliehen konnten, von polnischen Bürgern aber verraten wurden und so ins Konzentrationslager zurückgebracht werden konnten. Das alles soll «vergessen» werden. Und heute ist vor allem eines wichtig: Europa soll Russland hassen und als Bedrohung wahrnehmen! Um dies zu erreichen, ist jede Geschichtsverfälschung erlaubt.

    Traurig nur, dass das EU-Parlament auf solche Vorstösse hereinfällt. Noch hat man offensichtlich nicht begriffen, dass gerade solche Aktionen das Vertrauen vieler Stimmbürgerinnen und Stimmbürger in die EU massiv untergraben helfen.

    – – – – – – – – – – – – – – – – – – – – – – –

    Siehe zum gleichen Thema

    Ausserdem auf Infosperber:

    – – – – – – – – – – – – – – – – – – – – – – –

    (*) Gestern Freitag, 26. September 2019, ist wenigstens die Online-Plattform NachDenkSeiten auf die Problematik dieser Resolution eingestiegen, siehe hier.

    (**) Die Seitenzahlen und Zitate sind direkt aus einem originalen Exemplar von Hitlers Buch «Mein Kampf» mit Erscheinungsjahr 1936 übernommen, das der Autor des Artikels aufgrund der käuflichen Übernahme der Bibliothek von Raymond Broger, verstorbener Landammann von Appenzell-Innerrhoden, selber besitzt.

    (***) Ryszard Antoni Legutko (Polen), Anna Fotyga (Polen), Tomasz Piotr Poręba Polen), Dace Melbārde (Lettland), Witold Jan Waszczykowski (Polen), Ryszard Czarnecki (Polen), Jadwiga Wiśniewska (Polen), Bogdan Rzońca, (Polen), Anna Zalewska (Polen), Jacek Saryusz-Wolski (Polen), Grzegorz Tobiszowski (Polen), Joanna Kopcińska (Polen), Elżbieta Rafalska (Polen), Joachim Stanisław Brudziński (Polen), Beata Szydło (Polen), Beata Mazurek (Polen), Andżelika Anna Możdżanowska (Polen), Beata Kempa (Polen), Patryk Jaki (Polen)

    Themenbezogene Interessen (-bindung) der Autorin/des Autors

    Zum Autor. Es gibt keine Interessenkollisionen.

    Weiterführende Informationen

    Michael Jabara Carley: Who betrayed whom?

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

———————————————————————-

Grafikquellen     :

Oben      —         Berlin, Hitler im Sportpalast

Der Führer sprach zum ganzen deutschen Volk Am Abend des historischen 30. Januar hielt der Führer im Berliner Sportpalast vor Tausenden Volksgenossen und zahlreichen Soldaten eine grosse Rede an das ganze deutsche Volk. Sie wurde zu einer schneidenden Abrechnung mit den plutokratischen Kriegstreibern und zu einem begeisterten Bekenntnis zur Grösse und Macht des nationalsozialistischen Deutschlands. – Unser Bild zeigt den Führer nach dem Betreten des Rednerpultes, wo ihm orkanartiger Jubel entgegenbrauste, der ihm zunächst minutenlang das Sprechen unmöglich machte. Scherl Bilderdienst, Berlin 30.1.42

[Adolf Hitler]

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-J00282 / CC-BY-SA 3.0

————————–

2.) von Oben     —-       Display of Copies of Hitlers Mein Kampf – Documentation Center in Congress Hall – Nuremberg-Nurnberg – Germany

Unten         —         München, Adolf Hitler vor Feldherrenhalle

Der feierliche Staatsakt vor der Feldherrnhalle in München (11.11.1939) für die sieben Opfer des verbrecherischen Sprengstoffanschlags im Bürgerbräukeller (am 8.11.1939). Der Führer erweist den Toten die letzte Ehre. Foto Wag. 11.11.1939

Abgebildete Personen:

  • Hitler, Adolf: Reichskanzler, Deutschland

This is a retouched picture, which means that it has been digitally altered from its original version. Modifications: recolored. The original can be viewed here: Bundesarchiv Bild 183-E12359, München, Adolf Hitler vor Feldherrenhalle.jpg. Modifications made by Ruffneck88.

Source Own work
Author Ruffneck88

Deutsches Bundesarchiv (German Federal Archive), Bild 183-E12359    Commons:Bundesarchiv

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

Abgelegt unter Bildung, Bücher, Deutschland, Europa | Keine Kommentare »

„Neustart“ – Brandenburg

Erstellt von DL-Redaktion am 4. Oktober 2019

Aufnahmestopp und harte Auflagen

Von Kaija Kutter

Brandenburg erteilt der Einrichtung „Neustart“ zum zweiten Mal harte Auflagen. Aktuelle Bewohner bestätigen einige der Vorwürfe gegen das Personal.

 Das brandenburgische Jugendministerium hat für das Kinderheim „Neustart“ bei Jänschwalde einen Aufnahmestopp verfügt und zum zweiten Mal in Folge Auflagen erteilt. Es handle sich um Maßnahmen zur „Sicherung des Kindeswohls“, die keine Vorverurteilung bedeuteten. Die taz hatte am 21. September über Vorwürfe berichtet, die fünf ehemalige Bewohner erhoben. Unter anderem waren sie eingangs in ihren Zimmern isoliert, hatten Milchglasfolie an den Fenstern und tagsüber keine Matratze auf dem Bett. Sie berichteten von strengen Frage-Ritualen, abgeschlossen Türen und einzelnen Übergriffen.

Das Heim des Arbeiter-Samariter-Bunds Lübben liegt im Wald bei Jänschwalde und hat rund 30 Plätze für Kinder- und Jugendliche im Alter von zwölf bis achtzehn Jahren. Aufnahmestopp heißt, dass dort bis zur Klärung der Vorwürfe keine Kinder aufgenommen werden. Auch wird einem Mitarbeiter vorerst der Umgang mit den Kindern untersagt.

Zudem darf das „Chip-System“, mit dem Jugendliche sich bei Wohlverhalten persönliche Freiheiten wie länger telefonieren oder sich schminken dürfen erkaufen mussten, nicht mehr angewendet werden. Derartige Methoden wurden jüngst vom Deutschen Ethikrat kritisiert. Mit sofortiger Wirkung auszusetzen sei auch das „Anklopf-Verfahren für den Gang der untergebrachten Kinder und Jugendlichen zur Toilette“, schreibt das von der SPD-Politikerin Britta Ernst geleitete Ministerium für Bildung, Jugend und Sport (MBJS) in Potsdam. Dort liegt seit Montag ein Brief vor, in dem ein Jugendlicher dieses entwürdigende Verfahren detailliert beschreibt. Er musste für einen Toilettengang sechs oder sieben Fragen stellen.

JänschwaldePfarrhaus.jpg

Bereits vor einer Woche hatte das MBJS als Reaktion auf den taz-Artikel mehrere Auflagen erteilt und deren Umsetzung am 25. September mit einem unangekündigten Besuch kontrolliert. So wurde die an den Fenstern angebrachte Milchglasfolie durch Gardinen ersetzt. Ferner schrieb das Ministerium „Die feste Verankerung der Stühle am Boden wurde entfernt“ und die Schränke in den Aufnahmezimmern seien für die dort untergebrachten Kinder und Jugendlichen „inzwischen frei zugänglich und nicht mehr verschlossen.“ Auch seien die Türen nach draußen beim Besuch offen gewesen.

Vorwürfe teilweise bestätigt

Quelle       :          TAZ           >>>>>          weiterlesen

 Berichte vom 22.09 19 :

Hinter Milchglasim-Neustart

vom 22. September 2019

Die Haasenburg war gestern –
Hinter Milchglas ist heute

Weitere Berichte zum Thema Haasenburg

Neues aus der Haasenburg

Haasenburg gegen die TAZ

Nico, dem Kapital zum Fraß?

Die Firma am Waldrand

Die Heime der Haasenburg

Heime der Haasenburg 3

Aus für Haasenburg gefordert

Das Ende der Haasenburg  auf DL 

————————————————————————-

Grafikquellen       :

Oben         —         KAP-Luftaufnahme auf Höhe Friedhof mit Blickrichtung nach Nordost auf den Ortskern von Horno (Forst (Lausitz)) im November 2013

Abgelegt unter Bildung, Brandenburg, Mensch, Positionen | Keine Kommentare »

Die Würde des Menschen

Erstellt von DL-Redaktion am 20. September 2019

«Schwarze Schafe» – mehr als nur «hie und da»

Les jeunes dirigeants remettent en cause les traditions en Mauritanie (5198526542).jpg

Quelle        :       INFOsperber ch.

Von Markus Mugglin 

Appelle an Unternehmen, Menschenrechte zu beachten, zeigen wenig Wirkung. Eine Studie im Auftrag des Bundes liefert den Beleg.

«Es mag hie und da schwarze Schafe geben», versuchte der freisinnige Giovanni Merlini in der Debatte des Nationalrates über die Konzernverantwortungsinitiative in der Sommersession schädliches Verhalten von Unternehmen zu relativieren. CVP-Vertreter Thomas Ammann zweifelte hingegen nicht daran, dass schwarze Schafe existieren. SP-Nationalrat Cédric Wermuth schätzte den Anteil der Schweizer Unternehmen, die sich im Ausland nicht tadellos verhalten, auf 20 Prozent und damit auf eine beträchtliche Zahl.

Dass die Einschätzungen parteipolitisch gefärbt sind, überrascht nicht. Ebenso wenig, dass Mitte-Links staatliche Regeln für die Einhaltung der Menschenrechte fordert, Mitte-Rechts sich hingegen mit wohlfeilen Appellen begnügt. Erstaunlich ist es dennoch, dass der Glaube an die Überzeugungskraft freiwilliger Massnahmen noch immer verbreitet wird. Denn spätestens seit Ende letzten Jahres lässt sich deren Wirksamkeit auch für die Schweiz faktenbasiert in Zweifel ziehen.

Damals wurde die «Bestandesaufnahme über die Umsetzung der UNO-Leitprinzipien für Wirtschaft und Menschenrechte durch den Bund und durch Schweizer Unternehmen» publiziert. Verfasst hatte sie im Auftrag des Bundes das Beratungsunternehmen «twentyfifty».

Die Studie nahmen fast nur die im Streit um die Konzernverantwortungsinitiative direkt involvierten Parteien zur Kenntnis. Und sie legten sie extrem verschieden aus. «SwissHoldings», der Verband der multinationalen Konzerne, reagierte höchst erfreut, weil angeblich «rund 80 Prozent der Schweizer Grossunternehmen über eine konsistente Menschenrechtspolitik gemäss den neuen UNO-Vorgaben» verfügten. Die Kampagne für die Konzernverantwortung reagierte darauf empört mit dem Vorwurf «fake news» und verwies ihrerseits auf das «niederschmetternde Fazit» der Studie. Denn weniger als die Hälfte selbst der grossen Unternehmen würden die menschenrechtlichen Auswirkungen ihrer Aktivitäten laufend ermitteln.

Lange Liste von «Gaps»

Die «Bestandesaufnahme» deckt tatsächlich beträchtliche Differenzen zwischen Anspruch und Wirklichkeit auf. Die Mängelliste erstreckt sich von geringen Kenntnissen über die UN-Leitlinien für Wirtschaft und Menschenrechte über ungenügende Verankerung und Umsetzung der Prinzipien in den Geschäftsrichtlinien bis zu Mängeln bei Beschwerdemechanismen.

Die meisten der befragten Unternehmen verweisen zwar in ihren Leitbildern auf Menschenrechte, doch nur jedes fünfte nimmt Bezug zu den von der Staatengemeinschaft und auch der Schweiz gutgeheissenen UNO-Prinzipien. Nur wenige Unternehmen schätzen ihre menschenrechtlichen Risiken und Auswirkungen ein und sehen spezifische Massnahmen zum Schutz der Menschenrechte vor. Nur eine Minderheit überprüft die effektive Umsetzung von Massnahmen und hat die von der UNO geforderten Beschwerdemöglichkeiten geschaffen.

Die Ergebnisse differieren merklich nach Unternehmensgrösse. Die Unternehmen mit mehr als 5000 Beschäftigten schneiden besser ab. Die «twentyfifty»-Autoren führen es darauf zurück, dass sie stärker dem Druck von Organisationen der Zivilgesellschaft ausgesetzt sind. Die NGO-Kampagnen gegen viele führende Schweizer Konzerne zeigen also Wirkung, die immer wieder mal vom Bundesrat geäusserten Empfehlungen hingegen weniger.

Auch Politik in der Kritik

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

———————————————————————-

Grafikquelle       :        [Magharebia/Mohamed Wedoud] „Young people may veer to extremism because of marginalisation by the older generation,“ said UJD party chief Jiddou Ould Ahmed. جدو ولد أحمد، رئيس حزب „اتحاد الشباب الديمقراطي“ يقول „الشباب قد ينحرف إلى التطرف بسبب التهميش الممارس عليه من طرف الكبار“ „Les jeunes risquent de se tourner vers l’extrémisme par suite de leur marginalisation par les générations plus âgées“, a expliqué le président de l’UJD, Jiddou Ould Ahmed. Full story: www.magharebia.com/cocoon/awi/xhtml1/en_GB/features/awi/f… www.magharebia.com/cocoon/awi/xhtml1/ar/features/awi/feat… www.magharebia.com/cocoon/awi/xhtml1/fr/features/awi/feat…

Abgelegt unter Bildung, Europa, Kultur, Regierungs - Werte | Keine Kommentare »

Dann kamen die Knüppel

Erstellt von DL-Redaktion am 20. September 2019

Singen, bis die Knüppel kommen

Nostorf Kirche 2008-05-23.jpg

Die Söldner der Mächtigen kommen nie ohne Auftrag!
Es fehlt ihnen aber auch an Intelligenz Flüchtlinge in einen Ort mit 490 Einwohner zu senden. So dumm sind Menschen niht – nur Politiker Innen welche ein Land regieren.

Von Marina Achenbach

Mecklenburg Das Ensemble „Lebenslaute“ spielt für die Geflüchteten in der Unterkunft Nostorf-Horst. Dann aber rückt die Polizei an.

Das machen sie seit 33 Jahren. Mit ihrer Musik überschreiten Orchestermusiker und Chorsänger, Profis und Laien, singend und spielend eine politisch gesetzte Grenze, eine der vielen, die meist erst erkennbar werden und wehtun, wenn man gegen sie stößt. Sie praktizieren zivilen Ungehorsam, sie üben ihn, erproben sich selbst. Dafür kommen sie aus dem ganzen Land zusammen. Ihre jährliche Aktion bereiten sie präzise vor. Diesen Sommer ist es die „Erstaufnahmeeinrichtung Nostorf-Horst“, ein Flüchtlingscamp in Mecklenburg-Vorpommern (MV), das im Begriff ist, ein „Ankerzentrum“ nach Seehofer’scher Art zu werden. Die „Lebenslaute“ hatten angeboten, in diesem Camp ein Freiluftkonzert aufzuführen. Das wurde abgewiesen, mit einer Begründung (des Landesamts für innere Verwaltung), die für die Musiker eine Provokation ist: der Ort diene „Betreuung, Schutz und Unterkunft während des Asylverfahrens“, und das bedeute „nicht zuletzt auch die Unverletzlichkeit des Wohnbereichs als Rückzugsraum“.

Dieser „Rückzugsraum“ sind einige Wohnblocks im Wald, im Abseits, im ehemaligen Grenzgebiet zu Schleswig-Holstein. Isoliert, freudlos, einsam, hoch umzäunt, Tor mit Wache, wo sich jeder an- und abzumelden hat beim Passieren, Zimmer mit Doppelbetten, keine eigenen Küchen, sondern angeliefertes Essen, viel Nudeln, Pudding in Plastikbechern. Die zugewandte Beratung durch den Flüchtlingsrat e. V. ist nicht im Innern zugelassen. Wer sich traut, Rat zu holen, muss durchs Tor zu einem Container herauskommen. Schule nur für den Teil der Kinder, die zum Hamburger Kontingent gehören, das es bis zum Herbst noch in diesem Lager gibt. Die übrigen bleiben ohne Schule, das verstößt gegen die UN-Kinderrechtskonvention. Die medizinische Versorgung ist ganz mangelhaft, eine psychologische Behandlung fehlt. Dem Malteserorden ist die Betreuung des Camps übertragen, zusätzlich ist eine Security-Firma beauftragt.

Die Angst in der Nacht

Vor allem wohnt in diesem Lager die Angst: Abzuschiebende werden oft in den Nachtstunden herausgeholt, alle Zimmer im Camp werden jeweils durchsucht. Mehrfach wurde Feueralarm ausgelöst, der alle aus den Betten holte. Und Willkür, ein Iraner erzählte deprimiert, sein einziger Landsmann, mit dem er sich hier angefreundet hat, wurde plötzlich woandershin verlegt. Meist leben hier rund 300 Insassen, aus vielen Ländern mit vielen Sprachen, sie bleiben bis zu zwei Jahre hier. Sie sind zur „Weltlosigkeit“ verurteilt, mit Hannah Arendt gesprochen.

Ein Konzert in Schwerin eröffnete die Aktion, vor der Staatskanzlei, dem Amtssitz der Ministerpräsidentin. Ich las in den Gesichtern, sah mit Respekt die große Spanne zwischen den Generationen, die Konzentration auf die Dirigentin. Sie spielten klassische Musik, sangen auch Folk und Soul, verteilten Informationen. Aber hinter ihnen im Amtsgebäude öffnete sich die ganze Stunde über kein Fenster, kein einziges Gesicht tauchte auf. So viel Unterwürfigkeit? Die Polizei wachte über die Zentimeter auf dem Pflaster vor den Stufen der Staatskanzlei, die nicht übertanzt werden durften. Denn zum Schluss wurde noch getanzt, zu Dvořáks Musik.

Nostorf Hallenhaus.JPG

Fünf Tage haben sie sich dann auf die Aktion in ihrem Quartier, einer Waldschule in Alt-Jabel, vorbereitet. Es wurden die Musikstücke eingeübt, auch mögliche Konfrontationen durchgespielt. Man sprach über eigene Grenzen und Ängste. Konsens ist Voraussetzung jeder Aktion, das System der Konsensfindung ist inzwischen eine eigene Kultur, eine Übereinkunft, die alle akzeptieren, stimmig, demokratisch und wirkungsvoll. Ihre Losung: Das Flüchtlingscamp Horst auflösen. Menschenwürde für Geflüchtete. Sie unterstützen damit Initiativen, die sich dort seit Jahren engagieren, wollen Druck und Aufmerksamkeit erhöhen. Ihre Aktionen sind angekündigte, bewusste, gewaltfreie Gesetzesübertretungen: Blockaden, Besetzungen, Entzäunungen, das Betreten verbotener Räume wie Abschiebeflughäfen, Militärübungsplätze, Raketendepots, auch die Blockade von sieben Eingangstüren der Verfassungsschutzzentrale in Köln über vier Stunden im vorigen Jahr.

Quelle      :    Der Freitag          >>>>>         weiterlesen

———————————————————————-

Grafikquellen       :

Oben     —        Kirche in Nostorf, Landkreis Ludwigslust, Mecklenburg-Vorpommern

——————————————

Unten      —       Hallenhaus in Nostorf, Landkreis Ludwigslust-Parchim, Deutschland

Abgelegt unter Bildung, Deutschland, Meck - Pommern, Mensch | Keine Kommentare »

Körperverletzung im Amt

Erstellt von DL-Redaktion am 18. September 2019

Mit anonymer Faust

File:Police brutality at Nigerian Embassy protest.jpg

Von Anett Selle

Verfahren zu Polizeigewalt werden fast immer eingestellt, heißt es in einer neuen Studie. Meist, weil die Beamt*innen nicht identifizierbar waren.

Für die Polizei ist Gewaltanwendung unter bestimmten Bedingungen straffrei. Dazu gehört Verhältnismäßigkeit: Beamt*innen sind verpflichtet, das geringste zielführende Mittel zu wählen. Wer darüber hinaus Gewalt anwendet, macht sich strafbar. Doch diese Straftat wird in Deutschland kaum verfolgt. Auch das Ausmaß von Polizeigewalt ist unbekannt.

Eine neue Studie kommt nun zum Schluss, dass das Dunkelfeld “mindestens fünfmal so groß ist wie das Hellfeld“. Grundlage des Zwischenberichts sind 3.375 Berichte von Betroffenen aus allen Gemeindegrößen: vom Dorf bis zur Großstadt mit über 500.000 Einwohner*innen.

Es ist die bislang größte Untersuchung zu Polizeigewalt im deutschsprachigen Raum: Seit 2018 untersucht das Forschungsprojekt „Körperverletzung im Amt durch Polizeibeamte“ unter Leitung von Kriminologie-Professor Tobias Singelnstein an der Ruhr-Universität Bochum (RUB) körperliche Gewalt durch Polizist*innen, die Betroffene als unverhältnismäßig bewerten.

Bereits bekannt war, dass jährlich über 2.000 Anzeigen gegen Polizist*innen eingehen. Während Staatsanwaltschaften durchschnittlich in etwa 20 Prozent aller Ermittlungen Anklage erheben, sieht es hier anders aus: Weniger als 2 Prozent der Anzeigen führen zu einer Anklage. Weniger als 1 Prozent endet mit einer Verurteilung.

Grundlos schnell eskaliert

Die RUB-Studie untersucht nun, in welchen Situationen es zu wahrgenommener Polizeigewalt kommt und welche Folgen sie für Betroffene hat. Ferner geht es darum, wieso Anzeigen meist ausbleiben und Staatsanwaltschaften fast alle Verfahren einstellen. Die Befragten beteiligten sich online: Sie sind überwiegend männlich, zur Zeit des Vorfalls durchschnittlich 26 Jahre alt und hochgebildet (Fach- oder Hochschulreife). 16 Prozent haben einen Migrationshintergrund.

Da die Auswahl der Befragten nicht zufällig erfolgte, ist die Stichprobe nicht repräsentativ. Trotzdem ließen sich Schlussfolgerungen für die Gesamtsituation ziehen, schreiben die Autor*innen. “Die Befragten schilderten sehr vielfältige Situationen […] Vor diesem Hintergrund kann davon ausgegangen werden, dass rechtswidrige polizeiliche Gewaltausübungen prinzipiell in allen Einsatzsituationen vorkommen können.“

Quelle         :       TAZ          >>>>         weiterlesen

Ausbilder über rechtsextreme Beamte

„Behörden blocken das Thema ab“

Datei:-Ohlauer Räumung - Protest 27.06.14 -- Wiener - Ohlauer Straße (14549442343).jpg

Das Interview mit Christoph Kopke führte Konrad Litschko

Polizeiausbilder Christoph Kopke plädiert für mehr Aufklärungsarbeit wegen rechter Haltungen. Gerade aus einem Land im Norden erwartet er mehr.

taz: Herr Kopke, seit Jahren unterrichten Sie in Berlin Polizeikommissare. Wie oft sind Ihnen dabei Rechtsextreme über den Weg gelaufen?

Christoph Kopke: Ehrlich gesagt noch nie. Noch nicht mal fragwürdige Äußerungen sind mir in Erinnerung. Vielleicht liegt das aber daran, dass die Klientel in Berlin weltoffener ist.

Anderswo sind die Erfahrungen anders. Derzeit wird viel über Rechtsextreme in Sicherheitsbehörden diskutiert, am Mittwoch erscheint das Buch „Extreme Sicherheit“ dazu. Wie groß ist das Problem?

Seriös kann man darüber keine Angaben machen, denn es gibt bis heute keinerlei Studien dazu. Auch die Sicherheitsbehörden geben dazu nur vorsichtig Informationen heraus – man könnte auch sagen, sie blocken das Thema ab. Aber was man sicher sagen kann: Wenn sich rechte Positionen in der Gesellschaft offensiver artikulieren, dann tun sie das in der Polizei auch.

Die Polizei ist also nur ein Spiegel der Gesellschaft?

Solche gesellschaftlichen Stim­mungen gehen ja nicht an Polizisten vorbei. Aber an die Polizei stellen sich andere Anforderungen: Sie kann sich nicht mit Polarisierungen in ihren Reihen abfinden. Hier darf es keinerlei Zweifel geben, dass die Beamten voll und ganz hinter dem Recht und Gesetz stehen.

Zuletzt fielen hessische PolizistInnen mit rechtsextremen WhatsApp-Gruppen auf oder Polizisten aus Mecklenburg-Vorpommern, die Munition für einen „Tag X“ geklaut haben sollen, oder zwei sächsische SEK-Beamte, die sich in Dienstlisten als NSU-Mörder Uwe Böhnhardt eintrugen. Was ist da los?

Quelle :          TAZ          >>>>>         weiterlesen

—————————————————————–

Grafikquellen       :

Oben      —         Police brutalize protester at rally against „embassy hearings“ in front of Nigerian Embassy, Berlin

Source http://asylstrikeberlin.files.wordpress.com/2012/10/polizeigewalt.jpg
Author Berlin Refugee Strike

Licensing[edit]

w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

——————————-

Unten       —        Seit dem 24. Juli 2014 haben ca. 900 PolizistInnen aus dem gesamten Bundesgebiet den Kiez um die ehemalige Gerhart Hauptmann Schule an der Ohlauer Straße in Berlin Kreuzberg zum Sperrgebiet gemacht. Erklärtes Ziel war es, den rund 250 Flüchtlingen, die gegen die bestehenden Zustände protestierten, beim „freiwilligen Umzug zu helfen“. Ca. 50 Flüchtlinge weigern sich bisher ihren Protest zu beenden, die ehemalige Schule zu räumen und sitzen zu ihrer Sicherheit seit dem 24.06.14 auf dem Dach des Gebäudes.

Quelle #Ohlauer Räumung / Protest 27.06.14 // Wiener / Ohlauer Straße
Urheber Markus Winkler

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 2.0 generisch“ (US-amerikanisch) lizenziert.

Checked copyright icon.svg Diese Bilddatei wurde ursprünglich auf Flickr durch mw238 in https://www.flickr.com/photos/11415654@N05/14549442343 hochgeladen. Sie wurde am durch den FlickreviewR-Bot geprüft und die Lizenzierung der Datei unter den Bedingungen von cc-by-sa-2.0 wurde bestätigt.

Abgelegt unter Bildung, Debatte, Kriegspolitik, Regierung | Keine Kommentare »

Nie Täter, immer Opfer:

Erstellt von DL-Redaktion am 18. September 2019

Die Polizei muss endlich lernen, mit Kritik umzugehen

File:Zurich police riot control.jpg

Fühlt sich das Volk angegriffen,muss ihm das Gefühl gegeben sich der Gerechtigkeit entsprechend,  zu Wehr setzen zu können. Die Situation in der von Oben alles beherrscht wurde, ist noch in Vieler Gedächtnis.

Quelle       :         NETZPOLITIK ORG.

Von

Eine selbstbewusste, selbstkritische und demokratische Polizei würde die Kritik der Studie zu rechtswidriger Polizeigewalt annehmen und beweisen, dass sie es besser kann. Statt die Chance von Transparenz und Kontrolle für mehr Vertrauen zu nutzen, werden dringend notwendige bürgerrechtliche Reformen weggemault und ständig neue Befugnisse erquengelt. So kann es nicht weitergehen. Ein Kommentar.

Gerät die Polizei in die Kritik, sind immer die gleichen Reaktionen zu beobachten: Polizeigewerkschaften und politische Hardliner streiten etwaige Vorwürfe ab, nehmen die Polizist:innen in Schutz und greifen die Kritiker und ihre Methoden an. So jetzt wieder schön zu beobachten bei der größten Studie, die je zum Thema rechtswidrige Polizeigewalt in Deutschland durchgeführt wurde.

Und diejenigen, die sonst am Lautesten nach der „vollen Härte des Rechtsstaates“ rufen, ignorieren dröhnschweigend, dass von polizeilichen Übergriffen betroffene Menschen in diesem Land oft keine Anzeige stellen: weil sie keine Chance sehen, dass Täter:innen in Uniform belangt werden. Da müssten eigentlich alle Alarmglocken des Rechtstaats klingeln!

Das in der Studie ausgemachte Dunkelfeld – lediglich eine von fünf mutmaßlichen Misshandlungen wird auch tatsächlich aktenkundig – ist beachtenswert. Nicht, weil es im Vergleich zu anderen Kriminalitätsfeldern besonders hoch wäre. Sondern weil das Missverhältnis so hoch ist, obwohl es sich um potenzielle Straftaten von Staatsbediensteten handelt.

Offenkundig gibt es deutlich mehr rechtswidrige Polizeigewalt als bisher angenommen und die Täter:innen können mit Straflosigkeit rechnen. Das ist nicht gut und schreit eigentlich nach sofortigen Reaktionen aus der Politik.

Es wäre so einfach.

Für das in der Studie untersuchte Problem liegen politische Konzepte fertig in der Schublade. Die Ergebnisse der Studie untermauern uralte Forderungen, welche die allerschlimmsten Misstände in Sachen rechtswidriger Polizeigewalt erfolgreich abstellen könnten:

  1. Es braucht eine eindeutige und klare Kennzeichnungspflicht der Beamt:innen, damit diejenigen, die Straftaten begehen, überhaupt identifizierbar sind.
  2. Es braucht eine unabhängige Anlaufstelle zur Kontrolle der Polizei, die für Bürger:innen und Polizist:innen gleichermaßen ansprechbar ist. Eine solche Institution braucht es, damit nicht die Polizei gegen sich selbst ermittelt, sondern eine unabhängige Stelle. Und sie ist nötig, um den bei der Polizei vorherrschenden Korpsgeist zu brechen und Kritiker:innen aus der Polizei zu schützen.
  3. Es braucht mehr Berichts- und Rechenschaftspflichten, insbesondere über den Einsatz bestimmter Zwangsmittel wie Pfefferspray.

Doch diese politischen Forderungen und Lösungsansätze werden von konservativen Sicherheitshardlinern, von Polizeivertretern und den Polizeigewerkschaften bis aufs Messer bekämpft. Seit Jahren.

Wo bleibt die selbstbewusste und demokratische Polizei?

Eine selbstbewusste, selbstkritische und demokratische Polizei würde die Herausforderung mutig annehmen und sagen: „Wir sind so gut und transparent, dass wir diese Reformen der Polizei als Chance für die Verbesserung unserer Arbeit sehen. Wir haben als diejenigen, die als einzige im Staat Gewalt ausüben dürfen, die Pflicht, transparent und rechenschaftspflichtig zu sein. Und wir haben die Pflicht, all jene aus dem Polizeiapparat zu werfen, die rechtswidrig Gewalt einsetzen.“ Menschen, die eine solche Position in der Polizei vertreten, muss man mit der Lupe suchen. Leider.

Dabei liegt in der Umsetzung dieser drei Lösungsansätze für eine besser kontrollierte Polizei die Möglichkeit, mehr Vertrauen bei den Bürger:innen zu gewinnen. Sogar bei all jenen, die der Polizei traditionell kritisch gegenüber stehen. Doch diese Chance verpasst die Polizei jedes Mal aufs Neue. Sie setzt in Sachen Vertrauen lieber auf Social-Media-Bohei, teure Werbekampagnen und eine Mehrheit der Deutschen, die der Polizei sowieso kritiklos aus der Hand frisst.

Falsche Anreize: Das Quengelkind Polizei wird belohnt

Stattdessen mault die Polizei weiter herum, dass alle immer gegen sie seien. Sie sieht sich permanent als Opfer, ist nicht bereit Fehler auch mal bei sich selbst zu suchen. Die Polizei ist wie ein Quengelkind, das an der Supermarktkasse so lange abnervt, bis es bekommt, was es will. Politisch wird sie für dieses Verhalten allerdings mit immer härteren Gesetzen und weitreichenden Befugnissen belohnt. Das ist eine schwerwiegende Fehlentwicklung, welche die falschen Anreize setzt.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.
———————————————————-
Grafikquelle    :       Polizei im Ordnungsdienst bei 1. Mai-Krawallen in Zürich

 

Abgelegt unter Bildung, Gewerkschaften, Kriegspolitik, Regierung | Keine Kommentare »

Die Welt verbessert sich

Erstellt von DL-Redaktion am 16. September 2019

Unvermeidlich, aber nicht vorhersehbar

File:Ludwig Binder Haus der Geschichte Studentenrevolte 1968 2001 03 0275.0258 (17085923805).jpg

Quelle      :         untergrundblättle  ch.

Von Heiko Schröder  neue-debatte.com

Kritisches Denken und antiautoritäre Erziehung. Pflanzen, Tiere, Menschen verändern sich ständig, stetig aber sehr langsam. Eine Kombination aus Kopieren und Modifizieren des Erbguts, die Genetik, bestimmt die Veränderungsprozesse.

Die Gesellschaft ändert sich auch ständig. Besitz, Strukturen, Verhaltensweisen, Wissen, Deutungsmuster und Ideen werden vererbt – dieser Vererbungsvorgang wird durch Meme bestimmt; Meme, wie sie Richard Dawkins in seinem Buch „Das egoistische Gen“ [1] 1976 definiert hat, die seit geraumer Zeit diskutiert werden [2].

Während die Gene sich nur sehr langsam über viele Generationen hinweg verändern und vererben, können sich Meme schnell vererben und auch verändern; denn ein Mem wird vererbt, indem es von Menschen kopiert wird, was oft nur Informationsfluss erfordert.

Während das Gen automatisch – und bis auf Mutation – identisch kopiert wird, spielt bei der Kopie der Meme eine aktive Zustimmung der Menschen, die sie kopieren eine Rolle. Wenn ich mich bei der Begrüßung entscheide, einem Bekannten die Hand zu reichen, wenn ich eine Melodie summe, wenn ich eine bestimmte Partei wähle oder mir Sportschuhe kaufe, immer ist mein Gehirn mit seinem Bewusstsein und auch mit seinem Unterbewusstsein beteiligt, es kann sich dagegen entscheiden, es kann die Entscheidung beeinflussen.

Veränderung in kurzer Zeit

Gene werden sehr langsam übertragen – es braucht wenigstens eine Generation um auch nur ein bisschen zu verändern. Aber das Mem, wenn es eine Idee ist, kann als Text oder Video via Internet in Sekundenschnelle übertragen werden; es braucht nur etwas Zeit, bis die Idee überzeugt und übernommen wird.

Jedes Jahr machen viele Menschen (wie ich jetzt auch) Sommerurlaub am Strand und sonnen sich. Dieses Mem gibt uns eine „gesunde“ und attraktive Hautfarbe, erhöht aber auch das Hautkrebsrisiko. Wenn ich dieses Mem für mich übernehme, es kopiere, sollte ich mir wenigstens überlegen, ob die angenehmen oder die unangenehmen Nebenwirkungen überwiegen.

Solche Entscheidungen können etwas dauern, bis für mich klar ersichtlich ist, ob es sich lohnt diese Verhaltensweise zu kopieren. Aber Meme brauchen keine Generation, um sich durchzusetzen. Die Meme, mobile Telefone zu nutzen, E-Mail, Facebook, Twitter zu nutzen haben sich in sehr kurzer Zeit durchgesetzt. Moden setzen sich sehr schnell durch, aber zum Beispiel die Art, wie wir Kinder behandeln, ändert sich langsamer.

… alles Meme!

Meme können (im Gegensatz zu Genen) erschaffen werden. Ob eine neue Idee oder eine Verhaltensweise aber zu einem erfolgreichen Mem wird, ist schwer oder gar nicht planbar. Die Entstehung eines Mems beinhaltet einen kreativen Prozess: Jemand hat eine Idee, hat etwas entdeckt, probiert etwas Neues aus und teilt es anderen mit. Wenn viele diese Information teilen, mag es zu dem „Tipping Point“ [3] kommen und ein Mem ist entstanden.

Meme scheinen oberflächlich eher Zufallsprodukte zu sein: Die Verbreitung des Fahrrades, des Autos, des Containers, des Computers. Die Verbreitung demokratischer Prinzipien, die gesetzliche Verankerung der Verbrechensbekämpfung, der nach oben gestreckte Daumen, das Nicken (in vielen Kulturen), die Sprachen, die Musikinstrumente, das Singen, eine einprägsame Melodie – alles Meme.

Gene und Meme unterliegen im Verbreitungsprozess bestimmten Auswahlkriterien. Meme – noch mehr als Gene – können zudem modifiziert werden, durch einen ungenauen Kopiervorgang beispielsweise, aber genauso durch absichtliche kreative Manipulation.

Meme und der (fast) freie Wille

Richard Dawkins hat den Begriff „The Selfish Gene“ (Das egoistische Gen) geprägt, was dem Gen eine Absicht und ein Eigenleben unterstellt. Dies war sicher unter anderem als Provokation gedacht.

Das Gegenstück zum egoistischen Gen, das „egoistische Mem“, scheint mir weniger angemessen, insbesondere weil es immer Menschen sind, die die Meme bewusst, also aus freier Entscheidung heraus wählen.

Auch wenn der freie Wille [4] ein komplexes Konstrukt ist, deren Existenz von vielen zu Recht angezweifelt wird – es ist aber wenigstens zum Teil unsere Entscheidung, welche Partei wir wählen, welche Zeitung wir lesen, ob wir nicken, ob wir Musik hören und ins Konzert gehen, ob wir Fahrrad fahren oder öffentliche Verkehrsmittel nutzen.

Selbst wenn jeder von uns viel von anderen kopiert, hat unser eigenes Verhalten auch Vorbildfunktion und führt zu Nachahmung. So kann ein neues Mem entstehen und das Mem vermehrt sich. Meme werden also auch neu erfunden und diese Erfindung beruht auf Kreativität, vielleicht auch mal auf Zufall. Ob und wie weit und wie sich ein Mem durchsetzt hat Malcom Gladwell in „The Tipping Point“ beschrieben.

Mehr Bildung, weniger personelle Gewalt

Eine der wichtigsten Meme für die Entwicklung der Menschheit ist sicher das Bildungssystem. Weltweit wird die Bildung stärker, weltweit wachsen die Einschulungsraten, die Zahl der Universitäten nimmt zu. Auf der ganzen Welt geht die personelle Gewalt gegen Kinder und Frauen zurück. Steven Pinker hat dies in seinem Buch „The Better Angels of Our Nature: Why Violence Has Declined“ (Deutscher Titel: „Gewalt: Eine neue Geschichte der Menschheit) 2011 herausgestellt [5]. 2018 wurde in einem Interview von Spektrum.de mit Steven Pinker [6] auf die Entwicklung der Tötungsdelikte in Westeuropa reflektiert: «Tötungsdelikte in Westeuropa | Die Anzahl an Tötungsdelikten in Westeuropa geht seit dem 13. Jahrhundert stetig zurück. Französische, englische oder deutsche Bürger laufen statistisch gesehen 60-mal weniger Gefahr, von einem Mitmenschen erschlagen zu werden, als im Jahr 1300.»

Das Wissen der Menschheit insgesamt und der Bildungsgrad der einzelnen Menschen sind beständig gestiegen. Parallel dazu nahm die personelle Gewalt ab. Die Erfindung des Buchdrucks hat die Ausweitung des Bildungssystems möglich gemacht. Dies war anfänglich noch ein recht langsamer Prozess; denn es war sehr aufwendig, ein Buch zu schreiben, zu drucken und zu verbreiten. Bücher mit einer Druckauflage in Millionenhöhe gibt es noch nicht so lange.

Bildungssysteme

Das Drucken von Zeitungen, Radio, Fernsehen und Telefon, haben diese Entwicklung beschleunigt. Das Internet mit Wikipedia, YouTube und Facebook macht es heute möglich, neues Wissen innerhalb von Sekunden über die ganze Welt zu verteilen. So steht nun auch das Wissen darüber, wie am effektivsten gelehrt und gelernt wird weltweit zur Verfügung.

Bildungssysteme entwickeln sich. Sie werden getrieben durch Parteien und Politiker, die – selbst getrieben durch die Formel des ewigen Wachstums – von der Wirtschaft wissen (und diktiert bekommen), was dort gebraucht wird. Getrieben von Eltern und Schülern, die Berufe anstreben, welche ein gutes Einkommen versprechen. Und getrieben von Lehrern, die gerade solche Fächer lehren wollen, die die Wirtschaft verlangt, weil sie darin für sich selbst die besten Anstellungschancen und somit eine Zukunft sehen.

Kritisches Denken

Schon immer hat die Wirtschaft geklagt, dass es nicht genug Fachkräfte gibt, entsprechend sind weltweit die Einkommen der besser gebildeten (und ausgebildeten) Menschen im Durchschnitt höher als die der weniger gebildeten. Dabei geht es der Wirtschaft vor allem um Fachwissen und Teamfähigkeit. Fachwissen wird immer komplexer: Computer müssen genutzt, Regelkreise und Chaostheorie müssen verstanden werden und Teamfähigkeit verlangt das Verstehen psychologischer, pädagogischer und soziologischer Vorgänge. Unser Bildungssystem kommt nicht darum herum, kritisches, also vernünftiges reflektierendes Denken zu lehren.

Kritisches Denken ist aber vielleicht aus der Sicht der Wirtschaft und großer Teile unserer Gesellschaft ein „zweischneidiges Schwert“.

Kritisches Denken oder vernünftiges reflektierendes Denken – oder auch wissenschaftliches Denken – heißt, zu hinterfragen statt zu akzeptieren, was einem gesagt wird. Es kollidiert mit allen Systemen, die auf Autorität aufgebaut sind. Dies gilt für große Teile unserer Bildungssysteme genauso wie für den großen Teil unserer Industrie. Das gilt für die Religionen und für politische Parteien und Regierungen. Es gilt auch für die Familie.

Antiautoritäre Erziehung und freies Denken

In Familie und Schule gab es schon in den 60er Jahren die antiautoritäre Erziehung (siehe: A. S. Neill zu antiautoritärer Erziehung [7] sowie „Freie Kindererziehung in der Familie“ von Paul und Jean Ritter [8]), die Kinder ernst nahm, an Entscheidungen teilnehmen ließ und sie damit zu vernünftigem reflektierenden, also wissenschaftlichem Denken und Argumentieren anhielt.

Die antiautoritäre Bewegung hat sich zwar nicht völlig durchgesetzt, sie hat aber die Diskussion im und um das Bildungssystem bereichert. Die Denkweisen an Universitäten sollten längst überall kritisch, also vernünftig reflektierend und wissenschaftlich sein (sind dies aber selbst an den Stätten des freien Denkens noch nicht uneingeschränkt, sodass Studenten noch vieles auswendig lernen, ohne es wirklich zu verstehen).

Everybody is a Leader

In der Industrie gibt es mittlerweile Firmen, die keinen Chef mehr haben. Flache Organisationsstrukturen setzen sich mehr und mehr durch. Diese verlangen, dass alle Mitarbeiter mitdenken und Entscheidungen treffen. Selbst in modernen Armeen entfernt man sich langsam von streng hierarchischen Befehlsstrukturen, vor allem, weil die hoch technisierte Armee so komplex ist, dass einzelne Befehlshaber oft nicht genug Überblick über mögliche Konsequenzen ihrer Entscheidungen haben.

Bücher wie „Everybody is a Leader“ [9] und „Multipliers“ [10] machen klar, dass man Menschen gut motivieren kann, wenn sie auch Teil der Entscheidungen in einer Firma sein können. Nur dann erfolgt „Buy-In“ [11] und Menschen setzen sich für die Gemeinschaft ein.

Es gibt Webseiten, die helfen, kritisches Denken zu trainieren. Zum Beispiel www.kialo.com, auf der kritisches Denken praktiziert wird oder www.kursfinder.de. Es gibt Techniken, die der Entscheidungsfindung dienen, wie beispielsweise „Six Thinking Hats“, eine von Edward de Bono entwickelte Methode zur Entscheidungsfindung. Es ist zu erwarten, dass die Industrie auch langfristig nach besser ausgebildeten Mitarbeitern sucht, Mitarbeiter die mitdenken, die kritisch und wissenschaftlich denken können.

Mehr Gerechtigkeit

Kritisches Denken oder wissenschaftliches Denken in demokratischen Systemen führt wohl zwangsläufig dazu, dass Utilitarismus, der Kant’sche Imperativ und Konsensieren genauso unterstützt werden, wie das kritische Denken selbst. Damit führt es die Menschen automatisch zu der Frage, was gerecht ist, und zu hinterfragen, wer unter einer Entscheidung leiden und wer davon profitieren würde.

Kritisches Denken angewandt in politischen Überlegungen in einem demokratischen System, würde wohl ebenfalls automatisch zur Gemeinwohl-Ökonomie führen, weil ständiges Wachstum unserer Umwelt zu sehr schadet und unser Streben nach Gerechtigkeit verlangt, dass wir uns um das Gemeinwohl kümmern. Diese Entwicklung scheint mir unvermeidlich, aber unvorhersehbar [12]. Kritisches Denken würde Chancengleichheit in Bezug auf Bildung und Wohlstand erfordern und Bildung und Wohlstand fördern.

Ausprobieren. Kopieren. Modifizieren.

Ich sehe die Verankerung des kritischen Denkens in allen Bereichen unserer Gesellschaft als genetischen Prozess. Kritisches Denken kann gelernt und trainiert werden. Es wird von einigen praktiziert, und wenn es zu guten Ergebnissen führt, wird es von vielen kopiert.

Meine Erwartung ist, dass alle Prozesse, die die menschliche Gemeinschaft verbessern, durch kritisches Denken gefördert werden. Somit nehmen alle Verbesserungsprozesse den Charakter genetischer Algorithmen an: Sie werden von wenigen ausprobiert, sie zeigen Erfolge, sie werden von einigen kopiert, modifiziert, ausprobiert, zeigen mehr Erfolge und werden von vielen kopiert. Dies führt zu einer aufsteigenden Spirale, zu einer exponentiellen Verbreitung.

Wissen. Fähigkeit. Persönlichkeit.

In der Behandlung unserer Kinder hat sich die Anwendung von Gewalt schon erheblich verringert, die Ernährung und Gesundheitsversorgung haben sich verbessert, Kinder werden sehr viel ernster genommen als noch von früheren Generationen. Die Entwicklung geht in Richtung Unterstützung ihrer Kreativität und ihrer Talente. Sie lernen, vernünftig reflektierend mit ihrer Umwelt und ihrem Umfeld umzugehen und sich zu integrieren ohne sich dabei zu verlieren.

Kitas, Schulen und die Orte der Berufsausbildung werden sich weiterentwickeln zu Stätten, an denen sich die Persönlichkeit genauso entwickeln kann wie die Ausweitung des Wissens und der Fähigkeiten. Auch das wird eher ein genetischer Prozess sein, der von kritischem Denken beschleunigt wird.

Arbeit. Geschick. Teamwork.

Die Arbeitsplätze werden sich so entwickeln, dass der Angestellte mehr Verantwortung erhält und gleichzeitig Miteigentümer der Firma sein kann, die ihn bezahlt. Unangenehme Arbeiten werden zunehmend von Robotern und Computern erledigt, Arbeitszeit wird sich verkürzen. Die Menschen werden zufriedener mit ihrer Arbeit sein und außerdem mehr Zeit haben, sich außerhalb der Arbeitsstelle kreativ zu betätigen.

Unsere technisierte Gesellschaft funktioniert mit Arbeitsteilung und Ausbildung. Fast hinter jedem Gegenstand, den wir in die Hand nehmen, steckt ein Entwicklungsprozess, der über mehrere Generationen erfolgt ist. Es stecken wissenschaftliche Erkenntnisse in ihm, er beruht auf Teamwork und Spezialisation, er verlangt für jeden seiner Produktionsschritte – und für Werbung und Vertrieb sowie für die spätere Entsorgung – Wissen und Geschick vieler Personen.

Was treibt die Entwicklung der Gesellschaft voran, was bremst sie?

Warum wird Gewalt weniger statt mehr? Die Frage, ob der Mensch gut oder schlecht ist, ist viel diskutiert worden und, dass der Mensch zu guten und zu schlechten Taten fähig ist, ist bekannt. Für den einzelnen Menschen gibt es ständig Gelegenheiten, sich selbst einen Vorteil durch egoistische Verhaltensweise zu verschaffen.

Aber wenn Menschen sich an einen Tisch gesetzt und darüber nachgedacht haben, welche Regeln sie aufstellen wollen, dann haben sich überwiegend Regeln durchgesetzt, die zum Frieden beitragen. Das gilt für die christlichen Zehn Gebote genauso wie für viele unserer Gesetze, unserer Verfassungen und der Menschenrechte.

Es ist für die meisten von uns günstig, wenn wir uns darauf einigen, uns nicht gegenseitig zu verletzen, zu töten, zu bestehlen oder zu betrügen. Für die Menschheit ist es günstig, wenn wir uns gegenseitig helfen. Es ist also durchaus egoistisch, solche Regeln anzustreben. Zusätzlich sind wir genetisch mit Empathie behaftet und wir wissen heute, dass unsere Spiegelneuronen dazu führen, dass wir mitleiden und uns ebenfalls leicht gemeinsam freuen können.

Gegenkräfte

Dagegen gibt es aber auch Kräfte, die bestehendes Unrecht aufrechterhalten wollen. Wer besitzt, wird dies nicht aufgeben wollen; denn die Angst vor Verlust, also Verlustangst [13] ist stärker als die Freude über Gewinn.

Die Freude am Besitz, das Bestreben „besser“ zu sein und mehr haben zu wollen, ist tief in unserer Gesellschaft verankert. Es drückt sich aus in den vielen Filmen, die von reichen Leuten handeln und vor allem in den vielen Übertragungen von Sportereignissen.

Ich vermute, dass Wettkampf, bei dem es Gewinner und Verlierer gibt, nicht genetisch in uns verankert ist, sondern nur memetisch. Wir müssen also viele unserer Meme ändern. Meme können aber kaum von außerhalb durch Gesetz oder Befehl geändert werden. Meme wachsen langsam und werden langsam wieder vergessen, sie kommen von innen aus der Gesellschaft, sie entstehen in uns.

Über-Ich, Ich, Es und die Angst

Die Frage, welche Bedeutung Meme letztlich haben, aufgezeigt in „Hast du Meme? Oder haben Meme dich?“ [14], hat viel Ähnlichkeit mit der Frage nach dem freien Willen in Free Will von Sam Harris.

Wir werden durch Meme gelenkt und unser Wille ist auch nicht total frei – der freie Wille wird eingeschränkt durch unseren Charakter, unser Über-Ich, unser Ich und unser Es [15], was auf uns zum Teil von unserer Umwelt mit Hilfe von Memen übertragen wurde. Es sind Meme, die uns lenken (Religionen sind Meme genauso wie Erziehungsstile). Andererseits können wir aber auch Meme entwerfen und Meme formen. Wir sind in der Lage, darüber zu reflektieren, welche Meme uns nützen und welche für uns schädlich sind.

Besonders die Situation unserer heranwachsenden Kinder ist so, dass sie oft hinterfragen, ob wir Erwachsenen ihnen die richtigen Muster vorleben und vorgeben. Oft blicken wir kritisch auf die „angepassten“ Menschen herab. Es gibt also Spielraum für uns zwischen Anpassung und Rebellion, zwischen Kämpfen und Aufgeben, zwischen Progressiv und Konservativ – und in diesem Spielraum verändert sich die Menschheit, verändern sich ihre Meme.

Es gibt eine Balance für die Geschwindigkeit von Veränderungen, die durch unsere Angst vor Veränderung und unsere Angst vor Stagnation bestimmt wird (siehe: Grundformen der Angst [16]).

Mehr Gerechtigkeit – eine Doppelsieg-Strategie

Den großen Veränderungen der Gesellschaft hin zu mehr Gerechtigkeit, zu mehr Chancengleichheit, zu mehr Kooperation und weniger Wettkampf steht eine mächtige Opposition gegenüber. Es sind nicht nur diejenigen, die von den jetzigen Ungerechtigkeiten profitieren. Es sind jene, die übertriebene Angst vor Veränderungen haben – konservative Kräfte der Gesellschaft.

Diejenigen, die eine Vormachtstellung besitzen, also viele der besonders reichen Menschen – sie alleine sind in einer recht kleinen Minderheit, werden aber von den konservativen Teilen der Gesellschaft unterstützt. Die konservativen Kräfte in der Gesellschaft neigen dazu, solche Veränderungen nur zu befürworten, wenn sie in kleinen Schritten geschehen. Aber kleine Schritte in dieser Richtung werden diese Konservativen unterstützen.

Einkommen, Vermögen und Verteilung

Würde in Deutschland das Einkommen umverteilt, und zwar zum Beispiel so, dass der Quotient aus Maximaleinkommen und Minimaleinkommen 10 beträgt (siehe: Gemeinwohl-Ökonomie [17]), wobei das Minimaleinkommen mit 1500 Euro definiert ist, so läge in Deutschland das Jahreseinkommen einer Person zwischen 18.000 Euro und 180.000 Euro – bei einem jährlichen Durchschnittseinkommen von etwa 40.000 Euro. Eine so große Veränderung könnte in unserem politischen System vermutlich nur in mehreren kleineren Schritten eingeführt werden.

Im Vergleich zur jetzigen Realität würden Einkommen soweit sinken, dass sich kaum jemand einen Ferrari oder eine Luxusjacht leisten könnte. Große Villen würden nicht mehr gebaut und einige Hersteller von Luxusartikeln würden ihre Produktion wohl erheblich umstellen müssen. Sie würden dabei möglicherweise aber gewinnen, denn die Gemeinwohl-Ökonomie wird im Durchschnitt mehr Wohlstand schaffen. Dies wird viel mehr Menschen die Möglichkeit geben, sich zum Beispiel ein iPhone zu kaufen, aber niemand wird mehr nach einem mit Diamanten besetzten iPhone verlangen.

Die positiven Effekt

Fraglich ist nicht, ob eine derartige Angleichung der Einkommen negativen Einfluss auf die Zufriedenheit vieler Menschen hätte. Aktuell haben weniger als 1,5 % der Bevölkerung überhaupt ein Einkommen, dass über 180.000 Euro im Jahr liegt. Obige Zahlen sollten daher unter verschiedenen Modellvorgaben nachgerechnet werden. Unter utilitaristischen Maßstäben wäre zu erwarten, dass sich die Situation für die überwältigende Masse der Menschen erheblich verbessert, weil es weit mehr Gewinner als Verlierer gebe.

Die Änderung der Einkommensverteilung und auch des Vermögens (Erbschaftsteuer) muss einhergehen mit der Änderung der Chancengleichheit in der Bildung, zusammen mit einer Ausweitung der Bildung; denn wir müssen besser lernen, die Zusammenhänge zu verstehen.

Selbst diejenigen, die im Rahmen dieser Veränderungen finanziell etwas abgeben, werden vielleicht zufrieden mit diesen Veränderungen sein. Denn mehr Gerechtigkeit [18] und ein verstärktes Gefühl, dass wir alle in einer gerechten Welt leben, führen zu geringerer Kriminalität, besserer Gesundheit für die Allgemeinheit, weniger Neid und höherer Zufriedenheit.

Mehr Freiheit für jeden

Ich habe ein paar Jahre als Hochschullehrer umgeben von armen Menschen gelebt – für sie war ich reich. Bettler saßen auf meinem Weg zur Universität. Ich fühlte mich nicht gut in der Rolle reich zu sein und ich glaube das geht den meisten Menschen so. Deshalb schotten sich viele Wohlhabende ab. Sie errichten hohe Mauern um ihr Haus und an dem Tor zum Grundstück steht ein bewaffneter Wächter. Das bedeutet aber auch weniger Freiheit für die Bewohner des Hauses.

Wenn diese Ungerechtigkeiten verringert werden können, müssen sich Wohlhabende weniger mit hohen Mauern und Bodyguards umgeben. Sie würden somit Freiheit hinzugewinnen, die ihnen die Möglichkeit zu einem größeren und vielleicht interessanteren Freundeskreis eröffnet.

Heiko Schröder
neue-debatte.com

Fussnoten:

[1] Richard Dawkins: Das egoistische Gen (Original: The Selfish Gene; 1976).

[2] Spektrum.de (01.12.2000): Evolution – Die Macht der Meme. Auf https://www.spektrum.de/magazin/die-macht-der-meme/827031 (abgerufen am 11.09.2019).

[3] Malcolm Gladwell: The Tipping Point – How Little Things Can Make a Big Difference (2001).

[4] Sam Harris: Free Will (2012). Siehe: https://en.wikipedia.org/wiki/Free_Will_(book) (abgerufen am 11.09.2019).

[5] Steven Pinker: The Better Angels of Our Nature: Why Violence Has Declined (2011). Siehe: https://en.wikipedia.org/wiki/The_Better_Angels_of_Our_Nature (abgerufen am 11.09.2019). Das Buch wurde in Deutsch unter dem Titel „Gewalt – Eine neue Geschichte der Menschheit“ (Verlag S. Fischer, 2013) veröffentlicht.

[6] Spektrum.de (19.04.2018): „In der Welt herrscht immer weniger Gewalt“. Auf https://www.spektrum.de/news/immer-weniger-gewalt-in-der-welt/1559618 (abgerufen am 11.09.2019).

[7] Alexander Sutherland Neill: Theorie und Praxis der antiautoritären Erziehung. Das Beispiel Summerhill (Rowohlt, Reinbek 1969).

[8] Paul und Jean Ritter: Freie Kindererziehung in der Familie – Selbstbestimmung als Erziehungsprinzip (Rowohlt Taschenbuch Verlag, Reinbek 1987).

[9] trainingmag.com (13.09.2016): Everybody is a Leader, Auf https://trainingmag.com/everybody-leader (abgerufen am 11.09.2019).

[10] Liz Wiseman und Greg McKeown: Multipliers – How the Best Leaders Make Everyone Smarter (Kindle, 2010).

[11] John P. Kotter: Buy-In – Saving Your Good Idea from Getting Shot Down (Kindle, 2010).

[12] Journal of Democracy: China at the Tipping Point? (2013). Auf https://www.journalofdemocracy.org/wp-content/uploads/2013/01/Nathan-24-1.pdf (abgerufen am 11.09.2019).

[13] Ulrike Sammer: Verlustangst und wie wir sie überwinden (Fachratgeber Klett-Cotta, 2018).

[14] Gen-ethisches Netzwerk: Hast du Meme? Oder haben Meme dich? Auf https://www.gen-ethisches-netzwerk.de/hast-du-meme-oder-haben-meme-dich (abgerufen am 11.09.2019).

[15] Strukturmodell der Psyche. Auf https://de.wikipedia.org/wiki/Strukturmodell_der_Psyche (abgerufen am 11.09.2019).

[16] Fritz Riemann: Grundformen der Angst (42. Auflage, Ernst Reinhardt Verlag, 2017).

[17] ecogood.org: Gemeinwohl-Ökonomie – Ein Wirtschaftsmodell mit Zukunft. Auf https://www.ecogood.org/de/idee-vision (abgerufen am 11.09.2019).

[18] Alfie Kohn: Punished by Rewards – The Trouble with Gold Stars, Incentive Plans, A’s, Praise and Other Bribes (2000).

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-ND 4.0) Lizenz.

——————————————————————

Grafikquelle          :          Ludwig Binder: Studentenrevolte 1967/68, West-Berlin; veröffentlicht vom Haus der Geschichte der Bundesrepublik Deutschland. / Stiftung Haus der Geschichte (CC BY-SA 2.0)

Abgelegt unter APO, Bildung, Kultur, Medien | Keine Kommentare »

Scientists for Future

Erstellt von DL-Redaktion am 15. September 2019

„Es macht mich traurig, wie dumm wir sind“

File:Front banner of the FridaysForFuture Demonstration 25-01-2019 Berlin 25.jpg

Interview:  mit Christoph Schneider –

-erforscht seit 25 Jahren, wie sich das Klima der Erde ändert. Lange hat niemand zugehört. Jetzt wird er selbst zum Aktivisten, ein bisschen zumindest.

Seit Jahrzehnten warnen Wissenschaftlerinnen und Wissenschaftler, dass der Mensch mit seinem Verhalten, seinen Autos, seinem Essen, seinem Urlaub das Klima der Erde verändert. Doch lange schien das niemanden zu interessieren. Bis jetzt. Seit jeden Freitag Tausende junge Menschen unter dem Motto „Fridays for Future“ auf die Straße statt in die Schule gehen, ist der Klimawandel zum Thema geworden.

Am 12. März verkündete eine Gruppe Forschender vor der Bundespressekonferenz in Berlin, dass sie die streikenden Schülerinnen unterstützt. Ihr Name: Scientists for Future. Die zugehörige Stellungnahme haben mehr als 26.000 Wissenschaftler unterzeichnet. Einer der Ersten war Christoph Schneider, Professor für Klimageografie am Geografischen Institut der Humboldt-Universität zu Berlin. Er sagt: Fridays for Future habe viel verändert, auch für ihn persönlich – aber lange noch nicht genug.

ZEIT Campus ONLINE: Herr Schneider, vor etwas mehr als einem Jahr begann Greta Thunberg mit ihrem Schulstreik für das Klima. Was haben Sie gedacht, als Sie davon erfahren haben?

Christoph Schneider: Ich habe zum ersten Mal von Greta Thunberg gehört, als sie vor der UN-Klimakonferenz in Kattowitz gesprochen hat. Ich glaube nicht, dass ich damals schon verstanden habe, welche Bedeutung das hatte. Ich fand es berührend, dass junge Menschen nicht nur auf einer Sachebene, sondern mit einer emotionalen Betroffenheit beginnen, die politische Debatte mitzugestalten.

ZEIT Campus ONLINE: Inzwischen protestieren Tausende Schülerinnen und Schüler auf der ganzen Welt mit Greta. Macht Ihnen das Hoffnung?

Schneider: Ja. Ich sehe die Möglichkeit, dass über diesen Protest ein Hebel gefunden wird, den Klimawandel in eine Bahn zu lenken, in der er die Menschheit weniger hart trifft.

ZEIT Campus ONLINE: Sie sprechen von Klimawandel, nicht etwa von Klimakrise, Klimazusammenbruch oder Klimanotstand, wie es Greta Thunberg tut. Warum?

Schneider: Weil ich als Naturwissenschaftler erst mal sehe, dass sich das Klima wandelt. Ob der Klimawandel zu einer Krise wird, ist ein politischer oder soziologischer Begriff, den ich nicht brauche. Ich versuche, objektiv zu sagen: Wir beobachten eine sehr starke Veränderung des Klimas. Die wird sich, nach allem was wir wissen, verstärkt fortsetzen. Die Auswirkungen davon sind voraussichtlich krisenhaft, sie könnten auch katastrophal werden. Aber da ich das nicht weiß, versuche ich zu vermeiden, es in Begrifflichkeiten zu fassen.

ZEIT Campus ONLINE: Sie erforschen seit Anfang der Neunzigerjahre, wie sich das Klima der Erde verändert. Erst jetzt beginnen Politik und Gesellschaft, sich dafür zu interessieren. Wie haben Sie das Vierteljahrhundert dazwischen erlebt?

Schneider: Schon 1986, in meinem ersten Semester Geografie, haben wir in der Freiburger Altstadt beim Bier über Klimawandel gesprochen. Damals war er für uns eher noch ein Anlass, um unsere Forschung zu motivieren. Es ist interessant, wie man das abspalten kann. Wir wussten natürlich genau, wie dramatisch es werden kann, wenn politisch nichts passiert, um dem entgegenzuwirken. Aber zu dem Zeitpunkt dachten wir noch, dass die Menschheit nicht so doof ist und schon rechtzeitig die entsprechenden Schlüsse ziehen wird.

ZEIT Campus ONLINE: Das ist aber jahrzehntelang nicht passiert.

Schneider: Das Kyoto-Protokoll von 1997 war für mich ein Durchbruch: Ich dachte, es gibt doch jetzt einen Konsens auf der Welt, dass wir den Klimawandel angehen. Das war eine Fehleinschätzung. Als dann die Schröder-Fischer-Regierung 2000 das Erneuerbare-Energien-Gesetz verabschiedete, sah ich darin eine Blaupause für die Welt. Das hat sich auch als Fehleinschätzung herausgestellt. Ab 2012 oder 2013 hatte ich immer mehr den Eindruck, dass auf den Folien für meine Vorlesung jedes Jahr das Gleiche steht: Es ist drängend, wir müssen jetzt schnell die Umkehr schaffen und die Emissionen global nach unten bringen. Nur den Zeithorizont muss ich jedes Mal updaten, weil es immer dringlicher wird.

ZEIT Campus ONLINE: Was macht dieses ewige Warten mit Ihnen?

Schneider: Ich bin immer noch optimistisch, dass tiefgreifender Wandel aus irgendeiner Ecke, die ich gerade nicht auf dem Schirm habe, passieren kann. Wer hätte denn vor drei Jahren gedacht, dass es Fridays for Future geben wird? Aber natürlich ist es auch frustrierend. Eine meiner Lieblingsfolien der Klimatologie-Vorlesung für die Erstsemester zeigt die Temperaturkurve von 1850 bis 2100. Meine Enkeltochter ist 2011 geboren, sie könnte den Wechsel ins 22. Jahrhundert erleben. Ich schaue mir diese Werte an und überlege: Was ist das für eine Welt? Wie sieht es da dann aus? Da kann einem schon bange werden. Ich empfinde eine tiefe Berührtheit, einen Schmerz. Es macht mich traurig, wie dumm wir sind. Kollektiv verhalten wir uns wie ein Schwarm dämlicher Goldfische.

„Unser Konsumverhalten funktioniert so nicht“

ZEIT Campus ONLINE: Die neueste Eurobarometer-Umfrage zeigt, dass sich immer mehr Menschen in Deutschland Sorgen ums Klima machen. Während 2018 noch 21 Prozent der Befragten im Klimawandel eines der beiden wichtigsten Themen sahen, mit denen die EU konfrontiert ist, waren es diesmal schon 31 Prozent. Freuen Sie sich über solche Zahlen?

File:Greta Thunberg 4.jpg

Würde Dummheit Schmerzen bereiten, müssten manche ältere Semester Tag und Nacht zittern.

Schneider: Ja, aber daraus folgt noch kein belastbares Bekenntnis zu engagierter Klimapolitik. Sagen Sie den Menschen mal, dass eine CO2-Steuer den Liter Sprit auf 2,50 Euro hochtreiben muss, damit wir den Wandel in Richtung Klimaneutralität schaffen. Dann möchte ich mal wissen, wie viele von den 31 Prozent dem noch zustimmen. Das ist das hauptsächlich Frustrierende: dass die Menschen wider besseres Wissen ihren kurzfristigen eigenen Vorteil wählen.

ZEIT Campus ONLINE: Was müssten wir bereit sein zu ändern?

Schneider: Unser Konsumverhalten funktioniert so nicht – egal, ob es um Plastikverbrauch geht, um Müll, um Fernreisen, um die Frage, wie viel Quadratmeter Wohnfläche jeder von uns haben muss. Ich sage nicht, dass wir eine Verzichtgesellschaft brauchen. Nein, wir müssen lernen, dass Lebensqualität bei dem hohen materiellen Wohlstand, den wir Deutschen haben, nicht davon abhängt, so viele Ressourcen zu verbrauchen. Ich bin überzeugt, dass der Erholungseffekt von drei Wochen Radfahren in Brandenburg mindestens so groß ist wie der Erholungseffekt von einer Fernreise auf die Malediven mit Tauchkurs. Aber das verstehen viele Menschen nicht.

ZEIT Campus ONLINE: Gerade in diesem Sommer wird doch viel über Begriffe wie Flugscham und Zugstolz diskutiert.

Schneider: Es sind nur ein paar Menschen, die es schaffen, ihr Verhalten wirklich zu ändern. Wir brauchen natürlich diese Graswurzelbewegung – dass Menschen weniger fliegen, bio und regional einkaufen, weniger Fleisch essen. Alles total wichtig. Aber das löst das Problem nicht. Es kann maximal das politische Bewusstsein schaffen und den Druck aufbauen, dass von oben die Anreize gesetzt werden, die eine breite Masse mitnehmen.

Quelle        :         Zeit-Campus           >>>>>         weiterlesen

———————————————————————-

Grafikquellen       :

Oben       —          Fronttransparent der FridaysForFuture Demonstration am 25. Januar 2019 in Berlin.

Source Own work
Author Leonhard Lenz

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication

————————

2.)     von  Oben       —        Maja Göpel (3.v.l.) bei der Vorstellung der Stellungnahme von Scientists for Future, März 2019 in Berlin

Abgelegt unter Bildung, Energiepolitik, International, Umwelt | Keine Kommentare »

Politik – Mythos Cambridge

Erstellt von DL-Redaktion am 14. September 2019

Den Engländern die Eliten und Schland den Nieten ?

TrinityCollegeCamGreatCourt.jpg

Von Rea Eldem

In England bestimmt die Wahl der Bildungsinstitution den Werdegang der Elite in Politik und Wirtschaft.

it Herzrasen in meiner Brust und wackligen Beinen schreite ich vor den Altar. Knie mich auf das rote Samtkissen nieder und schiele nach oben. Blicke in das faltige Gesicht des alten Herren, der ­Latein faselt und mir zum Abschluss seine Hand reicht, damit ich seinen Ring küssen kann. Dann stehe ich auf – vorsichtig und langsam, um bloß nicht auf den Saum meines schwarzen Umhangs zu treten. Ich verbeuge mich, wie ich es am ­Vorabend bereits mehrfach geübt habe, und verlasse das prächtige Senatsgebäude, ohne mich umzusehen.

Was wie ein mittelalterliches Aufnahmeritual klingt, ist meine Graduierungszeremonie im Jahre 2018. Sie ist der Klimax meiner einjährigen emotionalen Reise an der University of Cambridge, die an diesem Tag Familienangehörigen einen Einblick hinter ihre Kulissen gewährt. Sie alle sind angereist, um sich einen persönlichen Eindruck von einer der renommiertesten Bildungsinstitutionen der Welt zu machen. Die Stimmung einer Universität zu erleben, die über 90 Nobelpreisträger hervorgebracht hat und auf mehrere Jahrhunderte Geschichte zurückblickt. Turing, Darwin, Hawkins. Die Produktionsstätte der Forschungs- und Machtelite Englands.

Dass Studierende und Eltern den Zirkus mitmachen, ist sinnbildlich für die Strahlkraft und soft power von Oxbridge, wie Cambridge und Oxford oft zusammenfassend bezeichnet werden. Es sind Momente wie diese, die den Habitus dieses Ortes in konkrete Handlungen und Praktiken überführen und damit sichtbar machen.

Die University of Cambridge gibt es als Einheit gar nicht, jedenfalls nicht physisch. Es gibt weder das Gebäude, noch die Vorlesungshalle. Stattdessen gibt 31 Colleges, die nach und nach erbaut wurden und von Grund auf verschieden sind. Das College-System darf man sich vorstellen wie bei Harry Potter. Ein kleiner Ausflug in die Welt der Zauberer: Alle besuchen die Schule Hogwarts, sind aber in verschiedene Häuser unterteilt. Diese sind Dreh- und Angelpunkt für ihr Sozialleben. Sie schlafen dort, schließen Freundschaften, essen gemeinsam. Dennoch fühlen sie sich alle dem Überbau Hogwarts verbunden. Im Unterricht treffen sie häuserübergreifend aufeinander, je nach Fach. Die 31 Colleges der University of Cambridge sind quasi das Äquivalent der Häuser von Hogwarts. Und genau wie bei Harry und Co sitzt man in den Seminaren und Vorlesungen mit Studierenden zusammen, die aus anderen Häusern kommen.

Das College-System führt dazu, dass sich die Lebensumstände der Studierenden stark unterscheiden. Traditionelle Colleges haben Macht und Einfluss; sie stärken den Mythos der Universität als Ganzes. Sie haben zahlungskräftige Alumni-Clubs, bieten Führungen für Touristen an und verkaufen Pullover mit ihren Wappen drauf. Die Ungleichheit zwischen den Colleges reproduziert im Kleinen die Ungleichheit im Rest des Landes. Laut einem Bericht der Financial Times rekrutiert Oxbridge vorwiegend Privatschüler. Obwohl es über 2.900 öffentliche Schulen in England gibt, kommt mehr als die Hälfte der Studierendenschaft von sage und schreibe acht Privatschulen.

Immer wieder gibt es in der englischen Presse Berichte über die soziale Ungleichheit und die Rolle, die Eliteuniversitäten dabei einnehmen: Während die besagten acht Privatschulen ihre Schüler ab der Einschulung für die sozialen Codes sensibilisieren, Auswahlgespräche üben und perfekt auf den nahtlosen Übergang an die Eliteuni vorbereiten, haben Schüler aus öffentlichen Schulen erhebliche Nachteile.

In England bestimmt die Wahl der Bildungsinstitution den Werdegang: Von Englands bisherigen 56 Premierministern studierten 42 in Oxford oder Cambridge. Der Großteil drückte zuvor die Schulbank in einer der acht renommiertesten Privatschulen, von denen Eton wohl die im Ausland bekannteste sein dürfte. Obwohl Oxford mehr der prominenten politischen Totalausfälle der letzten Jahre geformt hat, werden auch in Cambridge Entscheidungsträger der Politik und Wirtschaft produziert. Das wirft die Frage nach den Werten auf, die solche Unis propagieren.

In Cambridges Unipolitik werden solche Fragen kontrovers diskutiert: Während die „Decolonise Cambridge“-Bewegung dazu auffordert, imperialistische Strukturen abzubauen und eine inklusive Vision der Uni anstrebt, halten andere an Traditionen fest. Die „Decolonise“-Bewegung plädiert dafür, Lehrpläne zu reformieren, um endlich auch einmal Alternativen zu weiß-männlichen Perspektiven herkömmlicher Soziologen, Historiker und Schriftsteller zu lehren. Andere sehen wiederum gar keinen Grund für Bemühungen um mehr Diversität, weder in den Lehrplänen noch in der Zusammensetzung der Studierenden- und Professorenschaft.

Pippa Wells-LHC.jpg

 Pippa Wells, Physicienne du CERN

Es liegt viel im Argen, aber wenig ist im Umbruch: Trotz anhaltender Kritik tun sich die englischen Eliteunis schwer mit Veränderungen. Sie sind von konservativen Machtstrukturen durchsetzt – und ansässig in einem politisch tief gespaltenen Land, in dem die einen krampfhaft an imperialistischem Gedankengut festhalten und die anderen für Veränderungen auf die Straße gehen. Um zu verhindern, dass diesem System zukünftig weitere Boris Johnsons entspringen, bräuchte es schon eine entschiedene Haltung vonseiten der Unis.

Man stelle sich vor, in Deutschland käme heraus, dass Merkel, Schröder und Kohl alle an derselben Elite-Uni studiert hätten und in derselben studentischen Verbindung aktiv waren. Absurd? In England wäre das wenig überraschend.

Quelle         :       TAZ         >>>>>         weiterlesen

—————————————————————–

Grafikquellen        :

Oben      —        The Great Court at Trinity College, Cambridge. Showing from left to right, the King’s Gate, Chapel, Fountain and Great Gate. The court features in the story Chariots of Fire.

—————————–

Unten        —      Pippa Wells, Physicienne du CERN, dans le tunnel du LHC

Maximilien Brice Pantelia, AnnaCern.ch https://cds.cern.ch/record/1019627 http://cds.cern.ch/record/2645407 https://cds.cern.ch/record/1459625

Abgelegt unter Bildung, Europa, Kultur, Regierungs - Werte | Keine Kommentare »

2 Jahre linksunten-Verbot

Erstellt von DL-Redaktion am 12. September 2019

Zwei Jahre linksunten-Verbot

Biedenkopf Geburtstag a100129 123130TWK Thomas Kretschel.jpg

Nur Mächtige treten die Welt mit ihren Füßen

Quelle         :         Scharf  —  Links

von Achim Schill (mit Assistenz von Detlef Georgia Schulze)*

Versuch einer politisch-juristischen Einordnung

Als im August 2017 das Verbot von linksunten.indymedia[1] vom Bundesinnenministeri­um (BMI) verfügt wurde, gab es zwar einige Proteste, aber im Verhältnis zur Bedeu­tung dieses Verbotes waren die Reaktionen doch eher bescheiden. Ob es die Nach­wirkungen von G20 waren oder ob man mit diesem Verbot nicht gerechnet hatte (und dementsprechend nicht [politisch] vorbereitet war) – jedenfalls passierte im ersten Jahr nach dem Verbot nicht allzu viel.

Ich war nur sporadisch und erst in den letzten Jahren vor dem Verbot Leser von links­unten, hatte aber zusammen mit DGS (in drei Fällen auch mit Peter Nowak) Texte auf dieser Plattform eingestellt[2]. Von daher war es für uns drei eine Selbstverständlich­keit, uns mit linksunten zu solidarisieren.[3] Dass wir drei ca. ein Jahr später deswegen Post vom Landeskriminalamt bekamen, war zumindest für mich eine erhebliche Über­raschung.

Am Anfang hatte ich einfach nur eine ohnmächtige Wut, die sich aber an nichts Kon­kretem abreagieren konnte. Aber durch die Zusammenarbeit mit den beiden anderen Autoren konnte ich dadurch zumindest die Sache etwas besser politisch, aber vor al­lem auch juristisch einordnen. Das hat bewirkt, dass sich meine anfangs ohnmächtige Wut in einen hoffentlich produktiven Medienaktivismus (s. unseren in FN 2 und 3 ge­nannten Blog) gewandelt hat; und ich gedenke, diesen Medienaktivismus noch weiter zu kultivieren, bis das linksunten-Verbot erfolgreich bekämpft ist.

Jene anfängliche relative öffentliche Passivität in Sachen linksunten hat sich aber mittlerweile dahingehend geändert, dass es mehr kritische Presseberichte über das linksunten-Verbot gibt. Und ich