DEMOKRATISCH – LINKS

                      KRITISCHE INTERNET-ZEITUNG

RENTENANGST

Archiv für die 'Überregional' Kategorie

Das Spiel mit Mitgliedern

Erstellt von DL-Redaktion am 17. November 2019

Wie „wahr“ sind veröffentlichte Mitgliederzahlen der Partei DIE LINKE. in der Realität?

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Quelle        :    Scharf  —   Links

Von Wolfgang Gerecht

Werden die Öffentlichkeit, die Links-Partei-Wähler und die Mitglieder der Links-Partei durch den 44-köpfigen Bundesvorstand (BuVo) und die Landesvorstände (LaVo) der Partei DIE LINKE durch irreale Mitgliederzahlen getäuscht?

Kann eine Partei, in der ein Landesverband den anderen Landesverband, mittels satzungswidrigen (unrichtigen) Mitgliederzahlen täuscht „demokratisch“ oder gar „solidarisch“ sein?

Ein zentraler Punkt der demokratischen Verfassung einer Partei ist die satzungskonforme Mitgliedschaft eines  j e d e n  Partei-Mitglieds.

Ein wesentlicher Punkt einer satzungskonformen Mitgliedschaft ist die satzungskonforme Zahlung des Mitgliedsbeitrages gemäß Beitrags-Tabelle bzw. die satzungskonforme Beitragsbefreiung eines Mitglieds.

  • Nur satzungskonforme Mitgliedsbeiträge ergeben satzungskonforme Mitgliederzahlen,
  • Nur satzungskonforme Mitgliederzahlen ergeben satzungskonforme Delegierten-Schlüssel.
  • Nur satzungskonforme Delegierten-Schlüssel ergeben eine legale Delegierten-Wahl.
  • Nur eine legale Delegierten-Wahl ergibt eine legale Parteitags-Delegierten-Versammlung
  • Nur eine legale Delegierten-Versammlung ergibt einen legal gewählten Partei-Vorstand.

Das gilt für alle Wahlen einer Partei, so auch für die Partei DIE LINKE.

Egal ob Bundesebene, Landesebene, Kreisebene, Stadt- oder Gemeindeebene.

Egal ob Vorstands-, Kommissions- oder z.B. LAG oder BAG Wahlen u.s.w..

Beispiel Saarland:

Ende 2016 wurden  2.395, für 2017  2.465 und 2018  2.124 Mitglieder ausgewiesen.

Von dort aus berichtet der Landes-Schatzmeister Schmidt gem. ND v. 26.9.19, dass er nach Abschluss der Mahnverfahren mit noch etwa 1800 Mitgliedern rechne.

In 2017 noch 70 Mitglieder dazu, in 2018  dann 341 Mitglieder weniger, dann wird in 2019 gemeldet es sind wahrscheinlich nur noch ca. 1800, also ca. 324 weniger.

Der Saarland-Schatzmeister beklagt zudem, dass die Beiträge viel zu niedrig seien. 30 bis 40 Prozent der Genossen zahlten nur den Menschen ohne Einkommen vorbehaltenen Mindestbetrag von 1,50 Euro monatlich, die meisten von ihnen auch den nicht einmal regelmäßig.

Es ist bei dieser o.g. Sachlage offensichtlich, dass ein Großteil der Genoss Innen im Landesverband Saarland Kenntnis von dieser rechtswidrigen Faktenlage gehabt haben müssen.

Bei der Korrektur der satzungswidrigen und damit rechtswidrigen Mitgliederzahlen aus denen normalerweise auch die Delegierten-Anzahl eines jeden Landesverbandes abgeleitet bzw. errechnet werden, muss um satzungskonform zu werden, folgendes berücksichtigen:

Die Streichung/Löschung der Mitgliedschaft bei den Mitgliedern, die nach dem Mahnverfahren ihre satzungskonform ermittelten Beiträge nicht entrichtet haben.

Die zur Streichung der Mitgliedschaft von LaSchatzMstr geschätzten 300 Mitglieder entsprechen etwa 14% der zum 31.12.2018 von ca. 2.100  (2.124) Mitglieder.

Nach Angaben des Landes-Schatzmeisters im ND zahlen 30 bis 40 Prozent der Genossen nur den Menschen ohne Einkommen vorbehaltenen Mindestbetrag von 1,50 Euro monatlich, die meisten von ihnen auch den nicht einmal regelmäßig. Mindestens 30% der Linken-Mitglieder im Saarland also ca. 630 Mitglieder wären demnach Empfänger von Grundsicherung sei es durch Hartz IV oder durch Sozialhilfe. Das wäre durch Vorlage der Bewilligungs-Bescheide leicht nachzuprüfen. In der Regel wissen die Linken-Mitglieder der Gemeinden- und Stadtverbände ja, wer wirklich satzungskonforme Beiträge zahlt, d.h. ggfs. zu Recht den „Mini-Beitrag“ zahlt oder nicht.

Also diese „Beitrags-Verweigerer“ haben ebenfalls keine Mitgliedsrechte und sind deshalb ebenfalls in das Mahnverfahren einzubeziehen, was bei erfolglosem Abschluss ebenfalls zur Streichung/Löschung der Mitgliedschaft solcher Mitglieder führen muss.

Diese Maßnahme wird zur Reduzierung von 630 Mitgliedern (bei 30%), von 420 Mitgliedern bei (20%) satzungswidrigen Beitragszahlern führen.

Wie heißt es so schön bei der LINKEN permanent: Solidarität, Demokratie u.s.w.

Einige Fragen lauten:

Ist der LV Saarland nur der berühmte Einzelfall?

Wusste der Bundesvorstand, gerade auch die beiden Vorsitzenden Kipping und Riexinger, der Bundesgeschäftsführer Schindler, der Bundes-Schatzmeister Harald Wolfvon alledem überhaupt nichts? Was hat der Bundes-Schatzmeister Wolf und der Bundes-Geschäftsführer Schindler für eine Wiederherstellung einer satzungsgemäßen Mitglieder- und Kassenführung im Landesverband Saarland konkret unternommen? Gibt es weitere Landesverbände mit gravierenden Unregelmäßigkeiten bei der Erhebung eines satzungsgemäßen Beitrags?

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/

——————————————————————

Grafikquellen        :

Oben        —     Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor      —     Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

———————————

Unten     —        Ein bunter Scherbenhaufen von rot  bis braun – ein Scherbenhaufen

Abgelegt unter P. DIE LINKE, Positionen, Saarland, Überregional | 5 Kommentare »

Demokratieförderung Bund

Erstellt von DL-Redaktion am 17. November 2019

Geld allein macht nicht glücklich

Unteilbar Dresden 2019 026.jpg

Von Pia Stendera und Simon Schramm

Wie wir zusamenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Deshalb investiert der Staat viel Geld in Großprogramme zur Demokratieförderung. Was können diese überhaupt leisten?

Demokratie, die Herrschaft des Volkes, bedeutet in Deutschland für die meisten Volljährigen, regelmäßig frei und geheim ihre Re­prä­sen­tan­t*in­nen wählen zu können. Gerade Jüngere halten das für selbstverständlich, sie kennen kein anderes politisches System. Und Demokratie bedeutet, die eigene Meinung frei äußern zu dürfen, auch wenn einige dabei gern weiter gehen würden, als es das Grundgesetz erlaubt. Doch demokratisches Leben ist noch viel mehr als wählen gehen und Meinungsfreiheit.

Wie wir zusammenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Und manchmal braucht es eine Erinnerung, wie sehr wir von unserem politischen System profitieren. Es braucht Überzeugungsarbeit – ob im Betrieb oder in der Kneipe. Um diese Arbeit zu fördern, hat der Staat 2001 beschlossen, Geld zu verteilen. Zusammengefasst hat er das mit dem Begriff Demokratieförderung.

Was heißt das? Konkret geht es um Fördergroßprogramme des Familienministeriums, wobei Geld an Organisationen und Bür­ge­r*in­nen verteilt wird, die sich um die Demokratie kümmern. Unterstützt werden zum Beispiel Bildungsprojekte für Schü­le­r*in­nen, Schulungen für Leh­re­r*in­nen, Projekte zur präventiven Extremismusbekämpfung, aber auch Aus­stei­ge­r*in­nen­pro­gram­me für Ex­tre­mis­t*in­nen.

In den vergangenen 20 Jahren hat die Regierung konstant immer mehr Geld dafür bereitgestellt, Kritik gab es trotzdem. Das Problem: Bisher liefen diese Großprogramme maximal fünf Jahre. Somit waren auch die Förderungen der Projekte immer begrenzt, ihre weitere Existenz stets bedroht. Nun wird mit „Demokratie leben“ zum ersten Mal ein solches Großprogramm verlängert.

Natürlich kann ein Förder-programm nicht alles heilen, was falsch läuft

„Weil Demokratieförderung Planungssicherheit braucht“, begründete Familienministerin Franziska Giffey (SPD) diese Entscheidung. Mit dem Jahr 2020 beginnt dann der zweite Förderzeitraum. Jährlich sollen bis 2024 115,5 Millionen Euro in demokratiefördernde Projekte fließen. Die Entfristung allein schafft aber keine Planungssicherheit.

Unteilbar Dresden 2019 006.jpg

Die Kritik an Großprogrammen zur Demokratieförderung ist so alt wie die Programme selbst. Jedes Mal, wenn diese Programme auslaufen, sagen Ver­tre­te­r*in­nen bisher geförderter Projekte, dass das Geld nicht reicht. Mit „Demokratie leben“ wurden aber allein 2019 115 Millionen Euro verteilt. Das ist mehr als in jedem vergleichbaren Programm in Europa.

Viel Unmut gab es wegen der neuen Verteilung der Fördergelder. Besonders ein offener Brief an das Familienministerium sorgte für Aufsehen. Der Brief wurde von Joseph Blank und Martin Nanzig von der Deutschen Gesellschaft für Demokratiepädagogik initiiert und von 315 Organisationen und Personen unterzeichnet. Wo genau ist das Problem?

Quelle         :     TAZ         >>>>>        weiterlesen

—————————————————————-

Grafikquellen      :

Oben         —          Unteilbar Dresden 2019

Abgelegt unter APO, Kultur, Sachsen, Überregional | Keine Kommentare »

Die LINKE in Thüringen

Erstellt von DL-Redaktion am 16. November 2019

Für ein sozialistisches Regierungsprogramm der LINKEN in Thüringen

Quelle       :     AKL

Beschluss der AKL Berlin vom 14.11.2019

Angesichts des Wahlergebnisses in Thüringen, aus dem DIE LINKE als stärkste Partei hervorgeht, fordern wir Bodo Ramelow und DIE LINKE-Fraktion in Thüringen auf, keine Koalition oder Tolerierungsabkommen mit der CDU oder anderen im thüringischen Landtag vertretenen Parteien einzugehen. Stattdessen sollte DIE LINKE jetzt das Wahlergebnis zum Anlass nehmen, ein sozialistisches Regierungsprogramm zu verabschieden, dessen Umsetzung einerseits die Lebensbedingungen in Thüringen verbessert und andererseits aufzeigt, dass sich DIE LINKE von allen anderen Parteien unterscheidet. Dieses Programm kann nicht im Bündnis mit bürgerlichen Parteien umgesetzt werden, sondern nur im Bündnis mit der arbeitenden und erwerbslosen Bevölkerung und den Gewerkschaften und sozialen Bewegungen.

Da laut Landesrecht der jetzige Ministerpräsident im Amt bleibt, solange keine neue Regierung gebildet ist, sollte DIE LINKE jetzt die Chance nutzen, als Minderheitsregierung Maßnahmen zur Abstimmung zu stellen wie zum Beispiel: Einführung eines kostenlosen ÖPNV und massiver Ausbau des Schienenverkehrs in Stadt und Land; Beschlagnahmung von spekulativem leerstehendem Wohnraum, Enteignung von Immobilienkonzernen unter demokratischer Kontrolle und Verwaltung, Mietsenkung und Deckelung der Mieten auf Kostenmiete, Bau von kommunalen Wohnungen; Einführung der 35-Stundenwoche bei vollem Lohn- und Personalausgleich im öffentlichen Dienst als Einstieg in weitere Arbeitszeitverkürzung; Rekommunalisierung und massiver Stellenaufbau in Krankenhäusern, Verkehrsbetrieben sowie allen Bereichen der Daseinsvorsorge unter demokratischer Kontrolle und Verwaltung durch demokratisch gewählte Räte von Beschäftigten, Nutzer*innen, Gewerkschaften und Landesvertreter*innen; Unternehmen, die mit Entlassungen oder Kürzungen drohen, in Landeseigentum unter demokratischer Kontrolle und Verwaltung zu überführen; das Nutzen aller Möglichkeiten von Besteuerung der Reichen und Gewinne durch das Land und die Kommunen; massive Investitionen in Infrastruktur und Soziales; Abschaffung aller Gebühren und Kosten im Bildungswesen, Aufsetzen eines Programms zur vollständigen Deckung offener Stellen in den Schulen, Auflösung des Landesamtes für Verfassungsschutz und Einsetzung eines unabhängigen NSU-Untersuchungsausschusses unter Beteiligung von antirassistischen Organisationen, Migrant*innenverbänden und Gewerkschaften.

Für die Durchsetzung und Verteidigung dieser Maßnahmen muss DIE LINKE die arbeitende und erwerbslose Bevölkerung demokratisch einbeziehen. Dazu sollte eine Informationskampagne einschließlich Massenversammlungen durchgeführt werden, die die Basis für Demonstrationen und Streiks in Thüringen und bundesweit sein können. Es darf der LINKEN dabei nicht um Stellvertreter*innenpolitik gehen: Alle diese Maßnahmen aus dem Parlament heraus müssen zu einer Selbstermächtigung derer führen, die vom Kapitalismus ausgestoßen und erniedrigt sind. Die Enteignung der großen Mehrheit der Menschen muss beendet werden – dazu bedarf es der Rückaneignung von dem, was den Menschen unter dem Stichwort „Sachzwänge“ Jahrzehnte lang genommen wurde: Geld, Perspektiven, Würde, Gerechtigkeit. Eine Politik im Sinne dieser Rückaneignung würde auch die Erfolge der AfD unter Arbeiter*innen und Jugendlichen untergraben, welche diese mit rechtspopulistischer Politik, Rassismus und Nationalismus in die Irre führt. Ein solches Programm könnte der LINKEN bundesweit Unterstützung bei denjenigen sichern, die nach einer Alternative Ausschau halten. So wäre garantiert, dass dieser Wahlerfolg keine Eintagsfliege, sondern einen Schritt auf dem Weg der LINKEN zu einer sozialistischen Massenpartei markiert.

akl - Antikapitalistische Linke

————————————————————————–

Grafikquelle         :            –Blogsport

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | 3 Kommentare »

Alkoholverbot an Bahnhöfen

Erstellt von DL-Redaktion am 15. November 2019

Zweifel an Wirksamkeit eines Alkoholverbots am Bahnhof

Ravensburg Bahnhof 2011.jpg

Von Ben Heisch

In der Diskussion über ein Alkoholverbot am Ravensburger Bahnhof häufen sich Beschwerden der Passanten bei der Stadtverwaltung. Auch die Polizei berichtet immer wieder von Konflikten der Betrunkenen und Drogenkonsumenten. SZ-Mitarbeiter Ben Heisch hat sich am Bahnhof bei Passanten umgehört. Zwar sprechen sich viele Bahnreisende für ein Alkoholverbot am Bahnhof aus, bezweifeln aber, dass ein Verbot durchzusetzen wäre.

Ein älteres Ehepaar, das für eine Zugfahrt an den Ravensburger Bahnhof gekommen ist, findet es in Ordnung, Alkohol am Bahnhof zu trinken – solange die Trinker niemanden stören. Außerdem waren sich die Ehepartner einig, dass die Idee, mutmaßlich alkoholabhängigen Menschen das Trinken in der Öffentlichkeit zu verbieten, nicht umsetzbar wäre.

Junge Frau stört sich abends an Betrunkenen

Quelle     :       schwäbische-Ravensbur           >>>>>         weiterlesen

Zu Obigen Artikel erhielten wir folgende Zuschrift

Kommentar von Stefan Weinert zum Bericht der „Schwäbischen“ :

da muss ich doch erst einmal an die Diskussion um ein mögliches Verbot von alkoholischen Getränken an der „blauen Tanke“ (Südstadt) nach 22 Uhr erinnern … Daraus wurde nichts. Wie hat sich die Situation da eigentlich entwickelt? Bitte liebe SZ, berichte mal. – 

Was den Bahnhof anbetrifft, bin ich wohl immer zur falschen Zeit mit der BOB nach FN gefahren. Habe nie irgendwelche Promille-Sünder gesehen … aber selbst wenn: Ein Verbot verlagert das Problem lediglich, löst es aber nicht. (Alte Stadtindianer-Weisheit) Eine andere Weisheit besagt: Was Akademiker, Stadträte, Großkopferte und Honorige und andere Krawattenhalter hinter verschlossenen Türen und opaken, getönten Scheiben saufen, tun die „Penner“ und „Nichtsnutze“ öffentlich. Und das weiß auch (fast) jeder. Abgesehen natürlich vom „Rutenfest“, wo das „öffentliche Besäufnis für alle“ von oben abgesegnet ist und diese Tradition dem „Narrensamen“ mit der Muttermilch eingeflößt wird. 

Das alles ist eine ziemliche Heuchelei. Ein „Nichtsnutz“ kann sich nun mal ein Kneipenbier (die Halbe für 3,30 €; auch in der „Räuberhöhle“) und einen Schnaps (2 cl = 2,50 €) nicht leisten. Für den Preis (plus Trinkgeld) bekommt er im Supermarkt eine ganze Kiste „Oettinger“ oder 1 Liter Wodka. Und da nun auch mal der „Nichtsnutz“ ein soziales Wesen ist (!!), sucht er sich seine „Kneipe“, wo er nicht alleine ist und alleine trinken muss. Erfährt man alles, wenn man sich mit den „Pennern“ auf  Augenhöhe unterhält.#

Ravensburg Rutenfest 2005 Festzug Burg Ravensburg.jpg

Die verlorene Ehre des  Landraubenden Adel wurde doch lange von  Hochstapelnden Politikern – Innen übernommen !

Bereits vor 15 Jahren schrieb ich in einem Leserbrief zum Thema „Säufer am Grünen Turm“, dass jene, die wir gerne „Penner“ nennen, das Spiegelbild unserer angeblich „heilen“ Gesellschaft sind. Weder Streetworker noch das Verbot helfen wirklich, sondern die Veränderung der Gesellschaft insgesamt ist die beste und auch kostengünstigste Lösung. Dazu gehört an erster Stelle, endlich damit aufzuhören, pharisäerhaft auf die öffentlichen Trinker einzuschlagen. Denn wer mit einem Finger auf den „Sünder zeigt“, zeigt gleichzeitig mit den restlichen Fingern auf sich selbst. Und welche die nächsten Schritte sein sollten/könnten … dürfte jedem klar sein.

Ach ja – als Theologe erlaube ich mir, einen der wichtigsten Sätze aus der Bibel in den Kontext der Moderne und in das Ravensburg im 21. Jahrhundert  zu übertragen: WER VON EUCH OHNE BIER IST, DER WERFE DIE ERSTE FLASCHE. Blasphemie? Mitnichten! Bevor Jesus auf der berühmt gewordenen Hochzeit zu Kana 600 Liter (!) Quellwasser in den besten Wein verwandelte, waren die Hochzeitsgäste bereits „trunken“ (nachzulesen in Johannes Kapitel 2 ab Vers 1 und folgende). Selbst wenn diese Geschichte nur eine symbolische Geschichte a la Bultmann sein sollte – wer wir sie heute wohl wie interpretieren ..?

MfG, Stefan Weinert, Ravensburg

——————————————————————

Grafikquellen        :

Oben       —      Ravensburg, Bahnhof (westliche Seite)

 

 

Abgelegt unter Baden-Württemberg, Feuilleton, Kultur, Überregional | Keine Kommentare »

Thüringer Regierung

Erstellt von DL-Redaktion am 15. November 2019

Thüringen – Minderheitsregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–09.jpg

Von Tom Strohschneider

Minderheitsregierung, das klingt erst mal doof. Dabei bietet sie viele Chancen.

Vor ein paar Tagen sorgte eine Meldung auf Twitter für Aufsehen: „CDU führte konkrete Gespräche mit der AfD“, so die Schlagzeile. Und das, so las man weiter, obwohl CDU-Fraktionschef Mike Mohring „zuvor jede Kooperation ausgeschlossen hatte“. Passiert da etwas Heimliches, Ungeheuerliches hinter den Kulissen der Erfurter Nachwahlpolitik? Eine Kooperation mit den Rechtsradikalen gegen Rot-Rot-Grün? Einige Politiker und Journalisten verbreiteten die irritierende Kunde weiter. Bis es jemandem auffiel: Die Meldung ist von 2014. Ein Kollege schrieb: „Geschichte wiederholt sich hoffentlich nicht.“

Was hätte sein können

Es gibt das berühmte Diktum von Karl Marx, dass so etwas eben doch passiert, „das eine Mal als Tragödie, das andere Mal als Farce“. Aber was, wenn es nach der Landtagswahl anders gekommen wäre, nur ein kleines bisschen anders, aber mit großen Wirkungen?

Vielleicht so: Es ist der 28. Oktober 2019, Mike Mohring macht sich am frühen Montagmorgen auf den Weg ins Fernsehstudio, eine schwere CDU-Klatsche im Nacken, unklare Mehrheitsverhältnisse, die Frage einer Kooperation mit der Linkspartei liegt wie ein zwei Tonnen schwerer Stein auf dem Tisch, man kann ihn nicht mal eben mit dem Handrücken wegfegen. „Die CDU in Thüringen ist bereit für Verantwortung, wie auch immer die aussehen kann und sollte“, sagt Mohring. „Deswegen muss man bereit sein, nach diesem Wahlergebnis auch Gespräche zu führen. Ohne was auszuschließen.“ Im Übrigen liege die Hoheit für den weiteren Erfurter Weg „alleine in Thüringen“.

Danach fährt Mohring in die CDU-Bundeszentrale, die Gremien tagen, zerknirschte Gesichter ob des Wahlausgangs – aber der Geist von Altmeister Bernhard Vogel ist in allen Köpfen: Man könne sich doch „Gesprächen nicht versagen“, keine Koalition mit der Linkspartei, das ist klar, aber daneben geht ja auch was. Auch die Thüringer Wirtschaft sieht das so: „Neue Situationen erfordern neue Maßnahmen“, heißt es vom Unternehmensverband. In der CDU-Bundeszentrale stimmt man zu, es wird eine Sprachregelung gesucht, Mohring bekommt sein Mandat. Nur eines nicht: irgendwelche Offenheit zur AfD zeigen. Und Mohring weiß auch: Selbst wenn er so denken würde, sollte er in dieser Runde nie und nimmer Sätze sagen wie: „Ramelow ist inhaltlich leer. Und wir werden als Union alles mit ihm machen können.“

Denn natürlich haben auch die Gegner der „neuen Maßnahmen“ Ohren, SMS-fähige Telefone und sie wissen, an wen sie sich wenden müssen. In der Bild-Zeitung wetzen sie ohnehin schon die Tastaturen, ein Gespräch mit Mohring wird als „Verhör“ verkauft, die alte Leier: Eine Zusammenarbeit mit der Linkspartei sei Verrat der CDU an einem „ihrer letzten heiligen Werte“, der „Markenkern der Partei der Wiedervereinigung“ sei bedroht. Doch Mohring bleibt aufrecht, die CDU bleibt es fast ausnahmslos auch, keine Heckenschützen, kein verbales Störfeuer.

Eine neue Situation erfordert auch neues Verhalten. Hier wird es geliefert. Zumal alle wissen: Wer jetzt gegen Gespräche mit der Linkspartei auftritt, macht jene lauten Minderheiten stark, die am liebsten über die Brandmauer zur AfD hinüberklettern wollten. Ortsfunktionäre aus der vierten Reihe. Ein paar Anhänger der Werte-Union, die von der Frankfurter Allgemeinen Zeitung als „eine kleine Gruppe am rechten Rand der CDU“ beschrieben wird. Auch ein früherer Verfassungsschutzpräsident treibt dort gern sein Wesen.

Aber die CDU im ganzen bleibt stabil. Der Generalsekretär der CDU wehrt einen Vorstoß von der Vorgestern-Fraktion ab, die ihn zu einem Gastbeitrag gegen die Linkspartei drängen wollen. Stattdessen gibt Paul Ziemiak einen Text heraus, in dem er CDU und AfD „wie Feuer und Wasser“ nennt, eine Zusammenarbeit wäre „Verrat an der Christdemokratie“. Mohring sieht sich bestätigt und unterstützt, er nimmt das vertrauliche Angebot von Bodo Ramelow ganz vertraulich an. SMS werden ausgetauscht, aber nicht weitererzählt. Es wird jetzt eine Weile dauern, das wissen alle Beteiligten. Und es wird kompliziert. Der Erfurter Weg ist eine ziemlich steinige und steile Straße.

Mohring wird tags darauf natürlich auf seine Kanäle zu Ramelow angesprochen. Er reißt sich am Riemen: „Private Kommunikation ist aus gutem Grund vertraulich.“ Als sich der Moderator einer Talkshow später nachfragend an ihn heranlanzt, lächelt der CDU-Politiker bloß. Er denkt an das Bild-Interview, Schweigen ist in dieser Situation eine „Frage des Anstands“.

2019-10-27 Wahlabend Thüringen by Sandro Halank–83.jpg

Apropos Anstand, dass das Blatt das Gespräch zum „Verhör“ erklärt hat, wurmt Mohring. Ein Bonmot von Max Goldt kommt ihm in den Sinn: „Diese Zeitung ist ein Organ der Niedertracht.“ Auch dagegen muss man nun aufrecht bleiben. Drei Tage ist die Wahl erst her, der junge CDU-Fraktionschef blickt in eine ungewisse aber auch spannende Zukunft. Ja, eine neue Situation ist das. Thüringen, die politische Landschaft, CDU und Linkspartei – er erinnert sich an den Morgan am Tag nach der Wahl, an seine Worte: „Ruhe und Besonnenheit“.

Was wirklich war

Hätte, hätte, Fahrradkette – die ersten drei Tage nach der Wahl sind in Wahrheit anders verlaufen. Die Lage ist dadurch nicht einfacher geworden, sondern komplizierter. Mike Mohring hat daran großen Anteil, taktisch unsicher, strategisch unvorbereitet, machtpolitisch ungeschickt. Hat er mit dieser Lage etwa nicht gerechnet? In der Talkshow, in der er in Wahrheit auch die Vertraulichkeit Ramelows herumplappernd brach, sagt Mohring: Es sei ein Wahlergebnis „mit dem man nicht rechnen konnte. Vielleicht wollte ich auch nicht damit rechnen.“ Markus Lanz darauf: „Aber damit musste man doch rechnen.“ Mohring: „Klar, konnte man.“

Konnte? Und doch lässt sich die verfahrene Kiste nicht allein auf Mohring schieben. Sein Versuch, unmittelbar nach der Wahl die Tür zur Linken entgegen vorheriger Absagen ein kleines bisschen offenzuhalten, ist vor allem von Politikern der Union vereitelt worden, die Thüringen nur zum Spielball ihrer eigenen Machtlogiken gemacht haben.

Die Mohring-Debatte in der CDU war nicht zuletzt eine um den Kopf der Vorsitzenden Annegret Kramp-Karrenbauer und gegen den Einfluss Angela Merkels. Nicht wenige haben nach dem Motto „Mohring schlagen, AKK und Merkel treffen“ agiert und dabei, man musste das ahnen können, jene angefeuert, die tatsächlich mit Rechtsradikalen reden wollen. Wie ein ausgerollter brauner Teppich für die, die glauben, man müsse die CDU noch weiter nach rechts abbiegen lassen.

Quelle         :     Der Freitag          >>>>>         weiterlesen

——————————————————————-

Grafikquellen              :

Oben       —           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Oskars letzter Versuch ?

Erstellt von DL-Redaktion am 13. November 2019

Ganz, ganz viel zu tun

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Von Anna Lehmann

Amira Mohamed Ali wird Nachfolgerin von Sahra Wagenknecht. Das Erbe wird schwer. Denn die Fraktion ist nach der Wahl gespaltener denn je.

Es gab da dieses Bild, kurz nachdem Amira Mohamed Ali am Dienstagnachmittag gegen halb vier zur Fraktionschefin der Linken gewählt worden war. Sie stand im Clara-Zetkin-Saal der Linksfraktion im Reichstagsgebäude, umringt von zwei Herren: zum einen Co-Fraktionschef Dietmar Bartsch und zum anderen Diether Dehm, einst Vorsitzender ihres niedersächsischen Landesverbandes und bis heute einflussreicher Strippenzieher in der Partei. Mohamed Ali lächelte in eine Kamera, Dehm und Bartsch neben ihr reckten die Fäuste. Gewonnen!

Die Szene war eigentlich nicht für die Öffentlichkeit bestimmt, der Fraktionssprecher scheuchte Neugierige schnell wieder aus dem Saal. Diether Dehm veröffentlichte es dennoch auf Facebook. Danach gingen Mohamed Ali und Bartsch aus dem Raum und vor die Presse und sie stand im Rampenlicht. Das erste Mal so richtig, seitdem sie vor zwei Jahren in den Bundestag eingezogen war.

2017 war Mohamed Ali auf Platz 5 der niedersächsischen Landesliste und als fünfte Niedersächsin für die Linke gerade noch in den Bundestag gerutscht. Zwei Jahre später ist sie Fraktionschefin, Nachfolgerin der bekanntesten Linken-Politikerin Sahra Wagenknecht. Eine Traumkarriere als Politikerin. Oder doch eher ein Knochenjob als Trümmerfrau?

Wie tief die Fraktion nach dieser knappen Wahl mit zwei Wahlgängen gespalten ist, zeigte sich im weiteren Verlauf des Nachmittags. Caren Lay, die ihre Kandidatur für den Fraktionsvorsitz als Erste angekündigt hatte, hätte als erfahrenere und bekanntere Kandidatin eigentlich die besseren Karten haben müssen. Die Vizefraktionvorsitzende und mietenpolitische Sprecherin sitzt seit 2009 im Bundestag.

Der Frust entlädt sich

Mohamed Ali ist nun mit Unterstützung des sogenannten Hufeisens ins Amt gekommen, jenes machttaktischen Bündnisses aus Reformern und Partei-Linken, das vier Jahre lang eine knappe Fraktionsmehrheit gesichert hatte. Doch der Groll gegen diese Machtbündnis war in den letzten Jahren gewachsen. Nun bekamen die übrigen Kandidat:innen für den Fraktionsvorstand den geballten Frust über diesen knappen Wahlsieg und das Wirken des Hufeisens zu spüren.

Sahra Wagenknecht and Dietmar Bartsch. Hannover Parteitag 2017.jpg

Vom Winde verweht

Der erste parlamentarische Geschäftsführer Jan Korte erhielt nur 39 von 68 möglichen Ja-Stimmen. Und das, obwohl er im Bundestag souverän auftritt und ohne Gegenkandidat:in angetreten war. Von den sechs potenziellen Arbeitskreisleiter:innen, die sich auf sechs Stellen bewarben, fielen zwei im ersten Wahlgang durch, Fabio de Masi und Heike Hänsel. De Masi wurde im zweiten Anlauf gewählt, Hänsel fiel erneut durch. Bartsch wird drei Kreuze gemacht haben, dass er mit 64 Prozent in einem Rutsch zusammen mit Mohamed Ali gewählt wurde. In einem anderen Wahlprozedere wäre er wohl genauso abgestraft worden.

Quelle          :         TAZ         >>>>>          weiterlesen

Neue Fraktionsspitze der Linken

Der Verfeindungskomplex

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Kommentar von Stefan Reinecke

Politische und persönliche Fehden sind in der Linksfraktion eng verwoben. Genau das kann für die unverbrauchte Mohamed Ali eine Chance sein.

Amira Mohamed Ali, Muslimin und Juristin aus Hamburg, wird zusammen mit Dietmar Bartsch die Linksfraktion führen. Das ist eine erstaunliche Umkehrung des Prinzips demokratischer Elitenauswahl. Eigentlich wird an die Spitze gewählt, wer sich als besonders robust, vertrauenswürdig oder taktisch versiert erwiesen hat. Mohamed Ali ist eine sympathische, eher nachdenkliche denn agitatorische Parteilinke. Doch sie ist erst seit vier Jahren in der Partei und nicht nur in der Öffentlichkeit ein unbeschriebenes Blatt.

Auch in der Fraktion kann sich niemand an wegweisende Beiträge erinnern. Manche behaupten, sie solle Wagenknecht bloß den Sessel warm halten, bis die wieder Lust hat auf den Job. Gewissermaßen das Modell Putin/Medwedjew. Das ist eines jener bösartigen Gerüchte, die ziemlich typisch sind für die giftige Atmosphäre bei den GenossInnen. Die Wahrheit ist: Der linke Flügel hat schlicht niemand anderen gefunden.

Ein Sieg des Bündnisses von Reformern und linkem Flügel, von Bartsch und Wagenknecht gegen Caren Lay und Katja Kipping also? So sieht es aus. Aber die Sache ist komplexer. Die Grenzen zwischen den drei Lagern sind ausgefranst und überlagert von persönlichen Animositäten.

Quelle         :         TAZ         >>>>>          weiterlesen

——————————————————————-

Grafikquellen           :

Oben      —      Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Hamburg, P. DIE LINKE, Überregional | Keine Kommentare »

Rennen um SPD-Vorsitz

Erstellt von DL-Redaktion am 12. November 2019

Denkt nach, Genossen!

File:Olaf Scholz, August 2009-1 - by SPD-Schleswig-Holstein.jpg

Ex – Bürgermeister oder Politiker ?

Von Pascal Beucker

Wenn die SPD noch eine Chance haben will, muss sich die Basis dem Parteiestablishment widersetzen und für Walter-Borjans und Esken stimmen.

Für das Parteiestablishment ist es offenkundig keine Frage, wem es in der zweiten Runde des großen SPD-Vorsitzendencastings die Stimme geben wird. Wer auch immer sich aus diesem Kreis in den vergangenen Tagen berufen fühlte, ein Votum zugunsten eines der beiden zur Wahl stehenden Duos abzugeben, stets fiel es zugunsten von Olaf Scholz und Klara Geywitz aus. Besser lässt sich ein Realitätsverlust kaum dokumentieren. Wenn die SPD noch eine Perspektive haben soll, wird die Parteibasis dem Werben ihrer Oberen widerstehen müssen. Daran ändert auch der theaterreif inszenierte und perfekt getimte Grundrente-Kompromiss nichts.

Die SPD-Mitglieder sollten selbstbewusst genug sein, sich nicht davon beeindrucken lassen, dass die veröffentlichte Meinung mehrheitlich ganz unverhohlen für den 61-jährigen Bundesfinanzminister aus Hamburg und die 43 Jahre alte Ex-Landtagsabgeordnete aus Potsdam trommelt. Wobei Letztere nicht ausschlaggebend für ihre Präferenz ist: Es geht um Scholz als vermeintlichen Stabilitätsgaranten. Eine vergiftete Empfehlung: So wie Medien, allen voran der Spiegel, Scholz gerade promoten, genauso schrieben sie einst auch Steinmeier, Steinbrück und Schulz in die Kanzlerkandidatur – um sie dann kurz vor der Wahl mit der gleichen Verve fallen zu lassen.

In was für einer Situation befindet sich die SPD? Bundesweit erreicht sie in den aktuellen Umfragen Zustimmungswerte zwischen 13 und 16 Prozent. Vom Wahlsieg Gerhard Schröders 1998 bis zur Schlappe von Martin Schulz 2017 hat die Partei mehr als 10,6 Millionen Wähler verloren. Seitdem hat sie nur noch eine einzige Landtagswahl ohne Einbruch in der Wählergunst überstanden. Das war die Wahl in Niedersachsen, in jener kurzen Zwischenperiode, in der die SPD-Führung großmäulig tönte, unter keinen Umständen die Koalition mit der Union fortzusetzen. Seit auch das Geschichte ist, ist es weiter bergab gegangen. In Bayern und Hessen im vergangenen Jahr sowie bei der Europawahl im Mai musste die SPD sogar zweistellige Verluste hinnehmen.

File:2013-09-22 Bundestagswahl 2013 Wahlparty SPD 11.jpg

Eine kleine Auswahl Geisterbahn fahrender SPD Mitglieder

Das Ausmaß des Niedergangs ist dramatisch. Die Partei sitzt mittlerweile in drei Bundesländern nur noch mit einem Wählerstimmenanteil von weniger als 10 Prozent im Parlament, in zwei weiteren liegt sie gerade mal knapp über der 10-Prozent-Marke.

Für die SPD gibt es noch Luft nach unten

Niemand sollte darauf wetten, dass die Talfahrt der SPD schon an ihr Ende gekommen ist. In früheren Zeiten wurde sie noch mit einem – schwer beweglichen – Tanker verglichen, heutzutage scheint der Vergleich mit der „Titanic“ passender: Das Schiff ist am Sinken, aber das Bordorchester spielt unverdrossen in der Erste-Klasse-Lounge weiter. Die Beispiele ihrer Schwesterparteien in Frankreich, Griechenland oder den Niederlanden zeigen: Für die SPD gibt es nicht nur Luft nach oben, sondern auch noch nach unten. Die Krise der Sozialdemokratie ist wesentlich existenzieller als jene Ende der siebziger bis Mitte der achtziger Jahre, die damals den liberalen Vordenker Ralf Dahrendorf dazu verleitete, etwas voreilig das Ende des sozialdemokratischen Zeitalters auszurufen. Jetzt könnte es wirklich so weit sein.

Quelle         :           TAZ           >>>>>          weiterlesen

——————————————————————–

Grafikquellen      :

Oben        —         Olaf Scholz bei einer Wahlkampfveranstaltung der Bundestagsabgeordneten Bettina Hagedorn in Kellenhusen.

Author SPD Schleswig-Holstein      /      Source  —     IMG_3928
This file is licensed under the Creative Commons Attribution 2.0 Generic license.

————————–

Unten         —

Description
Deutsch: Wahlparty der Bundes-SPD zur Bundestagswahl 2013.
English: The federal election party SPD for the parliamentary election in 2013
Date
Source Own work
Author Jonas Rogowski

———————————————————–

Abgelegt unter Feuilleton, HARTZ IV, P.SPD, Überregional | Keine Kommentare »

Die Linke Niedersachsen

Erstellt von DL-Redaktion am 12. November 2019

Die Causa Perli…   Potemkin

Landtag Niedersachsen DSCF7719.JPG

Quelle      :   Potemkin

Von    jpsb

Zu den geliebten Aufgaben eines Blogs wie Potemkin gehört es Meinungen und Standpunkte in den politischen Prozess des linken Politbetriebes einzupflegen. Dabei kann es dazu kommen, dass Adressaten von Kritik sich als Opfer von Angriffen oder gar Kampagnen wähnen. Schnell ist dann von Mobbing und Hetze die Rede. All das dient nur einer einzigen Strategie: Den Inhalten von Textbeiträgen ihrer Stoßrichtung zu berauben, jeder Debatte eine rein persönliche Note zu geben und sich schlussendlich der Verantwortung für eine mitgliederöffentliche Klärung von ungelösten Machtfragen zu entziehen.

Denn der letzte Blogbeitrag auf Potemkin hat im Landesverband Niedersachsen eine Kontroverse darüber ausgelöst, welche Kritik an Mandatsträgern, namentlich dem Bundestagsabgeordneten Victor Perli,  erlaubt sein soll und welche nicht. Unlängst wurde das Thema sogar im Landesvorstand behandelt. Natürlich hinter dem Rücken derjenigen, die für eine Verrohung der parteiinternen Umgangsformen verantwortlich gemacht werden.

Eine Verrohung der Umgangsformen? Bei den Linken? Dies klingt wie ein Treppenwitz der Geschichte. Denn in der öffentlichen Meinung ist längst und völlig zu Recht eingepreist, das Links der Mitte immer mit ganz besonders harten Bandagen Machtkämpfe ausgefochten werden. Die Partei war, ist und wird immer ein Ort bis aufs Messer geführter Diadochenkriege sein. Ein Landesvorstand der da eine andere Erzählung zum Besten geben will ist per se handlungsunfähig, da er die Realitäten im eigenen Verband schlichtweg nicht zur Kenntnis nehmen will.

Auch Perlis Aufstieg folgt den Mustern einer Mobilisierung gegen Andere. Auf der letzten Listenaufstellung forderte er erfolglos auf Platz 2 der Landesliste den niedersächsischen Abgeordneten Dehm heraus und hoffte dabei, nach Einschätzung etlicher Beobachter der Aufstellungsversammlung,  auf die Unterstützung des damaligen Abgeordneten Herbert Behrens. Als der Angriff auf Dehm misslang, wendete er sich umgehend gegen Behrens selbst und beerbte dessen Bundestagsmandat. Wer zielstrebiges Personal wie Perli unterschätzt, kann auch bei den offensichtlichsten Manövern schnell ins Hintertreffen geraten. Eine Lektion, die für Behrens zu spät kam.

Perli verkauft sich dabei gerne als eine Mischung aus junger Hoffnung und Schwiegersohnsliebling. Die von ihm versprochene Modernsierung des Landesverbands oder gar eine stärkere Profilierung in Strategiefragen blieb aus. Perli ist ein höchstens mittelmäßiger Redner, hat keinerlei Netzwerksarbeit im Bundestag vorzuweisen und in den von ihm bearbeiten Themen ist nicht die Spur von Erneuerung erkennbar. Der Genosse ist ein klassischer Hinterbänkler, der aber im Landesverband Niedersachsen ein Gespür für Machtpolitik entwickelt hat.

Dazu gehört auch die Beherrschung  finanziell wichtiger Aggregate eigener Machtpolitik. Zum Beispiel des Rosa-Luxemburg-Bildungswerkes in Niedersachsen, dessen erster Vorsitzender er ist. An sich unscheinbar, wird diese Institution durch Steuergelder finanziert und kann somit über die Vergabe von Bildungsaufträgen und die Organisation politischer Veranstaltung auch zu internen Machtzwecken mit Wirkung auf den Parteiapparat eingesetzt werden. Da im Bildungswerk auch Arbeitsplätze eingerichtet wurden, ist es Teil der internen Humanressourcen mit Wirkung auf den Landesverband der Partei.

2019-04-11 Diether Dehm MdB by Olaf Kosinsky-9591.jpg

Gebrauchte er nicht früher die Hände zum halten der Flöte, wenn er musizierend durch Hameln lief?

Wie dann durch die Hintertür politische Fakten geschaffen werden, zeigt eine Posse aus dem abgelaufenen Wahlkampf zum Amt der OberbürgermeisterIn in Hannover. Dort hatte eine im Kreisverband Hannover völlig isolierte Gruppe um die ehemalige linke Stadträtin Helga Nowak, eine Gegenkandidatin zur Nominierung des eigenen Kreisverbandes aktiv im Wahlkampf unterstützt. Dass Ergebnis war eine Kanibalisierung der Stimmen im linken Lager und ein schlechtes Wahlergebnis sowohl für die Gegenkandidatin Kaczmarek, als auch für die Kandidatin der Linken Jessica Kaußen

Quelle         :           Potemkin            >>>>>           weiterlesen

————————————————————-

Grafikquellen         :

Oben      —           Victor Perli, Landtagsabgeordneter Niedersachsen, 16. Wahlperiode (Fotoprojekt Landtagsabgeordnete Niedersachsen am 24. und 25. November 2009)

————————————

Unten         —          Diether Dehm, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Bundestag, Niedersachsen, P. DIE LINKE, Überregional | 2 Kommentare »

Linker Krieg oder Frieden

Erstellt von DL-Redaktion am 11. November 2019

Die Linke vor der Wahl:

Wagenknecht, Sahra, 2013.JPG

Sekt oder Selters ?

Aus Berlin Anna Lehmann

Am Dienstag wählt die Fraktion eine Nachfolgerin für die scheidende Fraktionschefin Sahra Wagenknecht. Doch es geht um mehr: Gelingt der zerstrittenen Fraktion ein Aufbruch?

Sahra Wagenknecht geht es anscheinend gerade richtig gut. Die Fraktionschefin wirke entspannt und gut gelaunt, berichten Abgeordnete. Als die Linksfraktion am vergangenen Dienstag über den Klimaaktionsplan stritt und sich die Sprit-Junkies und die Auto-Hasser in der Fraktion gegenseitig Ignoranz vorwarfen, habe Wagenknecht vermittelt: Es sei doch klar, dass man die Akzeptanz des Klimaschutz stärken müsse, auch bei denen, die nicht bei Fridays for Future mitmarschierten.

Wagenknecht hat, so scheint’s, endlich in ihre Rolle als Fraktionsvorsitzende gefunden. Und das in den Tagen ihres Abgangs. Am Dienstag wird die Fraktion Wagenknecht nach vier Jahren an der Spitze als Fraktionschefin verabschieden. Bereits im März hatte sie angekündigt, dass sie den Posten abgeben wird, wegen Stress und Überlastung.

Es zog sich länger als geplant, Wagenknecht absolvierte noch pflichtgemäß Wahlkampftermine für die Europawahl sowie in Sachsen, Brandenburg und Thüringen. Bis zu dieser letzten Wahl hatte sich die Partei strikte innerparteiliche Ruhe verordnet.

Ab Dienstag darf Wagenknecht endlich wieder einfaches Fraktionsmitglied sein und die Linke wählt eine neue Fraktionsspitze.

Es geht um viel, um viel mehr als die Nachfolge der populären und polarisierenden Spitzenfrau. Die Neuwahl ihres Führungspersonals wird für die Linke auch zu einer Bewährungsprobe: Versinkt die Fraktion erneut im Machtkampf der verfeindeten Lager – grob umrissen in die Truppen um Parteichefin Katja Kipping und die Getreuen von Sahra Wagenknecht und Dietmar Bartsch. Oder nehmen die Linken nach zwei zerstrittenen Jahren und drei verlorenen Wahlen den kleinen Aufschwung der Thüringer Landtagswahl mit und zeigen, dass sie interne Auseinandersetzungen solidarisch und zivilisiert klären können. In Thüringen ist die Linke Ende Oktober erstmals in ihrer Geschichte stärkste Partei geworden. Das Grundrezept: ein überaus beliebter Ministerpräsident und eine Partei, die geschlossen hinter ihm stand.

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–103.jpg

Leicht wird es nicht, diesen Schwung mitzunehmen. Wagenknecht hinterlässt eine zerrüttete Fraktion. Sie ließ kaum eine Gelegenheit aus, die Migrationspolitik der Partei und den Kurs der Parteiführung öffentlich in Frage zu stellen. Innerparteiliche Diskussionen mied sie, lieber gründete sie die Sammlungsbewegung „Aufstehen“, die Menschen zusammenbringen und den etablierten Parteien Druck machen sollte. Das scheiterte.

Die Parteivorsitzenden Kipping und Bernd Riexinger wiederum ließen sich auf einen Dauerstreit mit Wagenknecht und ihren Fans ein und damit zu, dass die Linke sich öffentlich zerlegte. Eine Fortsetzung dieses Dramas ist nicht ganz ausgeschlossen.

Leicht wird es nicht: Sahra Wagenknecht hinterlässt eine zerrüttete Linksfraktion

Zwei Frauen haben ihre Kandidatur für den weiblichen Part der Doppelspitze angekündigt: Caren Lay und Amira Mohamed Ali. Lay, die Vizefraktionsvorsitzende und mietenpolitische Sprecherin ist, stammt aus Rheinland-Pfalz, ihr Wahlkreis aber ist seit Langem Bautzen in Sachsen. Sie zählte mal zur „Jugendbrigade“ um Katja Kipping. Vielen gilt sie wegen ihrer Nähe zur Parteichefin als Teil des Konflikts. Lay bemüht sich jedoch gerade um Distanz zu Kipping und betont gern, dass sie sich nicht als deren Anhängsel verstehe.

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Mohamed Ali ist in Hamburg geboren und lebt seit vielen Jahren in Oldenburg. Sie arbeitete als Rechtsanwältin, bevor sie vor zwei Jahren über die niedersächsische Landesliste in den Bundestag einzog. Als verbraucherpolitische Sprecherin hielt sie dort engagierte Reden für die Kennzeichnung von Nahrungsmitteln und gegen falsche Subventionen an Landwirte, denen allerdings nicht mal ihre eigene Fraktion vollzählig beiwohnte. Mohamed Ali soll von Diether Dehm, der Wagenknecht verehrt und Kipping verteufelt, zur Kandidatur überredet worden sein.

Quelle          TAZ          >>>>>           weiterlesen

——————————————————————

Grafikquellen           :

Oben     —         Sahra Wagenknecht während einer Wahlkampfveranstaltung zur Bundestagswahl 2013 auf dem Friedensplatz in Bonn

2.)  von Oben      —             Bundesparteitag Die Linke 2018 in Leipzig

———————————–      — 

Unten         —             Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

Die Falschen Freunde ?

Erstellt von DL-Redaktion am 9. November 2019

Stolz und Einzelkämpfertum

File:Bremen, Loriotplatz, Parkbank mit Sitzfigur nach Loriot (2).jpg

Von Robert Misik

Viel wird über die sogenannten einfachen Leute gesprochen. Wer sind sie und was sind ihre Werte? Eine Spurensuche.

urz nach dem Wahlsieg von Donald Trump schrieb die amerikanische Rechtswissenschaftlerin Joan C. Williams einen großen Essay mit dem Titel „What so many people dont’t get about the U.S. working class“. Lange habe man die Bedrängnisse der Arbeiterklasse igno­riert, nun schleiche sich eine Art gutmenschliche Besorgnis ein. „Diese Haltung“, so Williams später in ihrem Buch „White Working Class“, in das weitere Recherchen und unzählige Zuschriften eingeflossen sind, „wird sie aber noch wütender machen und die ungesunde Klassenspaltung nur vergrößern“.

Williams weiter: „Sie wollen anerkannt werden für die Beiträge, die sie leisten – und für ihre Art zu leben.“ Anders gesagt: Die Arbeiterklasse will eben „nicht wie ein Stamm in einem Land behandelt werden, das weit entfernt ist“.

Von den USA bis ins Ruhrgebiet, von Mittelengland bis zu den Wiener Vorstädten, überall wird derzeit die Frage diskutiert, warum sich die „einfachen Leute“ als Verlierer fühlen und beklagen, keine Stimme mehr zu haben. Wobei es gleich mit der Frage beginnt, wer das denn überhaupt sein mag, diese viel besprochenen „einfachen Leute“.

Das sind einmal, grob gesagt, jene, die im Leben nicht auf die Butterseite gefallen sind – also eher Kleinverdiener, aber nicht nur. Es sind Arbeiter und Arbeiterinnen, bis hin zur Mittelschichts­familie im Einfamilienhaus mit zwei Autos vor der Tür. Leute, die sich als „die Normalen“ ansehen. Oft ist das auch eine stolze Selbstzeichnung. „Da, wo ich lebe, bedeutet ‚einfacher Mensch‘ ‚anständiger Mensch‘, weil bescheidenes (oder weniger bescheidenes) Auskommen mit ehrlicher Arbeit (meist körperlich) erschaffen“ wurde, so beschreibt das eine Frau aus dem österreichischen Mühlviertel.

Die „real existierenden“ Werte der arbeitenden Klassen sind über Jahrhunderte entstanden, hatten ihre Quellen teilweise noch in der vorindustriellen Handwerkskultur, mit ihrem Stolz auf die eigenen Fertigkeiten, den Vorstellungen von einem gerechten Lohn und einem fairen Preis. Hinzu kam ein Gemeinschaftsgeist mit einer starken Trennung in Insider und Outsider. Man kann auch die heutigen Werthaltungen der „populären Klassen“ nicht verstehen, ohne diese Geschichte zu verstehen.

Die alte Arbeiterklasse, so Joan C. Williams, habe einen Stolz gehabt und sie habe sich Anerkennung verschafft – bis sie gewissermaßen als zentrale soziale Schicht angesehen wurde oder sich zumindest so fühlen konnte. Diese Arbeiterklasse habe aber auch bestimmte Werte hochgehalten: den Stolz darauf, harte Arbeit zu leisten; die Vorstellung, dass man niemandem auf der Tasche liegen darf; dass man es mit eigener Tüchtigkeit schafft; dass man mit Handarbeit die Wirtschaft am Laufen hält, dass man zupackt, nicht zu verkopft ist. Dass man einfach „normal“ ist. Zugleich war dieser Stolz sehr verletzlich. Dafür, respektlos behandelt zu werden, hatte man immer ein feines Sensorium. Ein egalitärer Geist prägte die Arbeiterklassenmoral, und wer sich für etwas Besseres hielt, war schnell unten durch. Die Angehörigen der Arbeiterklasse schätzen rigide Selbstdisziplin, weil sie nötig ist, um einen harten Job, den man hasst, vierzig Jahre lang machen zu können.

Weniger solidarisch, als romantisierende linke Intellektuelle gerne glauben würden, ist die Arbeiterklasse mit „den Armen“, also mit jenen, die ihr Einkommen aus staatlichen Sozialtöpfen beziehen, weil sie mit Arbeit nicht über die Runden kommen, weil sie keine Jobs finden oder aus anderen Gründen am Arbeitsmarkt keine Chance haben. Die sieht man schnell als Leute an, die es sich leichtmachen, während man selbst jeden Tag aufstehen und rackern muss, einem nichts geschenkt wird.

Genau das klingt bei Lorraine, einer Gabelstaplerfahrerin, an, die im Zuge einer großen britischen Studie interviewt wurde. Sie ist alleinerziehend, Mutter zweier Buben, wohnt zur Miete, kennt die Stereotypisierungen, denen sie ausgesetzt ist, und sagt: „Ich bin unten, klar.“ Fügt dann aber hinzu: „Ich nenne mich Arbeiterklasse, aber ich glaube nicht, dass ich mich in der gleichen Klasse sehe wie jemand, der sich krallt, was er kann […]. Verstehst du, ich bin stolz auf das, was ich tue, ich stehe jeden Morgen auf […]. Ich kann mir nichts Ärgeres vorstellen, als jeden Tag daheim zu sein und nichts zu tun zu haben. Weißt du, die werden dann fett, oder? Und wundern sich, warum. Aber darf man das überhaupt sagen?“

Die weiße Arbeiterklasse habe das Gefühl, „aus dem Zentrum an den Rand des Bewusstseins ihres Landes gerückt worden zu sein“, formuliert auch der US-Politikwissenschaftler Justin Gest. Viele, so sagt er, fühlten sich außerstande, dagegen irgendetwas zu unternehmen. Gest hat für eine große Studie mehrere Monate erst in einem Arbeiterklassenbezirk in East London und danach eine Zeit in Youngtown, Ohio verbracht, Dutzende lange Gespräche geführt und die Ergebnisse in seinem Buch „The New Minority“ zusammengefasst.

Auch wenn hier bisher provisorisch von der „weißen Arbeiterklasse“ gesprochen wurde, ist dieser Begriff eher behelfsmäßig und unpräzise. Man sollte sich möglichst konkret vor Augen führen, wer eigentlich alles gemeint sein könnte, wenn man heutzutage, im postindustiellen Zeitalter, von Arbeiterklasse spricht

Quelle      :            TAZ            >>>>>        weiterlesen       

———————————————————————

Oben         —          Parkbank mit Skulptur (geschaffen 2016 von Roman Strobl, bemalt von Patrick Przewloka) nach der Titelfigur von „Loriots großer Ratgeber“ am Loriotplatz in Bremen

Author Karl432      / Sourcr    — Own work

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

————————-

Unten        —        Bpb      Bundeszentrale für politische Bildung

Abgelegt unter Kultur, Medien, Mensch, Überregional | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle  streifzuege.org

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.

Keep-it-in-the-ground.jpg

Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.

—————————–

2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.

—————————-

3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.

——————————–

Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

AKL – Thüringen-Wahl:

Erstellt von DL-Redaktion am 7. November 2019

Linke Positionen in Gefahr

2019-10-27 Wahlabend Thüringen by Sandro Halank–54.jpg

Quelle      :     AKL 

Von Steve Hollasky, Dresden

Keine Kooperation mit den bürgerlichen Parteien – für ein sozialistisches Regierungsprogramm!

Drei Dinge zeigen die Landtagswahlen in Thüringen: Dreißig Jahre nach der Revolution gegen die in der DDR herrschende stalinistische Bürokratie befinden sich die bürgerlichen “Volks”parteien SPD und CDU weiterhin in ihrer tiefsten Krise seit 1945; die gesellschaftliche Polarisierung schreitet fort und der Anpassungskurs eines Teils der LINKEN erreicht zu einer Zeit, in der linke Positionen wie zum Beispiel die Forderung nach Enteignung der Immobilienhaie oder kostenlosem öffentlichen Personennahverkehr Zuspruch in größeren Teilen der arbeitenden Bevölkerung bekommen, eine neue Qualität. Und es stellt sich die Frage, was man mit der jetzigen Situation anfangen solle. Die Regierungsbildung gestaltet sich schwierig und in den Führungskreisen der LINKEN wird offen über ein Bündnis oder Kooperation mit der CDU schwadroniert.

Krise der Etablierten

SPD und CDU haben in Thüringen erneut Verluste hinnehmen müssen. Die Sozialdemokrat*innen büßten 4,2 Prozentpunkte ein und stürzten auf ein Thüringer Allzeittief von 8,2 Prozent. Weit dramatischer fielen die Verluste der CDU aus. Mit 11,7 Prozentpunkten minus im Vergleich zu 2014 fiel sie noch hinter der AfD auf Platz drei und landete bei 21,8 Prozent der Stimmen.

Abgestraft wurden bei der Wahl am Sonntag die Regierungsparteien im Bund – und zwar unabhängig davon, ob sie sich in Thüringen aktuell in der Regierung befinden, wie die SPD, oder aber in der Opposition, wie die CDU. Damit setzte sich augenscheinlich der Trend der letzten Landtagswahlen in Sachsen und Brandenburg fort.

Mehr noch, die schleichende Krise den Unionsparteien scheint nun auch offen auszubrechen. Bislang konnten sich die in Wahlumfragen geschwächten CDU und CSU mit Blick auf die SPD als gesund präsentieren. Anders als die SPD fuhr man keine einstelligen Ergebnisse ein. Dass diese Zeiten nun aber vorbei sein könnten, meint auch Ursula Münch, Politikwissenschaftlerin an der Akademie für politische Bildung in Tutzingen und Mitglied im Wirtschaftsrat der Bundesregierung. Im Interview mit der tagesschau erklärte sie am 29.10., der CDU drohe aus ihrer Sicht „das gleiche Schicksal wie der SPD“. Auch vorgezogene Neuwahlen im Bund schloss Münch in diesem Interview nicht aus.

Die Zerschlagung der Industrie durch die Treuhand nach 1990, die Wiedereinführung kapitalistischer Verhältnisse und die anhaltende Perspektivlosigkeit in ganzen ostdeutschen Landstrichen, hat die Menschen in den neuen Bundesländern nicht nur ungeheuer wütend gemacht, sondern in der Folge auch von den Etablierten entfremdet.

Gesellschaftliche Polarisierung

Nicht selten vernimmt man zur Beschreibung der politischen Lage das Wort „Rechtsruck“. Dass dies nur eine ungenaue Wiedergabe der Situation ist, zeigt das Wahlergebnis in Thüringen. Was sich zusehends abspielt, ist eine Polarisierung nach links und rechts. Nicht nur die AfD erzielte Zugewinne und schnellte auf 23,4 Prozent, wodurch sie Platz 2 besetzte. Auch die LINKE fuhr ein Plus von immerhin 2,8 Prozentpunkten ein und landete bei 31,0 Prozent. Dabei hat auch die Regierung unter Bodo Ramelow in der Koalition mit SPD und Grünen nicht eine grundlegende andere Politik gemacht, die klar erkennbar im Interesse der Masse der arbeitenden Bevölkerung ist. So bekam in der Konsequenz diese Regierung keine Mehrheit. Viele wählten die LINKE als stärkste Kraft, um zu verhindern, dass die AfD stärkste Kraft wird, so wie es auch in Brandenburg mit der SPD oder in Sachsen der CDU der Fall war. Doch Rot-Rot-Grün hat den Aufstieg der AfD in Thüringen nicht verhindert.

Die gern erwähnten Einstellungen von Lehrer*innen in Thüringen sind bei Weitem nicht ausreichend. Und die Gemeindereform des Landes Thüringen bedeutete in der Realität nur längere Wege für Anwohner*innen, weil Ämter verlegt oder geschlossen wurden. Wirklich linke oder gar sozialistische Maßnahmen wie Initiativen zur Rekommunalisierung von Wohnraum oder Kliniken sucht man in den vergangenen fünf Jahren vergebens.

Dass die Thüringer Linkspartei ausgerechnet mit Ramelow an der Spitze dennoch ihr bestes Ergebnis überhaupt einfuhr, beflügelt nun den rechten, in der Konsequenz prokapitalistischen Teil der LINKEN. Dietmar Bartsch, Vorsitzender der Fraktion der Linkspartei im deutschen Bundestag, erklärte inzwischen, man müsse an den Erfolg von Bodo Ramelow anschließen und als Bundespartei davon lernen“. Das ist aber genau der falsche Weg und die Linken in der LINKEN müssen jetzt klar dagegen halten.

Gerade die Tatsache, dass die LINKE die Wut über Sozialabbau, Niedriglohnpolitik und Rentenkürzungen nicht zum Ausdruck bringt und konsequente Lösungen anbietet, macht es der AfD leicht. Auf rechtspopulistische Art verbindet sie soziale Demagogie mit dem Gift des Rassismus und Nationalismus. So erklärte Höcke im Wahlkampf gern, Zuwanderer würden gute medizinische Versorgung erhalten und Hiergeborene hätten mit dem Pflegenotstand zu kämpfen. Darauf aufbauend versucht die Thüringer AfD unter der Führung von Höcke, rechtsextreme Positionen zu verankern und hoffähig zu machen. Dass die Positionen der AfD Lügen sind, wird dann leichter zu erklären, wenn Migrant*innen, Geflüchtete und Hiergeborene gemeinsam gegen den Pflegenotstand kämpfen. Das zu organisieren wäre eigentlich Aufgabe der LINKEN.

Anpassungskurs der LINKEN

Dass die LINKE auch nach dieser Wahl einen anderen Weg, nämlich den des Parlamentarismus und Regierungsbeteiligung beschreiten wird, steht zu befürchten. Schon kurz nach der Wahl rief die Führung der Thüringer LINKEN nicht etwa zu Kämpfen auf, sondern erklärte die grundsätzliche Verhandlungsbereitschaft mit allen im Landtag vertretenen Parteien, mit Ausnahme der rechtspopulistischen AfD.

Was damit gemeint war, offenbarte sich schnell. Als der konservative Spitzenkandidat, Mike Mohring, am Tag nach der Wahl im ARD-Morgenmagazin, ganz anders als noch am Abend zuvor, verkündete, seine Partei müsse nun „Verantwortung übernehmen“, sprang die LINKE-Führung sofort auf den Zug auf. Ramelow erklärte, man werde sehen, was möglich sei, „eine festere Koalition, eine absolute Koalition oder ein Tolerierungsmodell“. Unterstützung kam von der LINKEN-Bundesspitze. Bernd Riexinger meinte glatt, der Ball läge im Feld der CDU. Eine Absage an ein Bündnis mit einer Partei, die für die Situation in Ostdeutschland verantwortlich ist, kam nicht. Die Befürchtung, die LINKE könnte sich wirklich auf ein Bündnis mit der CDU einlassen war jedoch fehl am Platz. Aber nicht, weil die LINKE dieses Angebot prinzipienfest ablehnte, sondern, weil die CDU und auch Mike Mohring die diesbezüglichen Andeutungen wieder zurückzog. Das spricht Bände über die Situation in der LINKEN, wo führende Teile die Partei lieber als “verlässlichen” Bestandteil des Establishments sehen wollen, anstatt als Partei des Widerstands.

Was jetzt?

DIE LINKE muss endlich aufhören, das Bündnis mit den Sozialabbauparteien einzugehen und stattdessen das Bündnis mit der arbeitenden Bevölkerung und den Gewerkschaften schmieden, um den gemeinsamen Kampf mit Beschäftigten, Arbeitslosen, antirassistischen Initiativen, Rentner*innen und Mieter*innen zu organisieren. Das Potenzial dafür besteht auch unter dem mit Abstand erneut größten Teil aller Wahlberechtigten – den Nicht-Wähler*innen, die weder dem bürgerlichen Einheitsbrei, noch den Rechtspopulisten etwas zutrauen. Wenn aber die LINKE in Thüringen zum festen Bestandteil dieses Establishments wird – und das wäre bei einem Bündnis mit der CDU der Fall – dann wird für noch mehr Menschen der scheinbar einzige Weg ihre Wut zu artikulieren das Kreuz bei der AfD sein. Das darf man nicht zulassen.

Datei:Goldlauter-Blick.jpg

Eine Regierung der LINKEN in dieser Situation kann nur eine Minderheitsregierung mit sozialistischem Programm sein. Die müsste ohne Zweifel um jedes kleine Gesetz kämpfen. Gerade dazu müsste sie die lohnabhängig Beschäftigten unabhängig von Herkunft, Sprache, Religion, Alter oder Geschlecht mobilisieren. Das zu erreichen wäre ohne Frage nicht leicht. Es wäre zudem nur möglich, wenn man der Bevölkerung zeigen würde, dass eine LINKE-Regierung wirklich in ihrem Interesse wäre. Das Programm für eine solche Regierung müsste aus Eckpunkten bestehen wie der Kommunalisierung von Wohnraum unter demokratischer Kontrolle die Mieter*innen, Verstaatlichung von Pflegeinrichtungen und Krankenhäusern, massiven Stellenaufbau an den Schulen, eine Absage an die Schuldenbremse und stattdessen die Besteuerung der Reichen, sowie antirassistische Mobilisierungen gegen AfD und Co. Eine solche Landesregierung könnte – sogar aus der Minderheit heraus – zu einem bundesweiten Fokus von Opposition gegen eine immer schwächer werdende Bundesregierung werden und den Widerstand gegen Sozialabbau, den Kampf für wirkliche Verbesserungen inspirieren und voran bringen. Sozialistische Ideen könnten wieder greifbar werden. Das wäre auch ein großer Schritt auf dem Weg hin zu einer sozialistischen Massenpartei. Und es wäre das wirksamste Mittel gegen Rechts, um die Basis der AfD zu untergraben.

Würde man dieses Programm vertreten, könnte man den Landtag von außen mit einer großen Bewegung unter Druck setzen. Doch Ramelow wird diesen Weg nicht gehen. Auch da braucht man sich keiner Illusion hinzugeben. Eine Koalition der LINKEN unter der Führung von Ramelow mit – oder Tolerierung von – Sozialabbauparteien, von SPD, Grünen, FDP und CDU, wird in Thüringen leider kaum zu verhindern sein. Wahrscheinlich sogar dann noch, wenn die zu erwartende Wirtschaftskrise hart zuschlagen und die Lebensbedingungen der arbeitenden Bevölkerung stark einschränken wird. Das zeigt, dass es darauf ankommt um grundlegende Positionen innerhalb der LINKEN bundesweit zu kämpfen. Dafür muss man jetzt endlich die linke Opposition in der LINKEN organisieren. Sol tut das im Rahmen der AKL. Wir fordern alle auf, uns dabei zu unterstützen.

akl - Antikapitalistische Linke

—————————————————————–

Grafikquellen         :

Oben          —         Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

 

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Digitale-Versorgung-Gesetz

Erstellt von DL-Redaktion am 6. November 2019

7 Gründe, warum Spahns Gesundheitspläne für Patienten gefährlich sind

File:Intensivstation fcm.jpg

Quelle        :      Netzpolitik ORG.

Von    

Am Donnerstag soll der Bundestag über das Digitale-Versorgung-Gesetz abstimmen. Doch der Vorschlag des Gesundheitsministers hat eine soziale Schieflage, weicht den Schutz sensibler Daten auf und kann zur Diskriminierung von Risikogruppen führen.

Gesundheitsminister Spahn will mit dem Digitale-Versorgung-Gesetz (Entwurf) die Daten gesetzlich Versicherter zentral speichern lassen und pseudonymisiert für Forschungszwecke zur Verfügung stellen. Gleichzeitig dürfen die Krankenkassen selbst so viele Daten zusammenlegen und auswerten wie nie zuvor – und diese für nicht näher umschriebene „digitale Innovationen“ nutzen. Der Gesetzesentwurf erregt massive Kritik – wir fassen die wichtigsten Argumente zusammen.

1. Sozial ungerechter Datenschutz

Spahns Pläne der Datenweitergabe betreffen die etwa 73 Millionen gesetzlich Versicherten. Knapp neun Millionen Menschen in Deutschland, die sich eine private Krankenkasse leisten können, sind von der Regelung ausgenommen. Private Krankenversicherungen haben in der Regel diejenigen abgeschlossen, die mehr Geld verdienen. Im Bundestag gilt das für fast die Hälfte aller Abgeordneten. Sie genießen in Zukunft einen besseren Gesundheitsdatenschutz als die Mehrheit der Bevölkerung.

2. Schieflage bei algorithmischer Auswertung

Die soziale Schieflage des Gesetzes wird dazu führen, dass gerade die Daten derjenigen ausblendet werden, die sich eine bessere Gesundheitsvorsorge und -versorgung leisten können. Es wird sich also anhand der Daten nicht auswerten lassen, welchen Einfluss eine gesetzliche oder eine private Krankenversicherung auf die Gesundheitssituation hat. Diese Fragen sind aber von hohem Interesse, wenn es darum geht, gute gesundheitliche Versorgung für alle zu gewährleisten.

3. Pseudonymisierung kann geknackt werden

Pseudonymisierung ist nicht gleich Anonymisierung. Oft genügen einige wenige Merkmale, um pseudonymisierte Daten doch einer Einzelperson zuzuordnen. Besonders bei Datensätzen mit niedrigen Fallzahlen wie bei seltenen Krankheiten ist diese Gefahr groß. Im Gesetzentwurf ist nicht beschrieben, wie die Daten vor einer solchen Identifizierbarkeit geschützt werden sollen.

Es gibt zahlreiche Felder, in denen De-Anonymisierung gelungen ist, ob nun bei Kreditkartendaten oder bei der Browserhistorie. Der Kryptografie-Experte Dominique Schröder forderte in der Expertenanhörung des Gesundheitsausschusses daher, nur mit verschlüsselten Daten zu arbeiten. Verfahren, auch mit solchen Daten Berechnungen und Auswertungen durchführen zu können, gibt es bereits.

4. Keine Widerspruchsmöglichkeiten

Die Patienten können der Nutzung ihrer sensiblen Gesundheitsdaten nicht widersprechen. Zwar ist laut der Datenschutzgrundverordnung die Zustimmung für eine Datenverarbeitung grundsätzlich notwendig, diese kann aber durch Gesetze ausgehebelt werden. Das ist hier der Fall. 73 Millionen Menschen in Deutschland haben durch das Gesetz weder die Chance, der Datenweitergabe generell abzulehnen, noch können sie ethisch fragwürdigen Studien auf Einzelfallbasis widersprechen.

5. Zentrale Massenspeicherung könnte ausgeweitet werden

Nach der alten Datenschützer-Weisheit „Wo ein Trog, da sammeln sich die Schweine“ kann eine zentrale Gesundheitsdatei weitere Begehrlichkeiten wecken. Die zentrale Erfassung könnte sich als Dammbruch erweisen, der „der Überwachung, der Kontrolle und der Sortierung von Menschen sowie der Diskriminierung bestimmter Risikogruppen Tür und Tor“ öffnet, wie es die Digitale Gesellschaft in einer Stellungnahme kritisiert.

6. Unklare Begrifflichkeiten, unklare Datenmengen

Spahns Gesetz hantiert mit unbestimmten Rechtsbegriffen: Niemand weiß bislang, was mit „digitalen Innovationen“ oder „Versorgungsinnovationen“ gemeint ist. Laut der Gesetzesbegründung dürfen aber die Krankenkassen Patientendaten aus der ärztlichen Versorgung, der Arzneimittelverordnung, der stationären Versorgung und der Abrechnung „sonstiger Leistungserbringer“ zusammenführen, um Erkenntnisse für diese „digitalen Innovationen“ gewinnen zu können.

7. Gesundheitsprofile und Diskriminierung

Der Bundesrat kritisiert, dass der Verhältnismäßigkeitsgrundsatz im Gesetz nicht gewahrt bliebe: „Die personenbezogene Zusammenführung und Auswertung ermöglicht den Krankenkassen, in großem Umfang individuelle Gesundheitsprofile ihrer Versicherten zu erstellen. Dies birgt erhebliche Risiken für die Persönlichkeitsrechte der Versicherten und die Gefahr der Diskriminierung von einzelnen oder bestimmten Risikogruppen.“ Die erweiterte Datenauswertung könnte in Richtung individualisierter Vertragsleistungen gehen und damit das Solidarprinzip von Krankenversicherungen unterlaufen.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.

——————————————————————–

Grafikquelle       :            Bildinhalt: Krankenbett einer Intensivstation mit Patient

  • Aufnahmeort: Mannheim, Deutschland
  •  Die dargestellte Person billigt jede nicht verunglimpfende Veröffentlichung.

 

attribution share alike This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: Frank C. Müller

Abgelegt unter Gesundheitspolitik, Politik und Netz, Regierung, Überregional | Keine Kommentare »

Linke PV am 27. /28. 10. 19

Erstellt von DL-Redaktion am 6. November 2019

Konversion der Autoindustrie, Geschlechterparität im Bundestag und Thüringen-Wahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle     :  AKL

Bericht von Lucy Redler

Der Parteivorstand (PV) widmete sich am Sonntag, 27.10. schwerpunktmäßig einer interessanten Debatte über die Zukunft der Autoindustrie, einem Gesetzesentwurf zur Herstellung von Geschlechterparität im Bundestag und der Vorbereitung der Strategiekonferenz der LINKEN am 29.2. bis 1.3.2020 in Kassel.

Am Montag, 28.10. ging es neben der Wahlauswertung in Thüringen vor allem um die neue Forderung der LINKEN zur Mindestsicherung. Darüber hinaus gab es Berichte aus dem Jugend- und Studierendenverband und wurden etliche weitere Vorlagen beschlossen. Da Thies Gleiss derzeit leider die Stimme versagt, verantwortet Lucy Redler diesen Bericht allein.

Autoindustrie

Bernd Riexinger hatte eine Diskussionsvorlage zur Zukunft der Autoindustrie und deren „soziale, ökologische, demokratische Transformation“ eingereicht, die auf hohem Niveau diskutiert wurde. In der Debatte ging es um das von ihm vorgeschlagene Ziel der Halbierung der Anzahl der Autos bis 2030, ob E-Autos eine Alternative sind oder nicht, die nötige Konversion der Produktion, einen Fünf-Stufen-Plan zum kostenfreien ÖPNV, das Ziel einer emissionsfreien Wirtschaft in 15 bis 25 Jahren, der Forderung nach Arbeitszeitverkürzung bei vollem Lohnausgleich und Fragen der Vergesellschaftung.

Angesprochen wurde, dass all dies nicht in der bisherigen Form der kapitalistischen Verwertung möglich sei. Klar wurde dabei auch, dass es im Parteivorstand unterschiedliche Vorstellungen darüber gibt, ob eine Transformation der Autoindustrie und die Einführung von Wirtschaftsdemokratie im Rahmen des Systems möglich sind, oder es nötig ist (Lucys und Thies Meinung), offensiver die Eigentums- und Systemfrage zu stellen. Das Ziel, das Klima zu retten, erfordert die Konversion der Autoindustrie. Das ist nur durch die Vergesellschaftung der Autoindustrie möglich und muss einhergehen mit der Überführung anderer Schlüsselindustrien in öffentliches Eigentum, der Abschaffung der kapitalistischen Produktionsweise und der Einführung demokratischer Planung.

Eine Debatte gab es erneut (wie bereits beim letzten PV zur CO2-Bepreisung) zur Frage, ob es ausreicht, das Angebot des ÖPNVs zu erweitern und Ordnungsmaßnahmen zu ergreifen, oder ob die Nutzung von Autos in der Innenstadt verteuert werden muss durch Parkraumbewirtschaftung und andere Maßnahmen, um marktwirtschaftlich ein anderes Verhalten zu erzwingen. Letzteres würde aus Sicht der AKL aber vor allem Menschen aus der Arbeiter*innenklasse treffen, Reiche könnten sich weiter leisten, ihre Autos in die Städte zu fahren (Umweltverbände sagen zudem, dass solche marktwirtschaftlichen Steuerungen viel zu langsam und viel zu wenig Wirkung erzeugen).

Bernd Riexinger hatte vorgeschlagen, das Konzept der LINKEN als „linken Green New Deal“ zu betiteln. Lucy sprach sich aus verschiedenen Gründen dagegen aus. Für viele klingt Deal nach einem Deal mit den Konzernen und nicht nach dem nötigen Kampf gegen Konzerninteressen. Bernd Riexinger verwies dagegen darauf, dass der Begriff international von Linken geprägt sei, zeigte sich aber offen für andere Begriffe.

Als Lesehinweis empfahl Lucy das Buch „Mit dem Elektroauto in die Sackgasse“ von Winfried Wolf (erschienen 2019 bei Promedia) und die Durchführung von Veranstaltungen mit ihm zum Thema alternative Verkehrspolitik. Winfried Wolf spricht sich darin sehr deutlich gegen E-Autos als angeblich grüne Alternative aus.

Geschlechterparität im Bundestag

Als zweiten Schwerpunkt unter Aktuelles diskutierte der PV einen Gesetzentwurf der Bundestagsfraktion zur Umsetzung der LINKE-Forderung nach Geschlechterparität im Bundestag. Dazu nahm Conny Möhring, frauenpolitische Sprecherin der Bundestagsfraktion, an der Sitzung teil und stellte den Entwurf vor. Während die Quotierung der Kandidat*innen auf den Listen und in Wahlkreisen der LINKEN unstrittig ist, ging es darum, ob die Partei einen Gesetzentwurf einbringen soll, der alle Parteien dazu verpflichtet, Wahllisten und Kandidat*innen für Direktmandate in den Wahlkreisen geschlechterparitätisch aufzustellen. Die gesetzliche Verpflichtung zur paritätischen Aufstellung der Wahllisten ist noch einfach vorstellbar, komplizierter wird es bei den Wahlkreisen. Der Vorschlag von Conny Möhring und anderen ist, die Umsetzung als paritätische Doppelbesetzung der Wahlkreise zu ermöglichen, indem die heutige Anzahl von Wahlkreisen halbiert und dann doppelt mit Mann und Frau besetzt wird. Die Alternative zur Einführung der vollen Geschlechterparität wäre die Abschaffung der Wahlkreise und die Umsetzung der Wahl über ein reines Verhältniswahlrecht. Diese Vorschläge wurden konstruktiv und kontrovers diskutiert.

Das Stimmungsbild zum Gesetzentwurf ging dann auch dementsprechend ungefähr 50:50 aus.

Eine Entscheidung darüber wurde auf die nächste PV-Sitzung am 23./24.11. verschoben. Positiv wurde festgehalten, dass Conny Möhring diese Diskussion im PV sucht, da ja sonst nicht selten die Fraktion Entscheidungen trifft und die Partei vor vollendete Tatsachen stellt.

Strategiekonferenz 2020

Am 29.2. bis 1.3.2020 soll eine bundesweite Strategiekonferenz der LINKEN im Kulturbahnhof im schönen Kassel stattfinden, die offen für alle Mitglieder ist. Dort sollen keine Beschlüsse gefasst werden, aber Räume in Plena und workshops geöffnet werden, um über die weitere Strategie der LINKEN zu sprechen. Die Konferenz soll sich vor allem an Mitglieder und Aktive richten und zudem an Akteur*innen aus dem Umfeld der Partei.

Ilja Seifert brachte es gut auf den Punkt, als er sagte, es sei nicht zentral, dass dort hundert Journalist*innen rumspringen, um sich keine Agenda von außen aufzwingen zu lassen.

Was genau diskutiert werden soll, wird Gegenstand von Debatten und auch Kontroversen sein. Ein Mitglied des geschäftsführenden PVs meinte, es solle dort kein Best-of der Kontroversen der letzten Jahre geben, sondern das diskutiert werden, was gesellschaftlich nötig sei. Es ist natürlich richtig, dass die Strategiekonferenz neue (und alte) Fragen wie Zukunft der Autoindustrie, Klimapolitik, internationale Handelsbeziehungen- und kriege, Aussichten auf eine Rezession diskutieren muss, aber zugleich müssen auch die Kontroversen der letzten Jahre ihren Platz haben. Denn diese sind ja nicht losgelöst von den gesellschaftlich notwendigen und aktuellen Fragen.

Mitglieder der Partei sind aufgerufen, bis zum 10.1.2020 eigene Strategiebeiträge von bis zu 10.000 Zeichen einzureichen. Diese könnt ihr hier einreichen:

strategiedebatte@die-linke.de . Die Beiträge sollen online und eine Auswahl in einem Printreader veröffentlicht werden. AKL-Mitglieder werden sich mit Beiträgen zu Wort melden.

Der PV wählte eine Vorbereitungsgruppe, der folgende Mitglieder aus dem PV angehören: Jörg Schindler, Harald Wolf, Lucy Redler (Vertretung Thies Gleiss), Ralf Krämer, Jan van Aken. Dazu kommen Genoss*innen aus dem Bundesausschuss, aus Parteiströmungen, Jugendverband, SDS und der Bundesgeschäftsstelle.

Vorschläge zur Strategiekonferenz könnt ihr gern an die Vorbereitungsgruppe oder auch direkt an Lucy richten. Die Vorbereitungsgruppe wird nun noch erweitert durch Genoss*innen aus Landesverbänden (also meldet euch schnell über euren Landesverband, wenn ihr mitmachen wollt.)

Weitere Themen unter Aktuelles waren die Massenproteste in Chile, Katalonien, Libanon und Irak, die Parteikampagnen zu Pflege und Mieten, die geplanten Studierendenstreiks ab dem 23.11., die Aufklärung des Lübke-Mordes und die Rolle des Verfassungsschutzes.

Neue Forderung: 1200 Euro Mindestsicherung

Angesichts der gestiegenen Lebenshaltungskosten lagen vier Vorschläge zur Erhöhung der sanktionsfreien Mindestsicherungsforderung der LINKEN (derzeit 1050 Euro) vor. Von diesen wurden in der Debatte im Wesentlichen drei diskutiert:

Erstens: Die BAG Hartz IV, bei der Sitzung durch zwei Genoss*innen vertreten, stellte ihr Konzept von einer sofortigen Erhöhung der Mindestsicherung auf 1200 Euro vor.

Zweitens: Der Gegenvorschlag kam von Ralf Krämer, der eine Erhöhung von 1150 Euro errechnet hatte.

Drittens: Der dritte Vorschlag war, die Forderung auf 1200 Euro zum nächsten Bundestagswahlkampf zu erhöhen.

Die Debatte drehte sich dann weniger um die Differenz von 50 Euro, sondern um die Frage, nach welchen Gesichtspunkten wir Forderungen aufstellen. Während die BAG Hartz IV, Lucy und andere Parteilinke politisch dafür plädierten, die objektive Notwendigkeit zum Ausgangspunkt zu nehmen und mit der Forderung nach 1200 ein Signal an Bündnispartner*innen in Erwerbsloseninitiativen und Sozialverbänden auszusenden und eine überfällige Debatte in den Gewerkschaften anzustoßen, argumentierten andere entweder stärker mathematisch oder damit, dass für die Durchsetzung von 1200 Euro die starken Bündnispartner in den Gewerkschaften fehlen und 1200 Euro gegenüber Lohnabhängigen schwerer vermittelbar seien. Es stimmt, dass die Gewerkschaften diese Forderung nicht aufstellen, dasselbe gilt jedoch auch für die Forderung nach 1050 und 1150 Euro. Es stimmt auch, dass manche prekär Beschäftigte eine Forderung nach 1050, 1150 oder 1200 Mindestsicherung nicht nachvollziehen können, doch das spricht wohl eher für Lohnerhöhungen statt einer niedrigeren Mindestsicherungsforderung. Lucy sprach sich dafür aus, flankierende Forderungen nach einem Mindestlohn von 13 Euro aufzustellen.

Die Abstimmung ergab eine Mehrheit für die Forderung nach 1200 Euro, in der Stichwahl setzte sich dann der moderatere Vorschlag durch, diese Forderung zum nächsten Bundestagswahlkampf statt unmittelbar aufzustellen.

Wenn euch die Vorlage der vier Varianten interessiert, schicken Thies oder Lucy euch diese gern zu.

Wahlerfolg für „Landesvater Bodo Ramelow“

Die Auswertung der Thüringenwahl kam viel zu kurz. Bodo Ramelow und Susanne Hennig-Wellsow konnten Montag aufgrund vieler Termine erst ab 11:30 an der Sitzung teilnehmen und eilten um 12 Uhr mit den Parteivorsitzenden zur Bundespressekonferenz.

Landtag Erfurt 2011-05-18 mnII (55).JPG

Nach minutenlangen Standing Ovations für Bodo Ramelow für die Presse, an denen sich die Autorin nicht beteiligte, gab es hochlobende Beiträge der Parteivorsitzenden und dann Inputs von Susanne Hennig- Wellsow und Bodo Ramelow. Bodo Ramelow erklärte die Arbeitsteilung so, dass er alle drei Parteien vertrete und Susanne Hennig-Wellsow die Partei und diese Arbeitsteilung beim Arbeitskampf der Uniklinik Jena gut geklappt habe. Susanne Hennig-Wellsow lobte, dass Bodo Ramelow als „Landesvater“ überall respektiert sei. Sie verteidigte, dass es Wahlplakate mit Bodo Ramelow ohne Logo der LINKEN gab.

Leider werden diese Sichtweisen aus Sicht der Autorin von wenigen kritisch hinterfragt.

Bodo Ramelow verwies darauf, dass er Ministerpräsident bleibe und auch bereit sei, sich mit einfacher Mehrheit im dritten Wahlgang wählen zu lassen.

Natürlich sind 31 Prozent für DIE LINKE in Thüringen ein gutes Ergebnis. Es stellt sich jedoch zum einen die Frage, warum die AfD so stark werden konnte und ob DIE LINKE mit diesen 31 Prozent linke Politik betreiben wird und diese nutzt, die gesellschaftlichen Verhältnisse zu ändern oder nicht.

An Diskussionszeit verblieben genau 10 Minuten und es gab nur zwei Beiträge, unter anderem von Lucy, die neben den bekannten Differenzen zur Regierungsbeteiligung und einer Warnung vor Bündnissen mit der CDU fragte, ob DIE LINKE Thüringen die 31 Prozent denn nun gesellschaftlich für die Mobilisierung zur Umsetzung eines Gesetzes zu Mietabsenkung, Mietendeckel und einem Gesetz für bedarfsgerechte Personalbemessung im Krankenhaus nutzen werde. Bodo Ramelow antwortete, ein Mietendeckel sei Symbolik und die Regierung habe gerade erst 6000 Wohnungen zurückgekauft.

Das erinnerte die Autorin an das Motto des Berliner Bürgermeisters Müller statt auf Enteignungen auf „Kaufen, Bauen, Deckeln“ zu setzen – nur ohne Deckeln.

Die AKL bleibt gespannt, ob die 31 Prozent für wirklich linke Politik genutzt werden, oder ob es so weitergeht wie bisher mit sozialdemokratischer Politik. Die AKL spricht sich für eine Minderheitsregierung allein der LINKEN in Thüringen mit sozialistischer Politik, gestützt auf gewerkschaftliche Kämpfe und soziale Bewegungen, aus. Vier Beiträge aus dem Kreis der AKL zu Thüringen (vom Bundessprecher Thies Gleiss und von den AKL- Mitgliedern Claus Ludwig und Sebastian Rave) findet ihr hier:

https://www.antikapitalistische-linke.de

Weitere Beschlüsse

Außerdem wurde (neben weiteren Vorlagen) das Folgende beschlossen:

• Die Unterstützung der Proteste gegen den AfD-Bundesparteitag am 30.11./1.12. in Braunschweig und der bundesweiten Demonstration in Solidarität mit Rojava am 2.11. in Berlin

• eine finanzielle Unterstützung von Aufstehen gegen Rassismus, der Roten Ruhr-Akademie in Essen, des politischen Aschermittwochs in Bayern, dem Gedenken an 100 Jahre Kapp-Putsch des Kreisverbands Wesel

• politische Vorlagen zur Abschaffung des Solidaritätszuschlags, eine Rekommunalisierungskampagne

• die Durchführung des Jahresauftakts am 10.1.2020 ab 18h im „refugio“ in Berlin-Neukölln und der Gremienberatung mit dem Themenschwerpunkt 15 Jahre Agenda 2010 am 11.1.2020

Darüber hinaus wurden die Berichte zur Mitgliederentwicklung im dritten Quartal, der Finanzbericht und der Genderbericht 2018 zur Kenntnis genommen (und leider aus Zeitgründen nicht diskutiert, wir empfehlen die Lektüre) und die Berichte aus dem Jugend- und Studierendenverband entgegen genommen. Für Letztere soll in Zukunft mehr Zeit auch zur Diskussion eingeplant werden.

Berlin, 30.10.2019, Lucy Redler (und schöne Grüße von Thies Gleiss)

akl - Antikapitalistische Linke

————————————————————-

Grafikquelle           :

Oben        —       Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —        Susanne Hennig, 18. Mai 2011

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Sind nun alle Bodo ?

Erstellt von DL-Redaktion am 5. November 2019

Für eine LINKE-Alleinregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–11.jpg

Quelle       :      AKL

Von Claus Ludwig.

Es ist gut, dass die LINKE zur stärksten Partei in Thüringen geworden ist und bei gestiegener Wahlbeteiligung in absoluten Zahlen und prozentual zulegen konnte. Doch Grund zum Jubeln ist dieses Ergebnis nicht. Zwei Wochen nach dem Doppelmord von Halle haben die Stichwortgeber der Nazi-Terroristen unter dem offenen Rechtsextremisten Björn Höcke ihre Stimmen mehr als verdoppeln können. Jetzt werden Rufe laut, die LINKE solle mit der CDU koalieren oder die FDP zu R2G dazuholen. Die LINKE sollte  dies ablehnen.

Wie in Brandenburg und Sachsen hat es bei der Landtagswahl in Thüringen eine scharfe Polarisierung anhand der Frage “für oder gegen die AfD” gegeben. Viele dieser Wähler*innen haben ihre Stimme der stärksten Anti-AfD-Kraft und damit der Partei des Ministerpräsidenten Bodo Ramelow gegeben. In Sachsen profitierte davon die CDU, in Brandenburg die SPD.

Die LINKE gilt – nicht zu Unrecht – im Osten als Teil des Establishments. Die Regierungsbeteiligung hat die LINKE verändert, nicht aber die Verhältnisse. Auch unter Bodo Ramelow gab es keinen Politikwechsel, sondern überwiegend ein “weiter so”.

Es ist rechnerisch nicht möglich, eine Regierung ohne LINKE oder AfD in Thüringen zu bilden. Eine Regierung mit der CDU würde, gerade angesichts der nahenden Wirtschaftskrise, dazu führen, dass die LINKE die Mitverantwortung für eine Politik übernimmt, die gegen die arbeitenden Menschen gerichtet ist. Das würde der AfD die Möglichkeit eröffnen, noch stärker zu werden. Das gleiche gilt, wenn die LINKE mit SPD, Grünen weiter regiert und sich die FDP als neoliberale Laus in den Pelz holt.

DIE LINKE hat 31% der Wähler*innen für sich mobilisiert. Was macht sie daraus? Wie baut sie auf der Grundlage eine starke antirassistische Bewegung auf, um die AfD zu bekämpfen? Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, mit klaren Eckpunkten und dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren (siehe unten).

In den nächsten Wochen wird viel von Verantwortung die Rede sein. Die wahre Verantwortung der LINKEN ist es, eine gesellschaftliche Alternative zu Sozialabbau, Niedriglöhnen, Armutsrenten und Rassismus zu formulieren und dafür auf allen Ebenen zu kämpfen – auf der Straße, im Parlament und – bei 31 Prozent Wähler*innen – auch in der Regierung. Das geht nicht mit den Establishment-Parteien von CDU, FDP, GRÜNEN und SPD, das geht nur mit einer linken Alleinregierung. Wenn die LINKE klare Beschlussvorlagen im Interesse der arbeitenden Menschen in den Landtag einbringt, müssen die etablierten Parteien Farbe bekennen, ob sie mit der AfD gegen die LINKE opponieren oder deren Anträge passieren lassen.

akl - Antikapitalistische Linke

Grafikquelle    :           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 5. November 2019

Lebensstile von Politikern

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Robert Misik

Normal musst du sein! Dürfen linke Politiker Porsche fahren oder Brioni-Anzüge tragen? Wann immer solche Lebensstilfragen aufpoppen, geraten Argumente durcheinander.

Eine Freundin von mir vertritt die Ansicht, die Mentalitätsunterschiede zwischen Deutschen und Österreichern träten besonders plakativ in zwei Liedern zutage: in dem Song „Ruaf mi net an“ des verstorbenen Wiener Liedermachers Georg Danzer und in „Zu spät“ von den Ärzten.

Beide haben dasselbe Thema, nämlich verschmähte Liebe. Hauptfigur ist jeweils ein junger Mann, der von seiner Freundin verlassen wurde, weil sie sich einen klügeren, reicheren, prestigeträchtigeren Partner gesucht hat. Doch während in der deutschen Version die Ich-Figur in gigantomanische Fantasien verfällt, versinkt die österreichische Figur in weinerlichem Selbstmitleid.

Bei den Ärzten heißt es: „Doch eines Tages werd’ ich mich rächen / Ich werd’ die Herzen aller Mädchen brechen / Dann bin ich ein Star, der in der Zeitung steht / Und dann tut es dir leid, doch dann ist es zu spät.“

Bei Danzer dagegen tut der trauernde Twentysomething gar nichts, nimmt Tabletten, kann nicht mehr schlafen und verwünscht den neuen Liebhaber, der die Ex in Restaurants einlädt und ein teures Auto fährt. „I waß du hasd jetzt an Freund mid an Porsche / Geh sag ihm er soll do in Oasch geh.“ Allein dafür, dass er „Porsche“ auf „Oasch geh“ („in den Arsch gehen“) reimte, gebührt Danzer der Literaturnobelpreis. Der Porsche steht hier für Protzerei, für das Neureiche, auch ein bisschen für das Ludenhafte. Porsche repräsentiert auch ein wenig das Unse­riöse, Krösushafte.

Wir führen ja bei uns in Österreich meist ähnliche Debatten wie ihr in Deutschland, nur noch ein bisschen dümmer. Deswegen hatte die österreichische Sozialdemokratie zuletzt ihre „Porsche“-Debatte. Die SPÖ ist ja bei den vergangenen Parlamentswahlen auf 21 Prozent abgestürzt, Tags darauf trat der Bundesgeschäftsführer zurück und holte seine Habseligkeiten mit seinem schicken Oldtimer-Porsche aus der Parteizentrale. Als sich dann noch herausstellte, dass auch der Tiroler Landesvorsitzende mit einem modernen Porsche-Modell durch die Gegend kurvt, waren die „Luxus-Sozis“ in den Schlagzeilen und buchstäblich „im Oasch“.

Entkontextualisierte Debatte

Wann immer solche politischen Lebensstilfragen aufpoppen, geraten die Argumente durcheinander. Die einen meinen, linke Politiker müssten auch durch ihren Lebensstil ausdrücken, dass sie auf der Seite der einfachen Leute stehen, und dafür sind Villen, Luxuskarossen und teure Uhren, Brioni-Anzüge und Zigarren Gift. Die anderen meinen, dass diese Leute sich das Zeug ja erstens von ihrem verdienten Geld gekauft haben, sie daher auch niemandem Rechenschaft schuldig seien, dass es zweitens darum gehe, ob sie gute Politik machen, nicht ob sie in Sack und Asche herumliefen, und dass die Linken, drittens, doch für Wohlstand und Luxus für alle eintreten, nicht für Armut für jeden.

Quelle      :          TAZ        >>>>>         weiterlesen

—————————————————————-

Grafikquellen      :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Feuilleton, P. DIE LINKE, Überregional, Umwelt | Keine Kommentare »

LINKE vs. Höcke-AfD

Erstellt von DL-Redaktion am 4. November 2019

Analyse der Thüringer Landtagswahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle       :     AKL   

von Claus Ludwig, Köln

Der Aufstieg der AfD ist alarmierend und führt viele an die Wahlurne. Auch wenn es in Thüringen eine klare Mehrheit gegen die AfD gibt und nur 15 Prozent aller Wahlberechtigten (inkl. der Nichtwähler*innen) die rechtsextreme AfD unter Björn Höcke gewählt haben: Die politische Polarisierung war selten so deutlich wie bei dieser Wahl. Von der Stimmung gegen rechts hat die LINKE profitiert, die ihre Stimmen von 265.000 auf 344.000 (Zahlen auf Tausend gerundet) steigern konnte. Doch Jubeln und Freudenfeiern seitens der LINKEN sind fehl am Platz.

Die AfD konnte ihre Stimmen von 100.000 auf 259.000 um den Faktor 2,6 vermehren. Die AfD ist die Partei der erwerbstätigen Männer im mittleren Alter, liegt bei den 18-24jährigen knapp vor der LINKEN und bei den Erstwähler*innen knapp hinter ihr. Die stark von Senior*innen geprägte Altersstruktur des Landes ist einer der Faktoren, welche einen Durchmarsch der AfD verhindert haben.

Ein anderer Faktor ist das unterschiedliche Wahlverhalten von Frauen und Männern. Frauen haben in stärkerem Maße die LINKE gewählt. Das wird auch an der beruflichen Aufteilung deutlich: Bei der stärker weiblich geprägten Gruppe der Angestellten dominiert die LINKE mit 34 Prozent gegenüber 19 Prozent der AfD, bei Arbeiter*innen liegen beide nah beieinander (31 und 29 Prozent). Bei den Selbstständigen liegt die AfD vorn. Gewerkschaftsmitglieder haben zu 36,6 die LINKE und zu 22,6 Prozent die AfD gewählt, bei den Gewerkschaftsfrauen waren es 40,2 zu 16,2 Prozent.

Die AfD hat mit 34 Prozent eine besonders hohe Unterstützung unter denjenigen, die ihre eigene wirtschaftliche Situation als schlecht ansehen. Allerdings waren  nur 13 Prozent der Befragten der Meinung, die Lebensverhältnisse hätten sich in ihrem direkten Umfeld verschlechtert, für 31 Prozent sind sie gleich geblieben, 34 Prozent sehen sogar Verbesserungen. Bei den “Sorgen” dominierten die Angst vor “politischen Anschlägen” (80 Prozent), dem Klimawandel (65 Prozent), Kriminalität und dem Islam (54 Prozent). Sorgen um den eigenen Lebensstandard machen sich 31 Prozent.

Bei der Wahl der AfD gibt es Elemente von Protestwahl, aufgrund zuvor erlebter sozialer Ausgrenzung und der Benachteiligung des Ostens. Diese waren jedoch bei dieser Wahl nicht entscheidend. Die AfD wird zwar von vielen gewählt, die sich vernachlässigt oder abgehängt fühlen. Dies ist allerdings nicht deckungsgleich mit einem bereits erfolgten sozialen Abstieg. Es handelt sich auch um eine Zunahme verfestigter rassistischer und rechtsextremer Einstellungen, auch wurzelnd in der massiven Intervention von Nazi-Organisationen in den 1990er Jahren und der Förderung von Rassismus durch staatliche Institutionen und die Debatten der bürgerlichen Parteien. All dies wurde und wird begünstigt durch das Fehler einer wirklich klaren linken Alternative und starken Gewerkschaften.

Björn Höcke ist auch unter AfD-Wähler*innen umstritten – was diese nicht daran hindert, ihn zu wählen. 82 Prozent aller Wähler*innen sehen die AfD zu nah an rechtsextremen Positionen. Aber 47 Prozent der Befragten finden es gut, dass sie “die Zuwanderung begrenzen” will und 39 Prozent halten sie für eine “demokratische Partei wie die anderen Parteien auch”. 44 Prozent der AfD-Wähler*innen sehen Höcke zu nah am Rechtextremismus, aber 77 Prozent “finden es gut, dass er kein Blatt vor den Mund” nimmt.

Bei der AfD-Unterstützer*innen handelt es sich nicht überwiegend um harte Faschist*innen, die bereit zur Aktion sind. Doch die Akzeptanz völkisch-faschistischer Sprache und Propaganda ist hoch. Das Potenzial, von einer Phase überwiegend parlamentarischer Agitation zu Straßenaktionen überzugehen und die Landes-AfD zu einer aktiven faschistischen Kraft wie die NPD zu machen, wächst.

Die LINKE hat es mit ihrer Fokussierung auf den Ministerpräsidenten Bodo Ramelow geschafft, die Rolle von SPD und Grünen gleich mit zu übernehmen. Anders als in Sachsen und Brandenburg konnte sie ihre starke Position bei den über 60jährigen halten. Gleichzeitig wurde sie zur Gegenspielerin der AfD, legte in größeren Städten wie Jena, Erfurt, Weimar, Suhl und Gera sowie unter Erstwähler*innen, bei Menschen mit höherer Bildung und bei Frauen im erwerbstätigen Alter besonders stark zu. Dies sind Schichten, die in anderen Bundesländern vor allem die Grünen wählten, auch wegen ihrer scheinbar konsequenten antirassistischen Positionierung. Dieses Ergebnis ist vor allem der Bündnis-Konstellation auf Landesebene geschuldet. Dazu beigetragen hat allerdings auch die glaubhafte Positionierung von Bodo Ramelow und vieler bekannter LINKER, die sich an Blockaden gegen Nazi-Aufmärsche beteiligt haben oder im NSU-Untersuchungsausschuss aktiv waren.

Der Verlust der Regierungsmehrheit für R2G bei Stärkung der LINKEN ist ein Hinweis darauf, dass die Lager-Arithmetik der Regierungsbefürworter*innen in der LINKEN nicht stimmt. Es wird keine starke LINKE neben einer stabilisierten SPD und dynamischen Grünen geben. Wenn die LINKE erfolgreich ist, geht das auf Kosten der SPD und der Grünen. Der Aufschwung der Grünen ist hingegen mit einer Begrenzung der LINKEN verbunden.

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -96.jpg

Solange nicht auf der Basis verstärkter Klassenkämpfe die Gesellschaft in Bewegung gerät und weitere Schichten von bisherigen Nicht-Wähler*innen erreichbar werden, bleiben die Verschiebungen bei den Wahlen im Großen und Ganzen innerhalb der Lager. Die Grünen profitieren vom Niedergang der SPD, die LINKE vom Schwächeln der Grünen. Die CDU verliert an die AfD. Ausnahmen bestätigen die Regel: In Thüringen gab es eine bedeutende, aber nicht entscheidende Wanderung von 23.000 CDU-Wähler*innen zur LINKEN. Die CDU-Spitze hatte versucht, LINKE und AfD gleichermaßen auszugrenzen, dies wurde von deren Wähler*innenschaft mehrheitlich abgelehnt.

Die in Berlin regierenden Parteien kommen nicht aus ihrer Krise heraus, und das am Vorabend des wirtschaftlichen Abschwungs. Die Meinung der meisten Thüringer*innen über die SPD ist eindeutig: “nur mit sich, ihrem Personal und Posten beschäftigt”.

Die Zahlen stammen aus: “Die Wahl zum 7. Thüringer Landtag am 27. Oktober 2019, WAHLNACHTBERICHT UND ERSTER KOMMENTAR”, Horst Kahrs und Benjamin-Immanuell Hoff, Rosa-Luxemburg-Stiftung sowie von Infratest Dimap im Auftrag der ARD-Tagesschau.

akl - Antikapitalistische Linke

————————————————————————–

Grafikquelle        :

Oben           —         Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —         Landtagswahl Thüringen am 14. September 2014

Abgelegt unter L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Katarina Witt – Interview

Erstellt von DL-Redaktion am 3. November 2019

„Man schweigt den Schmerz weg“

File:Bundesarchiv Bild 183-1988-0911-030, Katarina Witt, Jutta Müller.jpg

Von Anja Maier und Katrin Gottschalk

Die Eiskunstläuferin Katarina Witt war ein Weltstar, der in der DDR lebte – nicht alle haben sie dafür geliebt. Doch auch ihr und ihrer Familie kam 1989 das eigene Land abhanden. Ein Gespräch über hartes Training, Helden des Ostens und Männer am Herd.

taz am wochenende: Frau Witt, wir haben hier Fotos aus Ihrer Zeit in Karl-Marx-Stadt.

Katarina Witt: Ach, guck mal an. Die Frau Müller und ich in der Trainingshalle in Chemnitz! Oh Gott, wie toll, da müsste ich ungefähr dreizehn gewesen sein.

Wen sehen Sie auf diesen Bildern, wer waren Sie damals?

Das ist ein anderes Mädchen als das, an das ich mich erinnere. Kurze Haare, sehr burschikos, eher wie ein Junge. Und ich gucke da ziemlich ernst, Frau Müller sagt mir offenbar gerade, wo’s langgeht. Ich höre zu und hab ein bisschen Schiss.

Sie war ab 1977 Ihre Trainerin, hatte eine fast soldatische Ausstrahlung. Wie streng war diese Frau Müller tatsächlich?

Frau Müller war noch strenger, als man sich das ausmalen möchte. (lacht) Sie wollte das Beste von uns, das ist nun mal der Trainerjob. Da musste sie auch manchmal extrem sein, ohne dass man das gleich persönlich nimmt und sofort der Rechtsanwalt angerufen wird, wie das heute läuft. Der Sport war schließlich auch für mich eine ernste Sache. Wenn es nicht lief, hat man sich das sehr zu Herzen genommen. Ein Sportler muss im Grunde jeden Tag über seine Schmerzgrenze hinausgehen können, auch langweilige Sachen geduldig wiederholen.

Jutta Müller ist eine starke Frauenfigur in Ihrem Leben.

Absolut. Sie hat mich geprägt, ich habe lange mehr Zeit mit ihr als mit meiner Mutti verbracht. Wenn wir ins Ausland gereist sind, da hat sie mir auch mal ’ne Stulle geschmiert oder ein Würstchen unterm Wasserhahn warm gemacht. Wir haben ins Ausland Schwarzbrot und Salami mitgenommen, weil wir kaum Westgeld hatten, um uns was zu kaufen.

Gibt es heute junge Frauen, die Sie fördern und fordern?

Na ja, ich fordere vor allem meine Umwelt heraus. (lacht) Aber klar, ich treffe oft Frauen, denen ich ein Vorbild war, für die ich ein anderes Bild von der DDR rübergebracht habe: nicht immer so trist, wie man uns darstellen wollte. Einige erzählen mir auch, sie seien nach mir benannt worden.

Sind Sie eine Heldin?

Überhaupt nicht. Helden sind andere. Ich war eine Leistungssportlerin und habe da meine Frau gestanden, auch unter immensem Druck. Wir haben Leistungen geliefert, aber wir waren keine Helden, haben uns nicht aufgebäumt gegen etwas. Helden sind für mich die Leute, die 1989 auf die Straße gegangen sind. Die haben Mut gezeigt, Rückgrat. Ich hatte im Sport dagegen das, was ich machen wollte.

Wie kommt es eigentlich, dass es heute in der gesamtdeutschen Erzählung so wenige Heldinnen und Helden aus dem Osten gibt?

Ich bemerke, dass es da noch immer eine Trennung gibt. Als ich zum Beispiel nach dem Tod von Sigmund Jähn, dem ersten Deutschen im All aus der DDR, ein älteres Foto von uns beiden auf Instagram geteilt habe, kamen aus dem Osten diese Reaktionen: einer von uns, einer unserer Helden, einer von unserer Seite. Diese Reaktionen bekomme ich zu meiner Person auch. Auch mein Leben hat vor 89 stattgefunden und nach 89. Klar haben wir Nena und Modern Talking gehört – aber „bei uns“ sage ich, wenn es mit meinem ehemaligen Land zu tun hat. Auch wenn ich dies nicht wieder zurückhaben will. Jetzt gibt es andere Helden, für viele wird das gerade Greta Thunberg.

Als Sigmund Jähn verstorben war, entwickelte sich eine Debatte, ob jemand, der Generalmajor der DDR gewesen ist, zum Helden taugt. Wie sehen Sie das?

Ich finde es richtig, dass diese Diskussionen geführt werden. Aber das ist ja so, als würde man den Sportlern aus der DDR sagen: Ihr könnt keine Helden gewesen sein, denn ihr habt ja ’ne Diktatur repräsentiert. Sigmund Jähn und auch ich sind in der DDR aufgewachsen und zur Schule gegangen. Jähn wurde es dort ermöglicht, als erster Deutscher ins All zu fliegen. Was will man ihm da vorwerfen?

Was wird Ihnen denn 2019 noch vorgeworfen? Sie galten lange als SED-Profiteurin.

Eigentlich nüscht. (lacht) Klar, es gab’ne Zeit, wo ich sehr polarisiert habe. Letztendlich sagen eigentlich alle, ob Ost oder West, dass ich auf eine gute Weise meine Meinung, meine Haltung beibehalten habe. Ich habe meinem Land und dem Sportsystem alles zu verdanken, meiner Trainerin, meinen Eltern. Trotzdem bin ich nicht mit geschlossenen Augen durch die Welt gegangen, ich habe gesehen, dass der Sport der Bereich war, in dem Menschen wie ich ihre Träume verwirklichen konnten. In anderen Bereichen ging das nicht, und das war natürlich schlimm für die Betroffenen. Anderen wieder wurde vorgeschrieben, was sie lernen, studieren sollen.

Bundesarchiv Bild 183-1984-0831-421, Berlin, Sportlerball im Palast der Republik.jpg

Die Älteren erinnern sich an Sie als die Gold-Kati aus dem Osten, Jüngere haben Sie eher als Fernsehpromi auf dem Schirm. Als wer möchten Sie denn erinnert werden?

Ich will nicht als Fernsehpromi gesehen werden. Was ist das denn? Nüscht. Ich finde überhaupt dieses Promisein sehr fragwürdig. Ich komme vom Sport, und da habe ich eine Lebensleistung abgeliefert und dort fast ein Jahrzehnt die Weltspitze mitbestimmt. Das ist es, woran man sich erinnern soll.

Sie sind bekannt dafür, Ihr Privatleben sehr gut zu schützen. Kürzlich aber haben Sie doch eine sehr persönliche Geschichte erzählt. Für das Por­trätbuch „Ostfrauen verändern die Republik“ haben Sie geschildert, wie es Ihren Eltern nach der Wende gegangen ist.

Hören Sie auf, da fange ich gleich wieder an zu heulen.

Ihr Vater ist damals arbeitslos geworden, und Sie haben Ihre Eltern noch jahrelang unterstützt. Eine sehr ostdeutsche Erfahrung. Wie geht man als Kind damit um?

Ich war damals 23 Jahre alt. Meine Eltern, die heute über achtzig sind, waren damals also genauso alt wie ich heute. Die haben immer versucht, Probleme von uns Kindern fernzuhalten. Dieser Umbruch Anfang der Neunziger, der Schmerz, der damit einherging, die Verletzungen, das bricht ja jetzt erst auf. Unsere Eltern fangen jetzt erst an, offen zu reden, und das ist für uns, ihre Kinder, neu.

Wie war das damals in der Familie Witt?

Als die Mauer fiel, hatten meine Eltern schon ein langes Arbeitsleben hinter sich, die Kriegskindergeneration ist ja viel früher ins Berufsleben gestartet. Sie hatten erwachsene Kinder und die berechtigte Erwartung, jetzt ein Stück persönliche Freiheit gewinnen, die Früchte ihrer Arbeit ernten zu können. Also Anerkennung für ihre Arbeit, mehr persönliche Freiheiten, Erfahrungen weitergeben. Tatsächlich aber wurde ihnen gesagt: Wir haben eigentlich gar keinen Platz mehr für euch. Es ging da nicht nur um das Finanzielle, sondern auch um den verletzten Stolz, um diese Botschaft: Du bist überflüssig. Da wurde ihnen gesagt: Seid doch froh, ihr habt jetzt Freiheit, Demokratie. Aber was fängst du damit denn an, wenn gerade das gesamte Kartenhaus deines Lebens zusammenbricht und dich niemand an die Hand nimmt?

Was hätte denn damals geschehen müssen?

Es kam niemand und hat die Ostdeutschen an die Hand genommen. Unsere Kompetenzen waren nicht mehr gefragt. Die wenigsten waren ja Unternehmer, wir waren eher Macher, so haben wir das gelernt. Wir kamen aus einem Land, in dem – entschuldigen Sie den Ausdruck – aus Mist Bonbons gemacht wurde. Dinge wurden gelöst.

Aber 1990 kam dieses Prinzip an sein Ende.

Ja, so war das. Diese Generation musste nach dem Mauerfall um alles, alles kämpfen: ihre Rente, die Anerkennung der Abschlüsse und Studienzeiten, Frauenrechte, ihre Häuser und Wohnungen. Das ist das Problem heute: Diese Menschen fühlen sich zweitklassig behandelt. Sogar bei meiner Frau Müller habe ich das damals erlebt.

Was ist passiert?

Gala-Nacht des Sports 2013 Wien red carpet Hermann Kröll Theresa Breuer Katarina Witt.jpg

Man hat diese Weltklassetrainerin wirklich kaltgestellt. Die Rivalitäten zwischen dem ostdeutschen und dem westdeutschen Eislaufverband brachen voll auf. Wir waren nun mal die Erfolgreicheren in den zurückliegenden Jahren, wir hatten die Weltmeister, die Olympiasieger. Da hatte man schon dieses Gefühl: Ihr habt verloren, und wir sagen euch jetzt, wo’s langgeht. Selbst hier also, in diesem überschaubaren Bereich, hat man es nicht geschafft, die besten Erfahrungen aus beiden Systemen zusammenzuführen. Es gab eine große Arroganz, so eine herablassende Siegermentalität.

Haben Sie persönlich das auch zu spüren bekommen?

Quelle     :        TAZ          >>>>>         weiterlesen

———————————————————————

Grafikquellen       :

Oben        —        Katarina Witt, Jutta Müller ADN-ZB Thieme 11.9.1988 Karl-Marx-Stadt: Eiskunstlauf.- Die zweimalige Olympiasiegerin Katarina Witt wurde bei einem Schaulaufen in ihrer Heimatstadt Karl-Marx-Stadt vom Leistungssport verabschiedet. In der mit nahezu 5.000 Eissportfreunden ausverkauften Sporthalle „VIII. Parlament“ wurde die 22jährige Schauspiel-Studentin noch einmal begeistert gefeiert. Bewegende Augenblicke zum Abschluß einer glanzvollen Sportlerlaufbahn zwischen Trainerin Jutta Müller und Katarina Witt.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-1988-0911-030 / CC-BY-SA 3.0

——————————-

2. ) von Oben        —              Es folgt die historische Originalbeschreibung, die das Bundesarchiv aus dokumentarischen Gründen übernommen hat. Diese kann allerdings fehlerhaft, tendenziös, überholt oder politisch extrem sein. Berlin, Sportlerball im Palast der Republik ADN-ZB/Franke/31.8.84 Berlin: Sportlerball Beim Eintreffen zum Sportlerball im Palast der Republik: Erich Honecker, Generalsekretär des ZK der SED und Vorsitzender des Staatsrates der DDR; Dr. h.c. Margot Honecker, Minister für Volksbildung der DDR (2.v.l.); Willi Stoph, Mitglied des Poltibüros des ZK der SED und Vorsitzender des Ministerrates der DDR. L.: Bahn-Radsprinter Lutz Heßlich; 2.v.r.: Eiskunstlauf-Olympiasiegerin Katarina Witt. [Berlin.- Politiker und Sportler (u.a. Kati Witt) auf dem Weg zum Sportlerball im Palast der Republik, im Hintergrund Gebäude des Außenministeriums] Abgebildete Personen: Honecker, Erich: Staatsratsvorsitzender, Generalsekretär des ZK der SED, DDR (GND 118553399) Honecker, Margot: Ministerin für Volksbildung, SED, DDR (GND 122782933) Heßlich, Lutz: Radrennsportler, DDR Witt, Katarina: Eiskunstläuferin, SC Karl-Marx-Stadt, Olympiade 1984 und 1988, DDR (GND 11884508X) Stoph, Willi: Ministerpräsident, Staatsratsvorsitzender, Armeegeneral, SED, DDR

Abgelegt unter Feuilleton, Kultur, Mensch, Überregional | Keine Kommentare »

Linke sollte Kämpferisch sein

Erstellt von DL-Redaktion am 3. November 2019

Statt Sozialdemokratie 2.0

2019-10-27 Wahlabend Thüringen by Sandro Halank–53.jpg

Besser nicht so ?

Quelle       :       AKL 

Von von Sebastian RaveBremen

Die ernüchternden Wahlergebnisse in Brandenburg und Sachsen scheinen bei der LINKEN fast schon wieder vergessen zu sein. Nach dem Wahlerfolg von Bodo Ramelow in Thüringen und der ersten Regierungsbeteiligung im Westen in Bremen gehen kritische Stimmen im Knallen der Sektkorken unter. Dabei liegt gerade in diesen vermeintlichen Erfolgen eine Gefahr für DIE LINKE.

Es gibt nichts Grundlegendes, was die LINKE, die in Sachsen und Brandenburg verloren hat, von der LINKEN unterscheiden würde, die in Thüringen gewonnen hat. Alle drei Landesverbände stehen für die Hoffnung, als linker Teil eines “linken Lagers” in der Regierung eine graduelle Verbesserung der Verhältnisse erreichen zu können.

Tatsächlich sind die Regierungserfolge beispielsweise in Thüringen aber eher überschaubar. Der Verfassungsschutz blieb ebenso unangetastet wie die Schuldenbremse (wie in Bremen), ein Landesmindestlohn, der auch bei Aufträgen von Kommunen gilt, wurde nicht eingeführt. Dafür ist Thüringen heute das Land mit dem zweitgrößten Niedriglohnsektor (30%).

Das Scheitern des Projekts Sozialdemokratie 2.0 lässt sich deutlich daran festmachen, dass eines der Ziele des Koalitionsvertrags der scheidenden rot-rot-grünen Regierung lautete: „Der Kampf gegen alte und neue Nazis, gegen Rassismus und Antisemitismus, muss entschlossen fortgesetzt werden“. Bei allem Bemühen und der Teilnahme an Demonstrationen: Am Ende der Legislatur wurde das Ziel, Nazis und Rechtspopulist*innen wirksam zu bekämpfen, verfehlt. Und leider trägt auch DIE LINKE mit ihrer wirkungslosen sozialdemokratischen Politik einen Teil der Verantwortung dafür. Wenn die Menschen das Gefühl haben, trotz einer linken Regierung Bürger*innen zweiter Klasse zu bleiben und DIE LINKE Teil des Establishments ist, hat es eine rechte Opposition eben leicht.

Die ehemalige Sozialdemokratie ist nicht aus reiner Boshaftigkeit zur neoliberalen Agenda-2010-Partei geworden, sondern weil sie sich den Sachzwängen des globalisierten Kapitalismus gebeugt hat. Dieser ist mittlerweile in einer tiefen Krise, die Sachzwänge verschärfen sich sogar noch weiter – ein Kurswechsel bei der LINKEN weg von der Sachzwanglogik ist deshalb dringend nötig.

Die Partei muss sich endlich trauen, den Kapitalismus nicht nur in Programmen in Frage zu stellen. Sie muss sich in den Stadtteilen und Arbeitsplätzen verankern, indem sie eine konstruktive Rolle bei jeder kleinen und großen Gegenwehr spielt. Zum Beispiel wurde der Mietendeckel in Berlin vor dem Hintergrund einer monatelangen Debatte über Enteignung von Immobilienkonzernen als Zugeständnis an die Bewegung durchgesetzt. Wenn es auch in Bremen und Thüringen solche Verbesserungen geben soll, reicht es nicht, SPD und Grüne am Kabinettstisch mal darauf anzusprechen. Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren. Zu den Eckpunkten sollten gehören:  1. Nichtumsetzung der Schuldenbremse, 2. Bekämpfung der Niedriglöhne, 3. Stopp aller Abschiebungen, 4. Mietendeckel, Mietsenkung und Enteignung der Immobilienkonzerne, 5. Einführung eines Landesgesetzes zur bedarfsgerechten Personalbemessungen in den Krankenhäusern (Thüringen könnte hier Vorreiter werden!) 6. Bedarfsgerechter Haushalt, 7. Rückgängigmachen von Privatisierungen.

Wir gehen nicht davon aus, dass sich SPD und Grünen an einer Regierung mit einem solchen Programm beteiligen würden. Aber das wäre ein Brechen mit der Sachzwanglogik und würde die Frage nach einer gesellschaftlichen Alternative zum Kapitalismus konkret auf die Tagesordnung stellen.

akl - Antikapitalistische Linke

———————————————————————

Grafikquelle         :       Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

30 Jahre Mauerfall

Erstellt von DL-Redaktion am 2. November 2019

Geistiges Kleingärtnertum

Von Stefan Reinecke

Non Stefan ReineckeDie westdeutsche Linke träumte von Revolutionen. Doch als 1989 eine vor ihrer Haustür geschah, war sie überfordert.

Wir kennen die Bilderschleifen, die jeden 9. November aufs Neue gezeigt werden. Wahnsinn-Rufe, knatternde Trabis, Genscher und der Jubel in der Prager Botschaft. Auch Bilder können Floskeln werden, die mehr verstecken als erhellen. Im Herbst 1989, sagen diese Bilder, waren die Deutschen begeistert.

Alle Deutschen? Die Stimmung im Westen war viel schwankender. Im September waren aus der DDR schon Zehntausende in den Westen gekommen. Es fehlten Wohnungen und Jobs. Laut einer Umfrage meinte fast die Hälfte der Westbürger, das Boot sei jetzt leider voll und die Ostler sollten bitte in Plauen und Güstrow bleiben.

Ein paar Wochen nach dem Mauerfall ventilierte Oskar Lafontaine, ob DDR-Bürger weiterhin ein Anrecht auf Sozialleistungen haben sollten. Damit fördere man ja deren Abwanderung. Der SPD-Chef wollte, zumindest für eine Weile, zwei Staatsbürgerschaften. Lafontaine wollte die DDR genau in dem Moment faktisch anerkennen, in dem die SED politisch und die DDR wirtschaftlich kollabierte.

Er spekulierte auf das Gefühl der Westler, von den Habenichtsen aus dem Osten überrannt zu werden. In seinen Reden erschien die Einheit eher als unvermeidliches Übel. Die Grünen rangen sich widerwillig im Frühjahr 1990 – noch nach der SED/PDS – dazu durch, anzuerkennen, dass die Zweistaatlichkeit Geschichte war.

Keine Hürde für Europa

Die Erklärungen von Sozialdemokraten und Grünen bezeugen, 30 Jahre später gelesen, Realitätsblindheit. Warum diese Irrtümer? Der Historiker Timothy Garton Ash hat die Unfähigkeit der SPD im Herbst 1989 mit der erstarrten Ostpolitik erklärt.

Die SPD war demnach auf die SED-Führung und die Politik kleiner Verbesserungen fixiert und nahm die Bürgerbewegung nur als Störung wahr. Die späte Ostpolitik zeigt in der Tat Wahrnehmungsblockaden einer Politik, die auf Verständigung mit den Macht­eliten einer Diktatur verengt war. Allerdings waren die Grünen eng mit der Bürgerbewegung verdrahtet – und hatten ähnliche blinde Flecken.

Die westdeutsche Linke versagte 1989 komplett: moralisch, analytisch und politisch. Moralisch gab es keine Rechtfertigung dafür, dem DDR-Volk, das sich gerade befreit hatte, vorzuschreiben, in welchem Staat es zu leben hatte. Warum sollte Selbstbestimmung in Tibet und der Westsahara gelten, aber nicht zwischen Rostock und Görlitz? Zudem hatte die DDR laut Grundgesetz-Artikel 23 misslicherweise das Recht, der Bundesrepublik beizutreten.

Politisch hechelte die Linke dem Geschehen hinterher. Kohl setzte zügig die Währungsunion um. Dazu gab es angesichts des Abwanderungsstroms von Ost nach West keine realistische Alternative. Doch Lafontaine war überzeugt, dass die Währungsunion ein Fiasko würde und Kohl, der Nationalist, von seinen haltlosen Versprechungen eingeholt würde. Auch die atemlose Kritik, dass die deutsche Vereinigung die europäische zerstören würde, war falsch. Kohl setzte die Einheit zusammen mit Paris, London, Moskau und Washington ins Werk. Die deutsche Einheit war keine Hürde für Europa – im Gegenteil.

Gegen den Kapitalismus

Nach dem 9. November zeigte sich das geistige Kleingärtnertum der politischen Linken. Sie war fasziniert von Revolten gegen Autokraten – in dem Moment, in dem eine Revolution vor ihrer Haustür passierte, war sie schnell irgendwie beleidigt. Eine Epoche ging zu Ende. Die radikale Linke nahm übel, weil die Ossis genau das wollten, was sie ablehnte: Parlamentarismus und Kapitalismus. Viele Sozialdemokraten und Grüne klammerten sich an ihre eingravierte Überzeugung, dass es zwei deutsche Staaten geben müsse, und mäkelten, dass Kohl wieder alles falsch mache. Aber Kassandra gewinnt keine Wahlen.

Warum dieses Versagen? Es wurzelte nicht in der Nähe zum SED-Regime, sondern tiefer. Es gab in der Linken zwar eine kleine Strömung – um Rudi Dutschke, Tilman Fichter und Peter Brandt – die die Einheit als linkes Projekt verstanden. Doch das Gros hielt das für einen bizarren Spleen.

Die meisten Linken verstanden die Teilung irgendwie als gerechte Strafe für die NS-Verbrechen. Das war historisch Unsinn: Die innerdeutsche Grenze war, wie jedes Schulkind wissen konnte, Resultat des Kalten Krieges. Aber unser Gefühl sagte etwas ­anderes. Wir waren, manche insgeheim, manche ­offen, froh, dass die Mauer die fatale Geschichte des deutschen Nationalstaates beendet hatte.

Bundeshauptstadt Bonn 04.jpg

Ich will die neue Kanzlerin werden. Mein Hab und Gut habe ich mitgebracht.

Und gab es dafür nicht auch solide, vernünftige, moralische Motive? Der Historiker Hans Mommsen hatte 1981 eine historische Einordnung des bundesrepublikanischen Selbstgefühls skizziert. Wie in Österreich gebe es in der Bundesrepublik das Bewusstsein, etwas Eigenes geworden zu sein. Der Bismarck’sche Nationalstaat sei Geschichte und die Deutschen seien angesichts der Katastro­phen des 20. Jahrhunderts besser in mehreren Staaten aufgehoben.

Die westdeutsche Linke war postnational – und damit Avantgarde. Die Hälfte der unter Dreißigjährigen im Westen empfand die DDR 1987 als Ausland. In einem CDU-Programmentwurf von 1988 kam die Wiedervereinigung nicht mehr vor. Hatte nicht auch Helmut Kohl 1981 festgestellt, dass „die verlorene Einheit im Sinne eines alten Nationalstaates nicht mehr wiederherstellbar ist“?

Quelle          :        TAZ         >>>>>        weiterlesen

———————————————————————

Grafikquelle          :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

——————————

2.) von Oben    —           DL / privat  – CC BY-SA 3.0

———————–

Unten         —        Die Bundesumweltministerin Angela Merkel am Stresemannufer hinter dem Plenarsaal der ehemaligen Bundeshauptstadt Bonn beantwortet einem Fernsehteam deren Fragen. Im Hintergrund ist das Abgeordnetenhochhaus Langer Eugen zu sehen. Fotografische Impressionen von Andreas Bohnenstengel während der Parlamentarischen Woche im Juni 1995 in: Der Dreizehnte Deutsche Bundestag. Innenansichten unseres Parlaments. ISBN 3-87576-357-2

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

R-R-G ohne Mehrheit

Erstellt von DL-Redaktion am 28. Oktober 2019

Warum die Linkspartei eine Minderheitsregierung anstrebt

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Koalition oder Tolerierung? Irgendwie muss die Linkspartei in Thüringen mit der CDU zusammenarbeiten. Strategen sehen Vorteile für die Minderheitsregierung.

Über Minderheitsregierungen spricht Bodo Ramelow schon länger positiv. Auch wenn er im Wahlkampf stets für Rot-Rot-Grün kämpfte, das Thema war für ihn – anders als die in Deutschland vorherrschende Meinung – „kein Schreckgespenst“. Im Deutschlandfunk-Interview sagte Ramelow im September, in nordischen Ländern sei eine solche Konstellation „ganz normal“.

Es sei zwar „anstrengend, mit wechselnden Mehrheiten zu regieren“, erklärte der Linken-Politiker einige Wochen zuvor dem Redaktionsnetzwerk Deutschland. Aber der damit verbundene „sanfte Zwang zum Kompromiss“ könne auch bereichernd wirken. „Ein Blick über die Landesgrenzen, etwa nach Dänemark, ist da hilfreich.“

Die Volksparteien verlören an Anziehung, der Abstand zwischen den Parteien werde geringer. „Die Minderheitsregierung wird auch bei uns früher oder später kommen, da ist es allemal besser, sich schon jetzt auf neue Regierungsformate einzustellen und für eine höhere gesellschaftliche Akzeptanz zu werben.“

Nun wird es womöglich ernst. Es scheint, als ob Thüringen nach der ersten linksgeführten Landesregierung nun ein weiteres demokratisches Experiment erleben könnte.

Die Mehrheit für Ramelows Linksbündnis aus Linken, SPD und Grünen ist seit Sonntag dahin. Und die Diskussionen in der Linken wie auch bei SPD und Grünen haben begonnen. Auch wenn die Linken-Landesvorsitzende Susanne Hennig-Wellsow der Form halber auf die bevorstehenden Beratungen der Parteigremien am Montagabend verweist und sich zu dem Projekt zunächst nicht äußern will.

In der der Analyse der Linken-nahen Rosa-Luxemburg-Stiftung zum Wahlausgang in Thüringen aber wird eine klare Empfehlung ausgesprochen. Autor Horst Kahrs, früher Leiter der Strategieabteilung im Karl-Liebknecht-Haus, der Linken-Parteizentrale, schreibt: „Mit der Wahl in Thüringen wird endgültig klar, dass Kenia-Koalitionen keine ausreichende Antwort auf die Umbrüche im Parteiensystem sind und über neue Konstellationen nachgedacht werden muss.“

Nach schwieriger Regierungsbildung – den Regierungsauftrag sieht er klar bei Ramelow – stehe eine „Konstellation bevor, die es so oder so noch nicht gegeben hat“, heißt es in dem sogenannten „Wahlnachtbericht“, der traditionell auch Grundlage für die Diskussion in den Parteigremien ist.

Vorteile gegenüber dunkelrot-schwarzer Koalition

Die Präferenz des Soziologen Kahrs ist klar. Eine Minderheitsregierung hat aus seiner Sicht klare Vorteile gegenüber einem formalen dunkelrot-schwarzen Regierungsbündnis: „In der Auseinandersetzung mit der AfD wären Minderheitsregierungen gegenüber lagerübergreifenden Mehrheitsregierungen das probatere Mittel: Sie würden die Unterschiede zwischen den Parteien links von der AfD erkennbarer machen und die demokratische Streitkultur beleben können.“

2017-08-30 Georg Maier Vereidigung by Olaf Kosinsky-7.jpg

Nur mit den AfD-Stimmen könnte eine solche Regierung gestürzt werden. Das könnte das Experiment stabilisieren. Zentraler Prüfstein einer Regierung sei immer die Verabschiedung eines Haushaltes, „hier könnte sich dann der demokratische Konsens gegen die AfD manifestieren“.
———————————————————————
Grafikquellen         :

Oben     —        Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

Abgelegt unter L. Thüringen, Medien, P. DIE LINKE, Überregional | 1 Kommentar »

Zu – „Räte, Netz, Partei“

Erstellt von DL-Redaktion am 28. Oktober 2019

DIE LINKE: „Eine Debatte findet nicht statt“

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Quelle      :        Scharf  —  Links

Von Helge Buttkereit

Zu Peter Nowak „Räte, Netz, Partei“ im Neuen Deutschland vom 19. Oktober 2019, S. 21 (1)

Der Zustand der Linken ist erbärmlich. Die linken Parteien befinden sich seit Jahren freien Fall, nach der SPD ist nun auch die Linkspartei in der Existenzkrise. Die außerparlamentarische Linke ist kaum vernehmbar, wenn überhaupt in Form von Verteidigungs- oder Abwehrkämpfen gegen Repressionen oder gegen Rechts. Eine Besserung ist nicht in Sicht, zumal nicht an die Wurzel der Probleme vorgedrungen, die eigene Geschichte kritisch aufgearbeitet und daraus konkrete Schlussfolgerungen gezogen werden. Die Linke in der Krise müsste selbstkritische, radikale Organisationsdebatten führen, wo doch ihre Organisationen am Boden liegen. Tut sie aber nicht.

Wenn dann ein Autor nicht nur eine fast vergessene Organisation der westdeutschen Linken wieder ins Bewusstsein rückt, ihre Aktualität herausarbeitet und gleichzeitig auf nicht einmal zwanzig Seite eine fundierte Organisationsgeschichte des Proletariats liefert, dann wäre zumindest eine Beschäftigung mit dem Inhalt des Buches, eine kritische Auseinandersetzung mit den Argumenten angebracht. Peter Nowak hingegen hat eine an einigen Stellen falsche und ansonsten oberflächliche Rezension vorgelegt. Auf das Ziel des rezensierten Autors, einen Beitrag zur Organisationsdebatte zu leisten, geht er nicht einmal ein, geschweige denn, dass er in diese einsteigt.

Das besagte neue Buch von Carsten Prien unter dem Titel „Rätepartei“ ist eine historisch-materialistische Kritik des Sozialistischen Büros (SB) und reicht weit darüber hinaus. Das SB war in den 1970er Jahren die wichtigste Organisation der undogmatischen Linken in der Bundesrepublik, an der sich viele bekannte Köpfe wie beispielsweise Elmar Altvater, Arno Klönne oder Wolfgang Streeck beteiligten. Rudi Dutschke als einer der wichtigsten Vertreter dieser Strömung schon in der Studentenbewegung der 1960er Jahre war ebenfalls Teil des SB. Er wollte ausgehend von dessen Struktur eine „Rätepartei“ aufbauen. Es ging darum, die lockere, tendenziell unverbindliche und letztlich doch wieder von der Zentrale namens Arbeitsausschuss gesteuerte Organisation in eine „Partei neuen Typs“ umzuwandeln. Diese „Rätepartei“ sollte basisdemokratisch strukturiert sein, ausgehend von den „Arbeitsfeldern“, in denen sich bereits das SB organisierte. Mit „Arbeitsfeldern“ werden die Orte beschrieben, an denen die  Parteimitglieder in der Produktions- aber auch in der Reproduktionssphäre tätig sind. Davon ausgehend entwickelt sich im Organisationsmodell eine Parteiorganisation in Form einer Rätestruktur, die einen neuen Typ von Partei darstellte, würde sie Wirklichkeit.

Wer konkrete Stadtteil- oder Betriebsorganisationen kennt, wie Peter Nowak, für den sollte eine solche Organisationsform und auch ihre modellhafte Darstellung nicht abstrakt oder theoretisch, wie er schreibt, sondern im Aufbau zumindest erst einmal logisch erscheinen.

Denn die Arbeitsfelder sind ja praktisch vorhanden und eben an einigen Orten sogar schon organisiert, ohne ihre eigene Organisationsform weiter zu treiben. Dies zeigt sich schon in der ewigen Diskussion um die Priorität von Partei und Bewegung. Eine konkrete Aufhebung der beiden Vereinseitigungen in eine neue Organisation, wie sie Dutschke und viele andere mit ihm in den 1970er Jahren diskutierten, scheint heute undenkbar zu sein. Warum eigentlich?

Anstatt sich diese Fragen zu stellen, wird Nowak unsachlich. Warum er Prien mit ironischem Unterton als „selbsterklärten theoretischen Nachlassverwalter Dutschkes“ tituliert, bleibt in seinem Text ebenso unklar wie so vieles andere. Denn ein solcher sein zu wollen, hat Carsten Prien an keiner Stelle erklärt. Nowak führt diese Beschreibung hier ein, die allerdings sehr wohl eine sachliche Grundlage hat. Carsten Prien hat in seinem Buch „Dutschkismus“ eine kurze wie prägnante Darstellung von Rudi Dutschkes politischer Theorie vorgelegt und stellt in seinem neuen Buch nun ausgehend von Dutschke eine Diskussion dar, die es in der Krise der Linken mehr denn je verdient, rezipiert zu werden.

Richtig ist ferner, dass Prien die Diskussionen im SB parteiisch darstellt, wie Nowak es ihm vorhält. Parteiisch aber ist Carsten Prien wiederum für die Sache selbst, die revolutionäre Partei, deren Geschichte er darstellt und in deren Tradition er sowohl Dutschkes Parteigründungsversuche der 1970er als auch seine eigene Arbeit stellt.

Dabei geht es ihm um die revolutionäre Partei, die zur Selbsterkenntnis kommt, so schreibt er in „Rätepartei“, „dass die proletarische Selbstorganisation nicht Mittel zu irgendeinem ihr äußerlichen Zweck ist, sondern die aus der bürgerlichen Gesellschaft selbst erwachsene historische Prozessgestalt hin zu einer ,freien Assoziation‘ geschichtlich selbstbewusster und selbsttätiger Individuen“.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Diese historische Erkenntnis, gewonnen aus einer Analyse der Geschichte der Arbeiterbewegung, gilt es heute zu vertiefen und in einer Organisationsdebatte in konkrete praktische Schritte zu überführen.

Dabei ist sachliche Kritik sowohl an historischen Personen wie an Organisationen nötig, wie sie Carsten Prien auch übt. An keiner Stelle „stempelt“ oder „watscht“ er ab. Priens Kritik hat immer eine sachliche Grundlage, die Nowak entweder nicht zur Kenntnis nimmt oder aber bewusst unterschlägt. So ist beispielsweise die von ihm zitierte Kritik Carsten Priens an Peter Brückner im Buch mit einer erläuternden Fußnote untermauert. Brückner an dieser Stelle aufgrund anderer (an dieser Stelle nicht zu diskutierenden) Tätigkeiten in Schutz zu nehmen, ist unsachlich. Schlicht falsch ist die Angabe, im Anhang des Buches sei ein Briefwechsel zwischen Negt und Dutschke abgedruckt. Richtig ist: Hier sind drei wichtige Originaltexte der beiden Protagonisten der Organisationsdebatte der 1970er abgedruckt.

Es ist schade, dass Peter Nowak neben solchen einfachen Fakten auch die theoretische Tiefe des Buches von Carsten Prien nicht erfasst hat.

„Rätepartei“ könnte (eine) Grundlage für die notwendige Organisationsdebatte der Linken heute sein. Leider zeigt auch Nowaks Rezension, dass diese Debatte (noch) nicht stattfindet.

(1) https://peter-nowak-journalist.de/2019/10/18/raete-netz-partei/)

Helge Buttkereit ist wie Carsten Prien Mitarbeiter des Hans-Jürgen-Krahl-Instituts e.V. Der Text liegt auch der Tageszeitung Neues Deutschland vor, die allerdings nur kurze Leserbriefe abdrucken will.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen:

Oben         —         Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom

Autor    —     Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg
  • Created: 2014-05-10 13:18:56

 

———————————-

Unten        —           Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor     —        Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Gewerkschaften, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

Berliner Mietendeckel

Erstellt von DL-Redaktion am 25. Oktober 2019

Ersten Erfolg der Bewegung in Rückenwind für Enteignungskampagne verwandeln 

File:Potsdamer Platz, Berlin, April 2016.JPG

Quelle      :     AKL

Von     Lucy Redler, Berlin

Nach monatelangem Ringen und Druck der Mieter*innenbewegung und einer Gegenkampagne der Bauwirtschaft, der Genossenschaften, CDU, FDP, AfD und Teilen der SPD hat sich die rot-rot-grüne Regierung auf einen Entwurf zum Mietendeckel geeinigt. Der Beschluss des Senats geht nun ans Parlament und es bleibt abzuwarten, ob die SPD oder die rechte Opposition noch versuchen, einzelne Punkte zu verwässern.

Die drei wesentlichen Elemente des neuen Mietendeckels sind:

  • Mietenstopp: Die Mieten aller Mietwohnungen auf dem freien Markt, die vor 2014 gebaut wurden, werden rückwirkend zum 18. Juni 2019 für fünf Jahre eingefroren. Das betrifft 1,5 Millionen Haushalte.
  • Obergrenzen: Bei Wiedervermietung darf die Wohnung nicht teurer vermietet werden als gegenüber dem/der Vormieter*in (Ausnahme: Mieten unter fünf Euro netto kalt, diese können auf fünf Euro erhöht werden). Sind die bisherigen Mieten höher als die Obergrenzen-Tabellenwerte, die dem Gesetz beigefügt sind, gilt die Obergrenze, derzufolge die Kaltmieten 6,45 und 9,80 pro Quadratmeter je nach Baujahr und Ausstattung nicht überschreiten dürfen (ausgenommen sind Ausstattungsaufschläge.)
  • Mietsenkung: Bei bestehenden Mietverträgen gibt es es einen Anspruch auf Mietsenkung, wenn die Miete zwanzig Prozent über den Grenzwerten liegt (dabei gelten je nach Lage der Wohnung Auf- und Abschläge).

Der Senat rechnet mit 300.000 Anspruchsberechtigten. Wie viele von ihnen am Ende wirklich einen Antrag auf Absenkung stellen ist offen. Nicht wenige Mieter*innen dürften Angst haben, es sich mit ihrer/ihrem Vermieter*in zu verderben, denn die Regelungen gelten zunächst nur fünf Jahre und es ist offen, ob Teile des Gesetzes vom Gericht kassiert werden (weitere Fakten zum Entwurf).

Wie dicht ist der Deckel?

Eine wirkliche Bewertung der Tiefe des Eingriffs in das Eigentum der Immobilienkonzerne ist erst möglich, wenn klar ist, wie viele Menschen materiell von der Absenkung profitieren und wie geschickt die Konzerne Umgehungsstrategien finden. Nicht nachvollziehbar ist zudem, warum Mietsenkungen erst beim Überschreiten der Obergrenzen um zwanzig Prozent greifen und damit Bestandsmieten anders bewertet werden als Neuvertragsmieten. Zudem sind Modernisierungen von einem Euro pro Quadratmeter weiterhin möglich.

Unbestreitbar ist das Ergebnis aber ein wichtiger Erfolg der Mieter*innenbewegung, den es ohne die Proteste und den politischen Druck durch die Enteignungsdebatte nicht gegeben hätte. Diese hat auch dazu geführt, dass die SPD sich nicht mit ihrem Vorhaben durchsetzen konnte, Mietsenkungen zu verhindern. Wahr ist aber auch, dass das jetzige Gesetz deutlich hinter den ersten Entwurf zurück fällt.

Trotzdem wird die Einführung dieses Mietendeckels eine wichtige Signalwirkung auf Aktive bundesweit haben. Die Einführung sollte als Steilvorlage genutzt werden, für schärfere Gesetze zu Mietenstopp und Mietsenkungen in anderen Bundesländern und auf Bundesebene zu kämpfen. Auch in Berlin muss es zukünftig Auseinandersetzungen über eine Schärfung des Gesetzes geben.

Flag of Die Linke

Für die Berliner*innen ist das Gesetz nun vor allem eine Atempause, es löst die grundlegenden Probleme auf dem von privaten Konzernen dominierten Wohnungsmarkt jedoch nicht. Deshalb kommt es jetzt auch darauf an, die Kampagne für Enteignung der Immobilienkonzerne ohne Atempause weiter voranzutreiben und für massiven bezahlbaren Neubau durch die landeseigenen Wohnungsbaugesellschaften zu kämpfen.

Rückenwind

Ursprünglich hatte die SPD den Mietendeckel als Idee aufgebracht, um weitergehenden Forderungen der Initiative „Deutsche Wohnen & Co enteignen“ und der LINKEN nach Enteignungen von Immobilienkonzernen den Wind aus den Segeln zu nehmen. Im Gegenteil zu dieser Absicht spricht nun einiges dafür, dass die Initiative Rückenwind bekommen könnte. Denn der Mietendeckel hat gezeigt: Kämpfen lohnt sich.Erst deckeln, dann enteignen: Das muss jetzt die praktische Kampagne-Politik der LINKEN bestimmen und auch zur Kampagne der Gewerkschaften werden. DIE LINKE muss alles dafür tun, dass das juristische Verfahren zur ersten Stufe des Volksentscheids „Deutsche Wohnen & Co enteignen“ so schnell wie möglich abgeschlossen wird, um in die zweite Stufe der Unterschriftensammlung und der Kampagne einzutreten. Diese kann zum Rahmen werden, um die Organisierung von Mieter*innen qualitativ zu erhöhen und politisch ein Beispiel zu setzen, dass Enteignungen breiten Rückhalt in der Bevölkerung haben und zur Nachahmung in anderen Bereichen empfohlen werden. Denn es geht um nicht weniger, als die kapitalistischen Machtverhältnisse grundlegend zu ändern.

Dieser Artikel erschien unter www.sozialismus.info zuerst.

akl - Antikapitalistische Linke

————————————————————————

Grafikquellen       :

Oben      —      Potsdamer Platz, Berlin, April 2016

Author Another Believer       /       Source   :    Own Work
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

—————————-

Unten           —       Flag of Die Linke

Public Domain

Abgelegt unter Allgemein, APO, Berlin, Opposition, Überregional | Keine Kommentare »

Köln-Kurden machten mobil

Erstellt von DL-Redaktion am 24. Oktober 2019

Der Krieg auf der Domplatte

Fichier:Düsseldorf, Rosenmontag 2016, politische Karnevalswagen (06).jpg

Aus Berlin und Köln Dinah Riese, Anett Selleund, Christian Werthschulte

Adnan organisiert in Köln Proteste gegen den türkischen Einmarsch. Bekir Yılmaz in Berlin kann dagegen verstehen, dass die Türkei keinen PKK-nahen Staat tolerieren will. Der eine ist Kurde, der andere Türke. Landet der Konflikt an der syrischen Grenze jetzt mitten in Deutschland?

Aus dem Hauptbahnhof von Köln strömen an diesem wie an jedem Abend die Pendler*innen hinaus. Aber statt des Dom-Panoramas erwartet sie heute etwas anderes: gelb-grün-rote Fahnen der kurdischen Miliz YPG. Seit über einer Woche versammeln sich hier kurdische Gruppen, um gegen den Einmarsch der Türkei in Nordsyrien zu demonstrieren. „Operation Friedensquelle“ nennt die Türkei das, was sie tut; als „nicht im Einklang mit dem Völkerrecht“ bezeichnet es Bundesaußenminister Heiko Maas (SPD). Am Mittag gab es in Köln eine Mahnwache, jetzt am frühen Abend eine Demonstration. Heute sind etwa einhundert Menschen gekommen. „Man muss einen Tag als Kurde leben, um die Kurden zu verstehen“, sagt Adnan, der die Versammlung angemeldet hat. Sein Nachname soll nicht in der Presse veröffentlicht werden.

Adnan arbeitet als Sozialarbeiter in Köln, seine Familie kommt aus einem Dorf in der Nähe von Kobani auf der nördlichen Seite der türkisch-syrischen Grenze. „Ich schaue jede freie Minute aufs Handy“, sagt er. Er liest Nachrichtenportale, wartet auf E-Mails seiner Verteiler und telefoniert mit Freund*innen, die südlich der Grenze auf syrischem Territorium gewohnt haben. Sie sind mittlerweile in die 100 Kilometer entfernte Stadt Raqqa geflohen. „Ich fühle mich so hilflos“, erzählt er. „Wir sind bestürzt, dass wir alleingelassen werden.“ Aber die Solidarität der Bevölkerung mit der Mahnwache sei groß. Einen Tag später, am Samstag, demonstrieren in Köln 10.000 Menschen. An einem der Startpunkte flucht eine Frau im Vorbeigehen im rheinisch-türkischen Akzent: „Diese Scheißkurden. Sollen die doch woanders demonstrieren.“ Niemand beachtet sie.

Es ist kein neues Phänomen, dass sich Konflikte in und um die Türkei auch in Deutschland niederschlagen, sei es die türkische Militäroffensive gegen die syrische Stadt Afrin im Januar 2018 unter dem Namen „Operation Olivenzweig“ – ebenfalls ein Friedenssymbol – oder der Putschversuch in der Türkei 2016; oder seien es die verschiedenen Militärputsche in der Türkei, etwa 1971 oder 1980, in deren Folge viele Kurd*innen vor Verfolgung aus der Türkei fliehen mussten – zum Beispiel nach Deutschland.

Türkischstämmige Menschen bilden laut Mi­krozensus 2018 die größte Minderheit in Deutschland: 13,3 Prozent der „Menschen mit Migrationshintergrund“ hierzulande haben diesen, weil sie selbst oder mindestens ein Elternteil die türkische Staatsbürgerschaft hat oder hatte. Das sind rund 2,8 Millionen Menschen. Darunter sind auch viele Kur­d*innen. Wie viele von ihnen in Deutschland leben, lässt sich nicht so leicht beziffern. Schätzungen gehen von 600.000 bis anderthalb Millionen aus, sie oder ihre Familien stammen vor allem aus der Türkei, aus Syrien, dem Irak oder dem Iran.

Beiderseits wird provoziert. Bei spontanen, nicht angemeldeten Aktionen gegen kurdische Versammlungen und Demonstrationen seien nach Einschätzung des nordrhein-westfälischen Verfassungsschutzes „Anhänger der rechtsextremistischen Grauen Wölfe“ unter den Teilnehmenden gewesen, erklärt das Innenministerium des Landes. Diese, „aber auch nationalistische regierungstreue Türken“ hätten bei diesen Aktionen den Wolfsgruß gezeigt, um ihr Gegenüber zu provozieren. Kurd*innen wiederum reagierten „auf dieses Zeichen hoch emotional.“

Anfang dieser Woche kommt es in Herne zu einer Schlägerei zwischen Türken und Kurden, wie die örtliche Polizei berichtet, beteiligt sind 50 bis 60 Personen. Schon in der Vorwoche wurde in der Stadt im Ruhrgebiet der Wolfsgruß gezeigt, wo­raufhin kurdische Demonstrant*innen erst einen türkischen Kiosk und dann ein Café angriffen. Eine kurdische Demonstration in Mönchengladbach wurde „verbal attackiert“, so das NRW-Innenministerium, bevor es zu körperlichen Auseinandersetzungen kam. In Dortmund wurden türkische Fahnen sowohl gezeigt als auch verbrannt, Letzteres hat der Versammlungsleiter rasch unterbunden. In Lüdenscheid wurde ein türkischstämmiger Mann mit einem Messer schwer verletzt, in Bottrop wurden aus einer Gruppe von etwa 200 Menschen heraus Pflastersteine auf eine kurdische Versammlung geworfen. Immer wieder seien auch Parolen der auch in Deutschland verbotenen Kurden-Partei PKK gerufen oder entsprechende Symbole gezeigt worden.

So hätte der „Schwarze Block des Staat“ aussehen können.

Es sei eine Situation „kurz vor der Explosion“, man sitze „auf einem Pulverfass“ – so ist seit Tagen zu lesen. Unsicher fühle er sich in Köln im Moment nicht, widerspricht Adnan, auch wenn er bestimmte Ecken meidet, wo sich ultranationalistische Türken treffen: „Das hat man nichts zu suchen.“

Im Bundesinnenministerium gibt man Entwarnung. Im Zusammenhang mit der türkischen Militäroffensive würden bereits seit geraumer Zeit „Mobilisierungsaktivitäten kurdischer und deutscher linker Organisationen verzeichnet“, sagt ein Sprecher des Ministeriums auf Nachfrage. Vereinzelte gewaltsame Auseinandersetzungen seien „nicht auszuschließen“. Eine „Verschärfung der ­Gefährdungslage“ sei derzeit aber „nicht erkennbar“.

Quelle       :         TAZ              >>>>>            weiterlesen

—————————————————————–

Grafikquellen          :

Oben        —        So sah es einmal in Düsseldorf aus. /Düsseldorf, Rosenmontag 2016, politische Karnevalswagen.

Cette œuvre a été placée dans le domaine public par son auteur, Kürschner. Ceci s’applique dans le monde entier.

—————————

Unten     —          Bereitschaftspolizei officers during a demonstration

Abgelegt unter Feuilleton, Köln, Medien, Überregional | Keine Kommentare »

Wahlen in Thueringen

Erstellt von DL-Redaktion am 24. Oktober 2019

Allen Untergangs-Prognosen getrotzt

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -110.jpg

Von Michael Bartsch

Nach fünf Jahren klopft sich Rot-Rot-Grün in Thüringen auf die Schulter. Die drei Koalitionspartner würden am liebsten zusammen weitermachen.

Es ist der Blick auf die Opposition, der in Thüringen zeigt, wie rund es für die Regierung eigentlich läuft. Mike Mohring wirke ziemlich bemüht, Angriffsflächen bei Rot-Rot-Grün zu entdecken, schilderte ein Radiohörer bei MDR Aktuell seinen Eindruck vom CDU-Spitzenkandidaten in Thüringen. In der Tat musste Mohring beim CDU-Wahlkampfauftakt am 3.Oktober das Geschäft der AfD betreiben und ein apokalyptisches Bild von Thüringer Zuständen zeichnen, um Wirkung zu erzielen. Ausgerechnet am Tag der Einheit denunzierte er überdies seinen Kontrahenten Bodo Ramelow von der Linken als „Gewerkschaftsfunktionär aus dem Westen“.

Die gesenkten Hörner der Union wirken wie ein Beleg für die überwiegend erfolgreiche Arbeit der ersten linksgeführten Koalition eines Bundeslandes. Die CDU-Kritik am Lehrer- und Polizistenmangel oder an schwacher Kommunalfinanzierung gleicht einem Eigentor. Linke, SPD und Grüne haben die rigide Sparpolitik und den Personalabbau der CDU-geführten Vorgängerregierungen gestoppt. Statt der im Koalitionsvertrag vorgesehenen 2.500 sind 3.900 Lehrer neu eingestellt worden, was freilich immer noch keine vollständige Unterrichtsversorgung sichert. Tausend Erzieherinnen mehr verbessern die Kita-Betreuung. Und das Volumen des Finanzausgleiches zwischen Land und Kommunen ist von 1,8 auf 2,1 Milliarden gewachsen.

Im November 2014 – kurz nach dem guten Ergebnis der Linken unter Bodo Ramelow – mobilisierte die CDU-Mittelstandsvereinigung viertausend Menschen, die auf dem Erfurter Domplatz mit Kerzen in der Hand den Untergang ihres geliebten Thüringen verhindern wollten. Hundert Tage nach seiner Wahl zum Ministerpräsidenten konterte Ramelow solche Ängste in seiner gewohnt trockenen Art: „Es gibt immer noch Bananen!“ Es gibt 2019 sogar den chinesischen Großinvestor CATL, der pünktlich zum Landtagswahltermin eine 1,8 Milliarden Euro teure Batteriefabrik ans Erfurter Autobahnkreuz baut.

Im Landtagsgebäude trifft man die ziemlich aufgeräumte Landes- und Fraktionsvorsitzende der Linken Susanne Hennig-Wellsow. Sie blickt sichtlich zufrieden auf eine mit den schlimmsten Orakeln begonnene Legislaturperiode zurück. „Wir haben keine einzige Abstimmung verloren!“ Dabei war Rot-Rot-Grün nur mit einer knappen Ein-Stimmen-Mehrheit gestartet.

An der Uneinigkeit der Oppositionsparteien CDU und AfD scheiterte im Dezember 2017 der Versuch, Ministerpräsident Bodo Ramelow (Linke) zu einer Vertrauensabstimmung zu zwingen. Die CDU wollte damals Differenzen in der Koalition über die größtenteils gestoppte Gebietsreform ausnutzen. Vor allem eine Reduzierung der 17 Landkreise bei nur 2,1 Millionen Einwohnern galt als das zentrale Vorhaben der Koalition. „Die Kreisgebietsreform ist das einzige wirklich gescheiterte Projekt“, räumt der SPD-Fraktionsvorsitzende Matthias Hey ein und verweist auf die Widerstände in den Regionen. In der Tat sind es nicht nur CDU-Politiker, die die historisch gewachsene Kleinstaaterei des Thüringer Flickenteppichs für einen „Segen“ halten. „Die Gebietsreform nicht um jeden Preis durchzuziehen hat dazu geführt, dass sie auf kommunaler Ebene freiwillig stattfindet“, dreht die Linken-Chefin hingegen die halbe Niederlage ins Positive.

Quelle        :      TAZ          >>>>>           weiterlesen

Im Labor wird’s spannend

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Kommentar von Georg Löwisch zur Bedeutung der Wahl in Thüringen

Mitten in Deutschland wird am Sonntag gewählt. Aber die Republik redet lieber darüber, dass die Bayern nur knapp gegen Piräus gewonnen haben. Oder da­rüber, ob AKK was Dummes oder was Kluges wagt (und ob sie dem Außenminister rechtzeitig Bescheid gesimst hat). Während im Sommer vor den Wahlen in Brandenburg und Sachsen ein medialer Countdown lief, ist von Thüringen kaum die Rede.

Das hat Gründe. Thüringen hat mit 2,1 Mil­lio­nen Einwohnern nur ungefähr halb so viele wie Sachsen. Und nach dem Grusel über die starken AfD-Ergebnisse vom 1. September wird in Dresden und Potsdam ziemlich geräuscharm über Kenia-Koalitionen verhandelt. Ein wenig ist die rot-rot-grüne Regierung in Erfurt an der geringen Aufmerksamkeit sogar selbst schuld: Sie legte den Wahltermin extra nicht auf denselben Sonntag wie die anderen, sondern lässt so spät wie möglich wählen. Das Kalkül: Nach dem AfD-Schocker in Brandenburg und Sachsen profitieren wir von der Gegenmobilisierung. Jetzt wirkt es aber so, als wollten viele das Land, wo Björn Höcke seine völkischen Träume propagiert, am liebsten wegschweigen.

Quelle          :          TAZ            >>>>>           weiterlesen

—————————————————————-

Grafikquellen       :

Oben      —          Landtagswahl Thüringen am 14. September 2014

  • CC BY-SA 3.0 de
  • File:2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -110.jpg
  • Created: 2014-09-14 19:10:36

—————————–

Unten         —          Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

Abgelegt unter L. Thüringen, P. DIE LINKE, P.CDU / CSU, P.Die Grünen, Überregional | Keine Kommentare »

Höckes nativer Enkeltrick

Erstellt von DL-Redaktion am 23. Oktober 2019

Anständige Floskeln und unanständige Ideologie

Landesparteitag AfD Thüringen 2019 - Björn Höcke - 1.jpg

Ein Essay von Tubias Ginsburg

Während die Nachrichten über den Anschlag in Halle auf die Smartphones eintrudeln, hält Björn Höcke eine Wahlkampfrede auf einem Familienfest der AfD. Der jüdische Autor Tobias Ginsburg war dabei.

Als Björn Höcke endlich die Bühne betritt, ist der Terroranschlag von Halle bereits vorbei. Zwei Menschen sind tot. Eine Holztür hat das große Massaker verhindert.

Ich weiß nicht, ob die durchnässten Menschen im thüringischen Mühlhausen von dem Attentat wissen. Während ich alle zwei Minuten mein Handy zittrig aus der Tasche krame, mich dabei frage, warum ich Jom Kippur an so einem beschissenen Ort verbringe und nicht bei meiner Familie bin, stehen die Leute um mich herum ganz friedselig beisammen.

Es sind vor allem gutgelaunte Rentner und Kleinbürger, dazwischen ein paar fröhliche Neonazis, die das AfD-Familienfest besuchen. Geduldig wartet man hier auf Björn Höckes Auftritt, trinkt Bier und Glühwein, schunkelt sanft zu volkstümlicher Schlagermusik, vorgetragen von zwei dauergrinsenden Musikern in Trachten, und wann immer ein neuer Regenschauer herabschüttet, flüchtet man unter die Zelte. Und die grinsende Kapelle greift beherzt in die Schlagerkiste: „Tiefe Spuren in unsren Herzen, tausend Sünden im Gesicht / Die nächsten hundert Jahre, die liegen noch vor uns / Wir sind alle noch am Leben!“

Der jung ergraute Kerl knurrt genervt auf, als ich ihn nach dem Attentat in Halle frage. „Waren sicher wieder die Goldstücke“, sagt er und meint damit Geflüchtete.

„Aber eine Dönerbude wurde auch zusammengeschossen.“

Der graue Kerl zuckt mit den breiten Schultern: „Kennen wir doch schon alles.“

Es ist gar nicht so einfach Menschen mit Terroranschlägen noch zu beeindrucken. Sicherlich, in der Welt meines Smartphones, bevölkert von linksliberalen, antirassistischen und nicht zuletzt jüdischen Stimmen, da sitzt der Schock tief. Da erkennt man die Zäsur: Ein Nazi hat in Deutschland versucht, ein Blutbad in einer Synagoge anzurichten. Aber hier auf dem Mühlhäuser Untermarkt, gleich vor der schönen gotischen Kirche, da klingt das alles nur halb so schlimm.

„Wie viele Tote denn?“, fragt mich die alte Frau mit Bratwurst, als ich sie anspreche.

„Mindestens zwei.“

„Ah, ah ja“, sagt sie, nickt freundlich, und wir wissen beide nicht, wie wir das Gespräch noch fortsetzen können. Was kann man dieser Frau sagen? Was kann man sagen, was tun nach so einer Tat?

Gut, da sind zunächst die Floskeln. Wir müssen gegen rechts sein. Noch mehr! Und gegen jeden Antisemitismus! Wir stehen unteilbar! Wir sind mehr! Nie wieder! Keinen Millimeter nach rechts! Rassismus, pfui Spinne! Und so fort. Gefordert wird das von den Anständigen, gehört von anderen Anständigen. Die Unanständigen lesen derweil unanständige Texte, in denen abgefuckte AfD-Politiker den Mörder als unpolitischen Geisteskranken darstellen. Und dann sind da noch all jene, die einfach nur weiterhin auf Familienfesten in ihre Bratwurst beißen wollen. Die einen Scheiß auf gutgemeinte Floskeln geben. Sich nicht angesprochen fühlen.

Klar erfüllen die Floskeln trotzdem einen Zweck. Sie sind beruhigende, kollektive Mantras: Die offene, pluralistische Gesellschaft ist noch lange nicht verloren. Und es liegt in der Natur des Mantras, dass man es wiederholt – und in der Natur des Menschen, sich im Moment der Hilflosigkeit Mut zuzusprechen. Sicher, man kann auch zusätzlich noch ein konsequentes Vorgehen gegen die rechte Szene verlangen. Aber haben wir das nicht schon nach den NSU-Morden verlangt? Nach der Nordkreuz-Todesliste, nach Franco A., nach dem Mord an Walter Lübcke? Oder nach 1945? Es ist gar nicht so einfach, sich nach so einer Tat wieder Mut zu machen.

Höcke nun wiederum gelingt das Mutmachen ganz hervorragend. Er macht seinem begeistertem Publikum Mut im Kampf gegen das verlogene Establishment, gegen Zuwanderung und Multikulti. Mut, sich von Kollegen, Freunden, Enkelkindern als Rassist beschimpfen zu lassen. Mut, trotzdem die AfD zu wählen.

Und dann äußert er sich auch zu Halle. Das muss er auch. Es ist bereits 17 Uhr, es nieselt, einige Zuschauer haben sich in Deutschlandflaggen mit dem Schriftzug „Wir sind das Volk“ gehüllt, im Hintergrund kreischen die Trillerpfeifen der Gegendemonstration. Die Bluttat liegt Stunden zurück, und die Pressemitteilungen laufen heiß.

Datei:Skulptur Juedische Opfer des Faschismus (Foto 2008).jpg

Höcke setzt den Anschlag in eine Reihe mit anderen Gewalttaten, die allesamt von Nichtdeutschen begangen wurden: Mit dem Jungen, der in Frankfurt vor einen ICE gestoßen wurde, mit dem Syrer, der zwei Tage zuvor in Limburg mit einem Lastwagen mehrere Autos gerammt hatte. „Und heute hören wir von einem Terroranschlag auf eine jüdische Gemeinde in Halle, und wir fragen uns als AfD: Was ist in diesem Land los?“

Eine unappetitliche Aufzählung, eine heuchlerische Frage, erst recht aus dem Mund von Höcke: einem Faschisten, der seine geschichtsrevi­sio­nis­tischen und rassistischen Verbal­exzesse mit ritterhafter Mannhaftigkeit und dunkelbrauner Nostalgie performt. Aber dieser Höcke ist an diesem Tag nur bedingt anzutreffen. Wie schon am Vortag in Apolda steht vor mir ein taktierender Wahlkämpfer, ein schmalbrüstiger Kerl mit brav frisiertem Scheitel. Der, so scheint es, sich Mühe gibt nicht allzu laut zu werden. Der sich als unschuldiges Opfer des Establishments geriert. Zwar hebt für ein paar Sätze zum Crescendo an und goebbelt herum, aber gleich darauf entschuldigt er sich artig dafür: „Entschuldigen Sie, an dieser Stelle werde ich einfach immer so emotional.“

Quelle         :        TAZ          >>>>>         weiterlesen

——————————————————————-

Grafikquellen       :

Oben        —      Landesparteitag der AfD-Thüringen am 19. August 2019 in Arnstadt

———————-

Unten        —    Skulptur „Jüdische Opfer des Faschismus“ (1957) von Will Lammert in der Großen Hamburger Straße, Berlin. Sie steht vor dem Jüdischen Friedhof Berlin-Mitte.

Denkmalplakette Deutschland.svg
Dies ist ein Foto des Berliner Kulturdenkmals mit der Nummer

09035233

Urheber Jochen Teufel

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter L. Thüringen, Medien, P.AfD, Überregional | Keine Kommentare »

Ein Linker Blick zurück

Erstellt von DL-Redaktion am 21. Oktober 2019

Die LINKE

2018-10-12 Eva Maria Bulling-Schröter LINKE 7988.jpg

Quelle        :    Scharf  —   Links

Von Fritz Schmalzbauer

Manchmal schadet es nicht, sich zu erinnern: Nicht nur im Großen und Ganzen, sondern im Detail. 2004/2005: Schröder/Fischer zwingen ihre Parteien auf neoliberalen und danach auf Kriegskurs (die Parteien lassen sich zwingen). Wir, eine kleine Gruppe von Gewerkschaftern – in der Presse als „enttäuschte Sozialdemokraten“ tituliert, wobei nur enttäuscht sein kann, wer sich täuschen lässt – protestierten und wurden, soweit noch „drin“, aus der SPD ausgeschlossen.

Die von uns ins Leben gerufene „Alternative für Arbeit und soziale Gerechtigkeit“ (ASG) wuchs schnell zu einer beachteten Bewegung. Es entstand daraus die WASG – Wahlinitiative für Arbeit und Gerechtigkeit und mit ihr der erste Geburtsfehler der neuen Linken: Statt, wie ursprünglich proklamiert, einen Rückhalt aus kritischen Gewerkschaftern und Sozialdemokraten zu organisieren, öffnete eine beteiligte Gruppe das Spektrum hin zu einer allgemeinen Sammlungsbewegung, in der sich alles austoben konnte, was je mit der Welt unzufrieden war. Bundestagswahlen und mögliche Mandate überlagerten den Ausgangspunkt.

Bei den von Schröder vorgezogenen Bundestagswahlen und der Kandidatur der WASG-Kandidaten auf PDS-Listen vereinbarten einige Leute hinter verschlossenen Türen, was sich später als DIE LINKE präsentierte. Damit bekam die PDS im Westen einen neuen Frühling, obwohl sie kurz davor noch völlig marginalisiert war. Die Belohnung: Ausgehandelte Bundestags- und später Europa-Mandate, mit denen es sich gut leben läßt und vor allem das politische Überleben von Leuten, die das Manipulieren gelernt hatten, so die heutige Bayernvorsitzende der LINKEN und von den Gewerkschaftern vorher nie wahrgenommene PDS-Abgeordnete Eva Bulling-Schröter.

Die Folgen der „parteitechnischen“ Unterwerfung unter die PDS, hinter dem Rücken der gewählten Parteileute der WASG gesteuert und ausgehandelt in Berlin: Flucht von Menschen des linksdemokratischen Spektrums der SPD, den Gewerkschaften, den Grünen und Nichtorganisierten. Sie wollten mit der PDS nichts zu tun haben. Zugegeben – ich hatte zwar dagegen opponiert und polemisiert, aber  letzten Endes für die Gründung der Partei DIE LINKE gestimmt, weil es zu diesem Zeitpunkt keine machbare Alternative gab. Was das „Machen“ betrifft, war der PDS-Apparat den westlichen Nebenberufspolitikern eben überlegen. Er überlebte in den neuen Strukturen, ob Partei, Fraktion oder Stiftung durch Profis, die weiterhin dafür sorgten, dass blieb, was bleiben durfte und hinzukam, was dem Apparat nicht im Wege stand.

Auf einer Referenten-Zusammenkunft von Gewerkschaftern in Bayern kritisierte ein Berliner Professor, Berater von Gewerkschaftsvorsitzenden, die Politik der Linken in der Europa-Fraktion. Sie hätten doch seine wohndurchdachten Vorschläge erhalten und dennoch ignoriert. Daraufhin schauten natürlich alle auf mich und warteten auf eine geharnischte Antwort. Mir fiel nichts besseres ein als „lieber eine kritikwürdige Linke als keine“. Gelächter und Applaus.

Schnee von gestern? Ich glaube nicht. Vergangenes läßt sich zwar nicht korrigieren, aber man kann gelegentlich daraus lernen. Die Ironie der Gegenwart will es, dass ausgerechnet im Osten in der Politik von Bodo Ramelow, Gewerkschafter in der Übergangszeit von der DDR zur BRD mit „Ostauftrag“ in Thüringen, ein Stück der ursprünglichen Idee weiter lebt. Linke Politik braucht zwar schonungslose Kritik nach innen und aussen, sie braucht aber auch nachvollziehbare, in der jeweiligen Situation nötige und mögliche Schritte. Geht dabei allerdings die Perspektive verloren, landet man bei der SPD. Schritt für Schritt.

Gründungsvorstand WASG / DIE LINKE

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————-

Grafikquelle       :          Eva Maria Bulling-Schröter, geb. Bulling, deutsche Politikerin (DIE LINKE.) Sie ist eine der Spitzenkandidaten für DIE LINKE. Bayern in der Landtagswahl 2018. Titel des Werks „Eva Maria Bulling-Schröter (DIE LINKE)“

Abgelegt unter Bayern, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Sie trainieren unser Ende!

Erstellt von DL-Redaktion am 19. Oktober 2019

Zur laufenden Atomkriegsübung in Büchel 

Quelle         :       Scharf  —  Links

Ein Beitrag von Kathrin Vogler

Seit Montag und bis heute trainieren US-Truppen gemeinsam mit der Bundeswehr in der jährlichen Militärübung „Steadfast Noon“ den Atomkrieg über Deutschland. Die Bundeswehr setzt dabei Tornados und Eurofighter ein. Trainiert werden die Einsatzbereitschaft und die Fähigkeit zur Zusammenarbeit zwischen den europäischen Militärs und der in Europa stationierten US-Air Force-Kräfte. Die beteiligten deutschen Standorte sind in diesem Jahr Büchel und Nörvenich. Auch in Nörvenich waren früher Atomwaffen stationiert. In Büchel lagern aktuell bis zu 20 Atombomben des Typs B61. Das Taktische Luftwaffengeschwader 33 der Bundeswehr soll im Atomkriegsfall die Bücheler Atombomben im Rahmen der Nuklearen Teilhabe ins Ziel bringen.

Kathrin Vogler, friedenspolitische Sprecherin der Fraktion Die Linke im Bundestag, dazu: „Es ist völlig wahnsinnig, was da gerade geschieht. Die USA übt mit der Bundeswehr sowie niederländischen, italienischen und polnischen Streitkräften, wie man einen Atomkrieg in Europa führt. Käme es dazu, würden Millionen Menschen sterben und kein Stein bliebe auf dem anderen. Es ist auch skandalös, dass die Bevölkerung nicht informiert wird. Wir wissen zum Beispiel nicht, ob die Bücheler Atombomben während der Übung über der Eifel herumgeflogen werden.

Kathrin Vogler 3.jpg

Ich habe Mitte September eine Kleine Anfrage zu Steadfast Noon  gestellt, die die Bundesregierung bis heute nicht beantwortet hat. Wie groß ist das Risiko, dass hier ein katastrophaler Unfall geschieht? Dass diese Atomkriegsübung eine politische und militärische Drohgebärde gegenüber Russland sein soll, macht alles noch schlimmer: Steadfast Noon markiert den Rückfall in den nuklear bestückten Kalten Krieg, der uns alle als Geiseln nimmt. Meine Antwort darauf: Wir müssen alle Atomwaffen abschaffen. Die Bundesregierung muss sofort den UN-Atomwaffenverbotsvertrag unterschreiben.“

Urheberrecht

Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquellen      :

Oben       —       Explosion von Upshot-Knothole Badger 1953 auf der Nevada Test Site

———————————

Unten      —        Kathrin Vogler. Foto: Niels Holger Schmidt

 

Abgelegt unter Bundestag, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Hessen droht U-Ausschuss

Erstellt von DL-Redaktion am 18. Oktober 2019

Verbindungen des Lübcke-Mörders

Wolfhagen, KS - Bründersen v W.jpg

Von Konrad Litschko

Der Ex-Verfassungsschützer Andreas Temme soll mit dem mutmaßlichen Lübcke-Mörder „dienstlich befasst“ gewesen sein. Ein U-Ausschuss könnte folgen.

Hessen steuert auf einen neuen Untersuchungsausschuss zu – und zwar zum Mordfall Lübcke. Nachdem am Donnerstag Hessens Innenminister Peter Beuth (CDU) einräumte, dass es einen dienstlichen Bezug des früheren Verfassungsschützers Andreas Temme, der am Tatort des NSU-Mordes in Kassel war, mit dem mutmaßlichen Lübcke-Mörder Stephan Ernst gibt, stellte die Opposition einen U-Ausschuss in Aussicht.

Auf Nachfrage der SPD hatte Beuth im Innenausschuss erklärt, Temme – ein einst langjähriger V-Mann-Führer – sei mit Ernst „dienstlich befasst“ gewesen. Näheres wollte er dazu nicht sagen. Ein Sprecher des Verfassungsschutz teilte aber der taz mit, es gehe um zwei Vermerke in Ernsts Personenakte aus dem Jahr 2000, die Temme unterzeichnet habe. Ernst war damals in der Kasseler Neonazi-Szene aktiv und galt als gewalttätig. Dienstliche Treffen zwischen Ernst und Temme seien nicht bekannt, sagte der Sprecher. Auch eine Zusammenarbeit von Ernst mit dem Landesamt habe es „zu keiner Zeit“ gegeben, ebenso wenig sei dieser V-Mann gewesen.

Die Rolle von Andreas Temme ist bis heute dubios. Der Verfassungsschützer war am Tatort, als der NSU im April 2006 in Kassel Halit Yozgat in seinem Internetcafé erschoss. Nur zufällig sei er dort gewesen, von dem Mord habe er nichts mitbekommen, beteuert Temme bis heute. Er wurde 2007 schließlich versetzt – und arbeitete zuletzt im Regierungspräsidium, das der im Juni erschossene Walter Lübcke (CDU) leitete. Zu dieser Tat bekannte sich Stephan Ernst: Er habe Lübcke wegen dessen Kritik an Geflüchtetengegner auf einer Bürgerversammlung 2015 getötet. Später widerrief er sein Geständnis.

Nach dem jetzigen Hinweis auf Temme halte er „einen Untersuchungsausschuss zum Mord an Walter Lübcke für nahezu unausweichlich“, erklärte der SPD-Parlamentsgeschäftsführer Günter Rudolph. Auch der FDP-Innenpolitiker Stefan Müller nannte es „erstaunlich“, dass die Information erst auf Nachfrage ans Licht komme. „Diese Informationspolitik ist ein weiteres Mal aufs Schärfste zu kritisieren. Der Innenminister bettelt um einen Untersuchungsausschuss.“ Der Linken-Innenexperte Hermann Schaus sagte ebenso: „Der Innenminister, CDU und Grüne legen ein Verhalten an den Tag, dass einen neuen Untersuchungsausschuss nahezu unumgänglich macht.“

Frühzeitige Löschung der Akte

Innenminister Beuth appellierte dagegen, sich „an die Fakten zu halten, anstatt durch haltlose Thesen Verschwörungstheorien zu bedienen“. Dass sich Temme, beim Verfassungsschutz zuständig für den Bereich Rechtsextremismus, auch mit dem damaligen Szeneangehörigen Ernst befasst habe, sei „nicht überraschend“. Beuth warnte die Opposition, „Sachverhalte unnötig zu skandalisieren“.

Quelle       :          TAZ         >>>>>             weiterlesen

———————————————————–

Grafikquellen      :

Oben        —          Bründersen, Wolfhagen, von Westen

—————————————

Unten          —         Peter Beuth auf dem 29. Parteitag der CDU Deutschlands am 6. Dezember 2016 in Essen

  • CC BY-SA 3.0Hinweise zur Weiternutzung
  • File:2016-12-06 Peter Beuth CDU Parteitag by Olaf Kosinsky-8.jpg
  • Erstellt: 2016-12-06 17:57:26

Abgelegt unter Hessen, P.CDU / CSU, Regierung, Überregional | Keine Kommentare »

Imperiale Gedankenspiele

Erstellt von DL-Redaktion am 16. Oktober 2019

Miserabler Aussenpolitiker, der ich bin

Quelle       :        untergrund-blättle  CH.

Von Eckhard Mieder

Ich hatte mich, das war zu Zeiten der DDR, entschieden, das Maul zu halten. Ich meine: das Maul zu halten, wenn es an Stamm-, Stuben- oder anderen Tischen außenpolitisch hoch- und herging.

Wenn räsoniert, schwadroniert, spekuliert wurde, als wären wir zwischen Wüsten, Metropolen, Parlamenten, Horizonten etc. heimisch. Ich weiß nicht, wie es an schweizerischen, spanischen, marokkanischen, chinesischen Quassel-Tischen zugeht -, mir kam es stets sehr, sehr deutsch vor, über die Welt Bescheid zu wissen und zu palavern.

Ich fand es ungehörig – plötzlich? irgendwann? weiß nicht mehr! -, über andere Völker, Regionen, Nationen und sowas zu urteilen. Ich hielt diese Unterhaltungen, in denen jeder alles über die fernen Orte, Konflikte, Ungereimtheiten dieser Welt wusste und seine Meinung knautschte, bis die Flasche leer war, nicht mehr aus. Ich kapierte da vieles nicht; ich kapiere bis heute den Lauf der Welt nicht; oder wissen Sie, was grad in Bali, Mali oder mit irgendeinem Ali gleich nebenan usw. geschieht? Oder doch.

Oder doch. Wenn ich die Welt als das Einfache nehme, das sie mir ist. Es gibt auf ihr massenhaft Menschen, die ihr Leben menschenhaft leben wollen. Und es gibt – relativ massenhaft – Menschen, die ihr Leben für menschenhafter halten als das der anderen. Es gibt also Politik und Leben. Es gibt Menschen und Menschen. So. Sortiert nach Sorten oder Ambitionen gibt es Menschen, die leben, Familien gründen, friedlich ihrer Wege ziehen oder einfach nur bleiben wollen. Und es gibt Menschen, die anders drauf sind. Imperialer. Süchtiger. Kriegerischer. (Haben die nicht auch Familie und die Freude auf einen Feierabend bei einem Glas Merlot/Riesling oder den Tagesbeginn mit einer Schüssel Müsli?)

Diese zweite Sorte Mensch (ich vereinfache gewiss, das mischt sich ja, wie sich alles mischt, gestern lief mir ein Regenwurm mit dem Gesicht amerikanischen Präsidenten, dessen Namen mir nicht einfiel, über den Weg; oder war es das Gesicht eines arabischen Präsidenten, dessen Namen mir ebenfalls entfallen war?) -, die zweite Sorte Mensch macht Politik. Im Namen der anderen Sorte Mensch, soweit es sich um eine Demokratie handelt. Und die mag Krieg. Die mag es, auf der Welt die Karten zu mischen. Die mag es, um des Profits willen – das sage ich so hin, obwohl ich keine Ahnung habe – mal da einzumarschieren, mal dort jemanden wegzuputschen, mal gleich wieder ein paar Flugzeuge oder bewaffnete Schiffe auf die Reise zu schicken … Ehrlich? Ist das so? Doch, so ist das, und ich finde das zum Kotzen.

Ich erinnere mich daran, wie es 1968 war. Als die Sowjets (darf man sagen; „Sowjets“ steht, glaube ich, nicht auf der List der Unwörter) in Prag einmarschierten. Da war ein Geschrei in der Welt, und jeder Schrei war ein Ruf nach Freiheit, Selbstbestimmung, Mündigkeit u. ä. Dann war das vorbei, so um 1990 rum. Plötzlich gab es – Freiheit, Selbstbestimmung, Mündigkeit u. ä. Und es gab Invasionen – plötzlich? irgendwie? weiß nicht mehr -, die … ja was? Die anders waren? Welche Schweinerei ist anders als – eine andere Schweinerei?

Welches Schlachtfest ist heiterer – als ein anderes Schlachtfest? Welches Massaker ist akzeptabler – als ein anderes Massaker? Jugoslawien, Irak, Libyen, Jemen, Syrien, irgendwie auch die Ukraine, irgendwie auch Venezuela – was, zum Teufel, geht auf dieser Welt vor? Was unterscheidet eine einstige Sauerei von einer Sauerei heute? Wieso haben wir uns daran gewöhnt, dass die zweite Sorte Mensch Schwein sein darf, und die erste Sorte Mensch leidet wie immer? Wäre ich blutrünstig, würde ich wünschen: Über den wirklichen Schweinen schwebe das Damokles-Schlachte-Beil. Mal sehen, was passiert.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquelle         :      Porträt

Abgelegt unter Bücher, Medien, Sachsen-Anhalt, Überregional | Keine Kommentare »

Dringend- Solidaritätsaufruf:

Erstellt von DL-Redaktion am 16. Oktober 2019

Keine Einschüchterung durch Hohenzollern und Co.!

Ernst August von Hannover 1983 Hochzeit Ekaterina Malysheva Georg Friedrich Prinz von Preußen und Ehefrau Sophie Prinzessin von Preußen.jpg

Wer sieht sich so etwas denn noch an ? Nur Narren ?

Quelle      :    Scharf  —   Links

Von Hans-Gerd Öfinger

Liebe Kolleginnen und Kollegen,

am 26. August 2019 habe ich auf der von mir mit redigierten Website www.derfunke.de einen Artikel mit dem Titel „Hohenzollern und Co. enteignen“ veröffentlicht. Konkret geht es darin um aktuelle Meldungen, wonach die Familie Hohenzollern, Nachfahren von Kaiser Wilhelm II., seit Jahren geheime Verhandlungen mit dem Staat führt. „Ein Jahrhundert nach dem Ende der Monarchie in Deutschland fordern die Erben der Hohenzollern-Dynastie vom Staat massive Entschädigungen in Millionenhöhe, Kunstwerke sowie unentgeltliches Wohnrecht im Potsdamer Schloss Cecilienhof“, so der Vorspann. Der Artikel bezieht sich auch auf die vom Landesverband DIE LINKE Brandenburg und vom Vorstand der Partei DIE LINKE initiierte Online-Petition „Keine Geschenke den Hohenzollern!“. Darin werden die Entschädigungsforderungen auch unter Verweis auf die Verstrickung der Hohenzollern mit dem Naziregime strikt abgelehnt. Ich empfehle, diese Petition zu unterstützen. Die Fraktion DIE LINKE im Bundestag hat das Thema aufgegriffen und fordert in einer Kleinen Anfrage von der Bundesregierung Aufklärung über die nichtöffentlichen vertraulichen Verhandlungen mit der Familie Hohenzollern.

„Prinz v. Preußen ./. der funke“

Mein Online-Artikel wurde offenbar binnen weniger Stunden auch in Kreisen um Georg Friedrich Prinz von Preußen registriert und missfiel ihm. Der Prinz ist ein Ururenkel von Wilhelm II., der als letzter deutscher Kaiser für die Verbrechen des deutschen Imperialismus in den Kolonien und im 1. Weltkrieg steht, unter dem Druck der Novemberrevolution 1918 abdankte und in das niederländische Exil floh.

So setzte schon einen Tag später eine Berliner Anwaltskanzlei im Auftrag des Prinzen ein längeres Schreiben (Betreff: „Prinz v. Preußen ./. der funke“) samt vorgedruckter Unterlassungsverpflichtungserklärung auf. In einem weiteren Schreiben erreichte die Redaktion eine Gegendarstellung mit der Originalunterschrift des Prinzen. Es folgte über einen Monat lang eine rege Korrespondenz sowie Beratungen, die viele Ressourcen verschlangen.

Im Rahmen meiner Recherchen konnte ich auch weitere spannende Fakten zu Tage fördern, die ich nicht für mich behalten werde. Ich gehe davon aus, dass auch andere Personen, Medien, Historiker und Organisationen, die sich kritisch zu den Forderungen der Hohenzollern äußerten, mit ähnlich lautenden Mahnschreiben und Forderungen überzogen wurden. Nachdem die Brandenburger LINKE zwei im Artikel zitierte und vom Anwalt des Prinzen beanstandete Aussagen aus der Begründung der Online-Petition strich, sah ich mich ebenfalls zu einer entsprechenden Streichung veranlasst. Die wesentlichen Aussagen und politischen Schlussfolgerungen im Artikel bleiben davon allerdings unberührt.

Mit solidarischen Grüßen

Hans-Gerd Öfinger

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————–

Grafikquelle       :       Hochzeitsgäste Georg Friedrich Prinz von Preußen und Ehefrau Sophie Prinzessin von Preußen vor der Marktkirche bei der Hochzeit von Ekaterina Malysheva und Ernst August von Hannoverg

Abgelegt unter Feuilleton, Niedersachsen, Traurige Wahrheiten, Überregional | Keine Kommentare »

Bodo, der Balancekünstler

Erstellt von DL-Redaktion am 12. Oktober 2019

Der Rote, den die Schwarzen lieben

2019-02-09 Viessmann Luge World Cup Oberhof StP 0103 LR10 by Stepro.jpg

Wer hat den größten Mund ?

Aus Vietnam und Thüringen Anna Lehmann

Ende Oktober wählt Thüringen. Bodo Ramelow, der einzige Ministerpräsident der Linkspartei, regiert dort seit fünf Jahren – und zwar so, dass selbst CDU-Anhänger sich eine weitere Amtszeit wünschen. Wie macht er das?

Gleich wird Bodo Ramelow in seine Vergangenheit hinabfahren, 800 Meter in die Tiefe. Das Bergwerk Merkers liegt im Westen Thüringens, an Hessens Grenze. Tausende Kilometer Stollen durchziehen die Landschaft unterirdisch.

Unter einem stählernen Förderturm warten an diesem warmen Augusttag der Leiter des Bergwerks, einige Politikerinnen und Journalisten. Zwei Dienstlimousinen mit Blaulicht fahren vor. Aus einer steigt Bodo Ramelow. Zusammen mit Gregor Gysi ist der Ministerpräsident Thüringens auf Wahlkampf-Wandertour. Beide sind mit Funktionshemden, Outdoorhosen und fabrikneuen Wanderstiefeln ausgerüstet. Dabei werden sie nach dem Bergwerksbesuch nur den 380 Meter hohen Hundskopf hochstapfen.

Zuvor fährt Ramelow in Merkers ein, heute ein Schaubergwerk mit Klettergarten und Konzerthalle. Die Kumpel, die hier noch arbeiten, sind vorwiegend mit Verfüllung beschäftigt, sie stopfen Hohlräume zu. Der Werksleiter schüttelt Ramelow die Hand. Ramelow boxt dem Mann daneben spielerisch vor die Brust. „Och, der Betriebsrat“, sagt er. Der Mann grinst.

Anfang der neunziger Jahre kämpfte Ramelow selbst als Arbeitnehmervertreter in Thüringen um Arbeitsplätze im Bergbau – gegen den westdeutschen Monopolisten, die Kali und Salz AG. Und gegen die Politik. Damals verlor er.

Fast 30 Jahre später kämpft er erneut um Arbeitsplätze im Bergbau. Diesmal zusammen mit K+S, wie die Kali und Salz AG heute heißt. Und die Politik ist er.

Selbstverständlich ist es nicht, dass die Gegner von einst nun Verbündete sind. So wenig wie es erwartbar war, dass die Linke, die erstmals einen Ministerpräsidenten stellt, nach fünf Jahren Regierung in Thüringen weder entzaubert noch zerstritten ist. Wenige Wochen vor der Landtagswahl führt sie sogar in den Umfragen.

Fast 25 Jahre hat die CDU das Land regiert. Bis 2014 Ramelow kam. Seit fünf Jahren führt er eine Koalition aus Linken, SPD und Grünen, die sich auf nur eine Stimme Mehrheit im Landtag stützt. Derzeit ist völlig offen, welche Konstellation nach dem 27. Oktober regieren könnte. Sicher ist nur: Wenn die Linke gewinnt, dann wegen Bodo Ramelow.

Die Partei weiß das. Alle Großplakate zeigen Ramelows Konterfei – mal als Lokführer, mal als Spaziergänger. Personenkult? Na klar doch.

„Seilfahrt“. Hinab saust der Korb mit Ramelow in die „Teufe“, wie es bergmännisch heißt. In der salzhaltigen Luft der Kaligrube erzählt Ramelow, jetzt in blauem Bergmannskittel und mit weißem Helm, in einer Bar in 807 Meter Tiefe, wie er sich 2015 mit dem Vorstandsvorsitzenden von K + S, Norbert Steiner, aussöhnte.

Kalischacht Bleicherode, Thüringen 8.JPG

Der Steiner sei ein Raubatz, wie er selbst, sagt Ramelow. „Alle haben gedacht: Weil ich damals auf der Seite der Kalikumpel war, würde ich niemals mit dem reden können.“ Aber man sei sich auf Augenhöhe begegnet und habe Frieden geschlossen.

Bodo Ramelow ist ein Mann der Gegensätze. Der Ministerpräsident ist aufbrausend und eitel, rechthaberisch und rauflustig. Mal kotzt ihn die Antifa an, mal der MDR. Mit Nazis und der AfD legt er sich seit jeher an. Wenn er auf Autofahrten allein mit seinem Handy ist, schwitzt sein Team. Ramelows Twitter-Scharmützel sind gefürchtet. Seine Mitarbeiter räumen hinter dem Chef auf.

Corinna Hersel traf Bodo Ramelow im Frühjahr 1990 zum ersten Mal. „Jetzt kommt der aus dem Westen und will uns die Welt erklären“, dachte sie damals. Hersel ist heute Verdi-Bezirksgeschäftsführerin, damals arbeitete sie für die Ost-Gewerkschaft Handel, Nahrung und Genuss. Ramelow, den die hessische Gewerkschaft Handel, Banken und Versicherung nach Thüringen entsandt hatte, traf dort auf viele tausend Frauen, die gerade ihre Arbeitsplätze verloren. Die Treuhand löste die Handelsorganisation der DDR auf. Von ihm habe man Wunder erwartet, erzählt Ramelow. „Die Menschen haben ja gedacht: Ich als Westdeutscher muss es wissen.“

Der Gewerkschaftssekretär aus Mittelhessen landet mitten im Osten und jener Umbruchzeit, deren Verwerfungen heute, 30 Jahre nach dem Mauerfall, wieder aufbrechen. Ramelow sieht, wie massenhaft Betriebe plattgemacht werden und sich Menschen von der gerade erkämpften Demokratie wieder abwenden.

Stunden hätten sie zusammen in Betriebsversammlungen verbracht, erzählt Hersel. Aus dem „arroganten Arsch“ wurde der Bodo – „einer, der immer für uns da war, den man auch mal nachts anrufen konnte“.

Der aber auch jähzornig sein kann. Als die Aktentasche mit dem frisch ausgehandelten Tarifvertrag beim Grillabend verschwindet, tobt er. Der Vertrag findet sich später in der Mikrowelle, jemand hatte sie als Tresor ausgewählt, als Ort für besonders Schützenswertes. Ramelow kann sich aber auch entschuldigen. „Das hat ihm viele Punkte eingebracht“, sagt Hersel.

Drei Jahre später, als auch die Kaligruben im Osten geschlossen werden sollen, wird aus dem Gewerkschafter Bodo der Politiker Ramelow. Die Schließung der Grube in Bischofferode 1993 habe ihn politisiert, erzählt Ramelow. „Sonst wäre ich immer noch der nette Gewerkschaftssekretär, der schaut, wann der nächste Tarifvertrag um die Ecke kommt.“

Die Treuhand-Anstalt, die das Volksvermögen der DDR privatisiert, plant damals die ostdeutschen Gruben mit dem westdeutschen Monopolisten Kali und Salz zu fusionieren. Der Schönheitsfehler: Zusammen produzieren die Gruben mehr Kali, als der Markt braucht, also sollen vor allem Gruben im Osten geschlossen werden. Die Bischofferoder Kumpel besetzen die Grube und treten im Sommer 1993 in den Hungerstreik. Die IG Bergbau macht nicht mit, stattdessen kommt der HBV-Sekretär Ramelow. „Wer bist’n du? Mach dich vom Tor“, empfangen ihn die Kumpel. Ramelow bleibt, obwohl er für Bergbau nicht zuständig ist. Er verstehe das Problem, sagt er, er wolle helfen.

Was der Gewerkschafter Ramelow damals nicht verstand: Bischofferode war nur ein kleiner Stein in einem größeren Spiel. In den geheimen Verträgen zwischen der Treuhand und Kali und Salz, die erst 20 Jahre später geleakt werden, stand, was viele ahnten: Die Schließung von Bischofferode war politisch gewollt. Die Treuhand hatte der Kali und Salz AG die Grube regelrecht aufgedrängt: Um den Erhalt von Jobs sollte sich der Konzern nicht scheren, für Verluste und ökologische Altlasten würden größtenteils die Steuerzahler haften. Die Arbeitsplätze im Westen waren wichtiger.

Als zum Jahresende 1993 alle Verhandlungen gescheitert sind, handelt Ramelow im Auftrag der Kumpel die Sozialpläne mit der Treuhand aus. Warum sie ihm doch vertraut haben? „Der war kein Phrasendrescher, hat sich reingekniet“, erzählt Gerhard Jüttemann, damals stellvertretender Betriebsratsvorsitzender. „Er war immer da: mit Informationen und Adressen – und vorbereitet, wie kaum einer sonst.“

Jüttemann, weißer Bart, schwarze Bergmannskluft, ist mit anderen ehemaligen Kumpeln nach Erfurt gekommen, wo die Rosa-Luxemburg-Stiftung im August 2019 eine Ausstellung über die Treuhand eröffnet. Es ist voll. Jüttemann erwartet Ramelow vor der Tür, sie begrüßen sich mit Schulterklopfen. „Bodo“ – „Gerd“.

Die Leiterin der Luxemburg-Stiftung spricht zur Eröffnung von der „Entwertung von Biografien“. Und sagt: „Es war nicht eure Schuld.“ Einige der Ältere weinen. Ramelow schaut zu Boden, nickt.

Bischofferode wird ein Wendepunkt: Menschen, die vier Jahre vorher noch skandierten „Wir sind ein Volk“, sind nun zutiefst enttäuscht. Und Ramelow? Tritt 1999 in die PDS ein, wird Fraktionschef in Thüringen, sitzt später im Bundestag, managt die Fusion von WASG und PDS zur Linken und kehrt nach Thüringen zurück.

2009 tritt er zum ersten Mal als Ministerpräsidentenkandidat an, die SPD koaliert aber als Juniorpartner mit der CDU. 2014 wird die Linke erneut zweitstärkste Partei, Ramelow schmiedet eine Koalition mit SPD und Grünen und stellte sich im Landtag zur Wahl. Im ersten Wahlgang fällt er durch. Im zweiten Versuch klappt es.

File:NNU đền Ngọc Sơn.jpg

Bodo Ramelows Besuch im Ngoc-Son-Tempel in Hanoi

In Ramelows Arbeitszimmer in der Staatskanzlei steht eine Lampe aus Metall – die letzte Grubenlampe aus Bischofferode. „Darum sitze ich hier“, sagt er, als die taz im Frühjahr 2017 auf der Besuchercouch sitzt. In Erinnerung an den schwersten Arbeitskampf im Osten kämpft er jetzt um die 4.500 Arbeitsplätze im Bergbau Thüringens.

Aber Kalivorräte sind endlich, außerdem wird die Lauge seit Jahren in den Fluss Werra entsorgt und versalzt das Wasser. Auch Ramelow weiß, dass die Zukunft anders aussieht.

Quelle        :      TAZ        >>>>>         weiterlesen

————————————————————-

Grafikquellen         :

Oben          —      Viessmann Luge World Cup Oberhof; Ministerpräsident Bodo Ramelow mit Schneemann „Flocke“; Maskottchen, mascot

  ———————————-

2.)   von Oben        —       Kalischacht Bleicherode, Thüringen

—————————

Unten       —       Casablanca1911 at Vietnamese Wikipedia

This work has been released into the public domain by its author, Casablanca1911 at the Wikipedia project. This applies worldwide.

Abgelegt unter Feuilleton, L. Thüringen, P. DIE LINKE, Überregional | 1 Kommentar »

Die Linke – Saarland

Erstellt von DL-Redaktion am 12. Oktober 2019

Prozess gegen Linke-Politiker wegen Titelmissbrauchs

BHPANAS.jpg

Saarlouis (dpa/lrs)

Der saarländische Linke-Politiker Andreas Neumann (45) muss sich wegen des Vorwurfs des Missbrauchs von Titeln vor Gericht verantworten. Es komme am 31. Oktober vor dem Amtsgericht Saarlouis zu einem Prozess, nachdem Neumann gegen einen Strafbefehl Einspruch eingelegt habe, teilte das Gericht am Freitag mit. Das Amtsgericht hatte am 4. September gegen Neumann einen Strafbefehl erlassen, weil dieser nach der Vorlage von Dokumenten einer nicht existierenden Universität fälschlicherweise über Jahre einen Doktortitel getragen haben soll.

Es erging eine «Verwarnung mit Strafvorbehalt» – quasi eine Geldstrafe auf Bewährung: Die Verurteilung zu 90 Tagessätzen zu je 50 Euro – also insgesamt 4500 Euro – sollte vorbehalten bleiben. Zudem wurde eine Bewährungsauflage von 1800 Euro ausgesprochen. Neumann habe sich im Rahmen des bisherigen Verfahrens zu dem Tatvorwurf nicht eingelassen, hieß es vom Gericht.

File:Amtsgericht, Prälat-Subtil-Ring 10, Saarlouis.jpg

Der Ortsverband der Linke in Saarbrücken-Malstatt hatte am 9. September beschlossen, einen Antrag auf Parteiausschluss von Neumann zu stellen, sobald der Strafbefehl gegen ihn rechtskräftig geworden sei. Nach Ansicht der Linken hat Neumann «dem Ansehen und der Glaubwürdigkeit der Partei» im Saarland schwer geschadet.

Quelle       :          Welt           >>>>>          weiterlesen

———————————————————————

Grafikquellen         :

Oben       —           dieLinke Stadtratsfraktion Saarbrücken 05.02.2010; Birgit Huonker, Andreas Neumann, Astrid Schramm

————————–

Unten       —      Amtsgericht, Prälat-Subtil-Ring 10, Saarlouis

Author Saarbraut

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

Abgelegt unter Medien, P. DIE LINKE, Saarland, Überregional | Keine Kommentare »

Aufgeklärt nach 50 Jahren

Erstellt von DL-Redaktion am 11. Oktober 2019

Antikolonialer Anschlag in Hamburg

Von Wolfgang Kraushaar

1969 detonierten auf einer Werft 20 Kilo Sprengstoff. Täter konnten nie ermittelt werden. Erst jetzt erfahren wir mehr über die Tat von Linken.

Der 13. Oktober 1969 ist ein Montag. Für die Bundesrepublik erweist sich der Wochenbeginn als ein schwarzer Tag. Die Bundeswehr verliert in der Nähe des Fliegerhorstes Memmingen ihren 100. Starfighter, jenes von der US-Rüstungsfirma Lockheed produzierte und 1958 vom damaligen Bundesverteidigungsminister Franz Josef Strauß trotz erheblicher Bedenken von Experten in hoher Stückzahl angekaufte Kampfflugzeug F-104 G. Auch wenn sich der 28-jährige Hauptfeldwebel Maximilian Ambs mit dem Schleudersitz retten kann, ist allein schon der symbolische Schaden enorm. Im Gegensatz zu einem anderen Vorkommnis dieses Tages stellt das Unglück eines der Top-Themen in der Presseberichterstattung des darauffolgenden Tages dar.

Im Hamburger Hafen gehen am frühen Morgen des 13. Oktober zwei Warnanrufe ein. Der erste erreicht um 6.13 Uhr eine Polizeistation, der zweite zwei Minuten später den Werkschutz von Blohm & Voss. Die 1877 gegründete Großwerft war mit der Produktion von Kriegsschiffen tief in den Nationalsozialismus verstrickt, wurde nach Kriegsende von den Briten geschlossen, teilweise demontiert, war aber 1955 wieder zugelassen worden und zu Beginn der sechziger Jahre dazu übergegangen, erneut Kriegsschiffe zu bauen. Ein anonymer Anrufer fordert: „Lassen Sie sofort die Korvette ‚João Coutinho‘ räumen: wir sprengen das Schiff in die Luft!“

Es dauert keine 20 Minuten, bis es tatsächlich so weit ist und um 6.32 Uhr ein Sprengsatz explodiert. Getroffen wird jedoch nicht so sehr das Kriegsschiff des Nato-Partnerlandes, sondern eine zwischen Kaimauer und der Korvette befindliche Schute. Den nicht sonderlich großen Kahn, der dem Transport von Gütern und Materialien dient, hat es so schwer erwischt, dass er in kurzer Zeit am Steinwerder-Kai versinkt. An der Korvette selbst, heißt es, sei nur geringer Sachschaden entstanden. Menschen sind nicht verletzt worden.

Die Reaktionen in der Presse sind eher bescheiden. Lediglich das Hamburger Abendblatt und die lokale Ausgabe der Bild-Zeitung informieren ihre Leser über das Ereignis. Später wird sich zeigen, dass das insbesondere bei den für den Anschlag Verantwortlichen für Verwunderung sorgt. Denn sie waren nicht nur davon überzeugt, dass sie eine spektakuläre antikolonialistische Aktion verübt hätten, sondern dass diese auch ohne die Verbreitung eines Bekennerschreibens durch das Medien-Interesse für die gewünschten Multiplikatoreneffekte sorgen würde.

Die Polizei tappt nach dem Anschlag im Dunkeln

Ganz im Gegensatz zum mangelnden Echo in der Presse widmen sich einige linke Gruppen und Zeitungen dem Anschlag. Überraschenderweise ist es aber eine niederländische Gruppierung, die als Erstes darauf reagiert. Ein in dem Nachbarland aktives Angola-Komitee lässt es sich nicht nehmen, die versuchte Attacke als antikolonialistische Aktion uneingeschränkt zu begrüßen. An Spekulationen beteiligen sich mehrere linksradikale Blätter. So wird etwa von der in Westberlin erscheinenden Wochenzeitung agit 883 behauptet, dass die Sabotageaktion von Werftarbeitern verübt worden sei.

Die mit dem Anschlag befassten Ermittler ­geben am Tag darauf bekannt, dass von den Tätern jede Spur fehle, man aber vermute, dass sie aus den Reihen einer antikolonialistisch eingestellten Organisation stammen würden. Konkret genannt werden das Governo Revolucionário de Angola no Exilio (Angolanische Revolutionsregierung im Exil, GRAE) und die Movimento Popular de Libertação de Angola(Volksbewegung für die Befreiung Angolas, MPLA). Diese beiden Organisationen würden auch, heißt es weiter, über Mitglieder in europäischen Studentenbewegungen verfügen. Mitglieder beider Organisationen hatten immer wieder mit Flugblattaktionen gegen den Bau derartiger Korvetten im Hamburger Hafen protestiert, zuletzt beim Stapellauf der „João Coutinho“ am 2. Mai.

Portugal tut im Übrigen so, als ginge es die Angelegenheit nichts weiter an. Ein Sprecher des in Hamburg befindlichen Generalkonsulats erklärt, dass „die Sache“ sie nicht betreffen würde. Solange die Schiffe nicht der Regierung ihres Landes übergeben worden und bis dahin Eigentum der Werft seien, hätten sie damit nichts zu tun.

Bei den 84 Meter langen und 10 Meter breiten Korvetten, die eine Besatzung von 70 Mann aufnehmen können, handelt es sich um eine eigene Schiffsklasse, die sogenannte „João-Coutinho“-Klasse. Die Schiffe verfügen über zwei 7,6-cm-Geschütze und zwei 4-cm-Maschinenkanonen in Doppellafetten. Portugal will sie zur Bekämpfung der in seinen Kolonien aktiven Guerillabewegungen einsetzen, die für die Unabhängigkeit ihrer Länder kämpfen. Nach ihrer Indienststellung sollen sie bei Patrouillenfahrten und Kampfeinsätzen in Angola, Mosambik, Guinea-Bissau und vor den Kapverden zum Einsatz kommen.

Trotz aller Anstrengungen verlaufen die von der Hamburger Staatsschutzabteilung K4 angestrengten Ermittlungen ergebnislos. Zwar sollen als verdächtig geltende Werftangehörige verhört und Mitglieder des Sozialistischen Lehrlingszentrums (SLZ) über Monate hinweg überwacht worden sein, aber niemand von ihnen wird festgenommen oder gar vor Gericht gestellt. Von den Urhebern des Anschlags fehlt jede Spur.

Erst 50 Jahre später beginnt die Aufarbeitung

Es wird schließlich ein halbes Jahrhundert dauern, bis sich das ändert. Die Betreffenden entscheiden, einen Bericht über Gründe und Hintergründe ihres Anschlags zu verfassen. Ihre Überlegungen sind eingebunden in einen kollektiven Erinnerungsprozess. Als sich die 68er-Bewegung im letzten Jahr zum 50. Mal jährte, trafen sich rund dreißig ehemalige Aktivisten – zum ganz überwiegenden Teil einstige Mitglieder des legendären Sozialistischen Deutschen Studentenbundes (SDS).

Die Hamburger Ehemaligen wollten es nicht bei einem einmaligen Treffen bewenden lassen, sondern einen Arbeitskreis bilden, um ihre eigene Geschichte aufzuarbeiten. Als ein Vorgriff auf diesen Schritt ist dem Autor von einem Sprecher der Ehemaligengruppe ein Anfang März 2019 verfasster Bericht zugestellt worden, in dem der Auslöser für den Anschlag im Hamburger Hafen sowie der Ablauf der Aktion minutiös dargelegt wird. Auch wenn niemand der daran Beteiligten bereit ist, mit seinem Namen nachträglich für das Geschehene einzutreten, so gibt es keinen plausiblen Grund, an der Authentizität ihrer Darstellung zu zweifeln.

Es ist allgemein bekannt, dass die „Entdeckung“ der Dritten Welt samt den zahlreichen in Afrika, Asien und insbesondere in Lateinamerika aktiven Befreiungsbewegungen zu den Schwerpunkten der 68er-Bewegung zählte. Diese Hinwendung war maßgeblich durch die Nachrichten vom Vietnamkrieg befördert worden. Die grauenerregenden Bilder, die Tag für Tag von den südostasiatischen Schauplätzen per TV zu sehen waren, erschütterten insbesondere große Teile der jüngeren Generation.

Der Antikolonialismus ging aber weit über Vietnam als US-Stützpunkt hinaus, denn es ging dabei auch um den Restbestand an von europäischen Mächten beherrschten Ländern wie Angola. Im Frühjahr 1969 wurde dieser Aspekt von den Protestierenden aufgegriffen. So schlug etwa der seit dem Mai 1968 wegen Verletzung der Rathaus-Bannmeile mit Haftbefehl gesuchte Karl Heinz Roth, ein SDS-Kader, die Durchführung einer eigenen Kampagne gegen den Neokolonialismus vor, in deren Verlauf auch über den von Portugal in seinen afrikanischen Kolonien praktizierten Krieg aufgeklärt werden müsse.

Diese Bezugnahme kam nicht von ungefähr, denn es war den Protestierenden bereits bekannt, dass drei für die portugiesische Marine bestimmte Korvetten demnächst vom Stapel laufen sollten. Aus diesem Grunde hatte sich auch die MPLA Anfang April in Schreiben an die Geschäftsleitung sowie den Betriebsrat von Blohm & Voss gewandt und darin festgestellt, dass mit dem Bau der Kriegsschiffe eine Entscheidung für den portugiesischen Kolonialismus und damit zugleich auch für die Unterdrückung des angolanischen Volkes gefällt worden sei.

Und am Ende desselben Monats meldete sich mit Amilcar Cabral der Anführer einer anderen Befreiungsbewegung, der in Guinea-Bissau einer an der afrikanischen Westküste gelegenen portugiesischen Kolonie – aktiven Partido Africano da Independência da Guiné e Cabo Verde (PAIGC) zu Wort. Er spitzte die Vorwürfe dahin­gehend zu, dass die bei Blohm & Voss gebauten Fregatten „für den Völkermord im Kolonialkrieg gegen unser afrikanisches Volk bestimmt“ seien. Er richte deshalb an alle Kräfte, die sich für Recht und Freiheit einsetzen würden, „… die dringende Aufforderung, der Kollaboration zwischen den Regierungen in Bonn und Lissabon auf politischer, militärischer, wirtschaftlicher und finanzieller Ebene durch wirksame Aktionen ein Ende zu setzen“.

Zur selben Zeit führte der AStA im Auditorium Maximum der Universität eine Informationsveranstaltung zu dem in immer weiteren Kreisen als skandalös betrachteten Fall des Korvettenbaus durch. SDS-Mitglieder verteilten dort ein Flugblatt, auf dem auch der Brief der MPLA abgedruckt war.

Eine Hamburger Kommune bedenkt, was man tun kann

Der Bericht aus der Gruppe von Hamburger Ex-SDSlern beginnt damit, dass der Besuch eines niederländischen Kamerateams geschildert wird, das im Herbst 1968 in einer Hamburger Kommune vorbeigekommen war, um nähere Informationen über die drei im Bau befindlichen portugiesischen Korvetten zu gewinnen. Die in der im Stadtteil Harvestehude gelegenen Hochallee 21 lebende Kommune hatte die Aufmerksamkeit des Filmteams errungen, weil in einigen zum Thema portugiesischer Kolonialismus verteilten Flugblättern ihre Adresse gestanden hatte.

Quelle         :          TAZ        >>>>>          weiterlesen

—————————————————————-

Grafikquellen      :

Oben       —          Werksgelände von Blohm + Voss: vorne die Einfahrt, mittig das Verwaltungsgebäude, rechts dahinter das Trockendock Elbe 17, oben rechts Dock 10

——————————

Unten       —           Blohm & Voss 1877

Abgelegt unter Hamburg, Kriminelles, Überregional, Wirtschaftpolitik | Keine Kommentare »

Rot – Rot oder der Tod

Erstellt von DL-Redaktion am 11. Oktober 2019

Die Linke: Was jetzt zählt…

Ein Vater der linken Krise ?

Die Zeichen stehen auf Rot-Rote-Zusammenarbeit im nächsten Bundestag. Denn eine weitere Kanibalisierung beider Parteien bedeutet das Ende einer starken Interessenvertretung der Lohnabhängigen in der Republik. Die Linke muss ihre internen Konflikte klären, um Teil eines Bündnisses mit der SPD zu werden und Personal in die nächste Fraktion entsenden, das die Erfahrung und Kompetenz besitzt Rot-Rot zu gestalten. Denn für eine radikale systemoppositionelle Ausrichtung ist die Partei weder organisatorisch noch kulturell vorbereitet.

Die Landtagswahlen in Brandenburg und Sachsen haben eine verunsicherte Linke hinterlassen. Daran wird auch der zu erwartende Bodo Ramelows Erfolg in Thüringen wenig ändern.

Denn auf Bundesebene hat die Partei den Niedergang der Sozialdemokratie in der Großen Koalition nicht nutzen können gesellschaftliche Räume und Diskurse zu besetzen, die durch die SPD-Destruktion geöffnet wurden.

Umfragewerte der SPD um 13 Prozent und bei den Linken um 7 Prozent zeigen die dramatische Erosion beider Parteien, die eigentlich die Vertreter der Arbeitnehmerinteressen im Bundestag sein sollten.

Wer sich die Genese dieses Abwärtstrends genauer anschaut, wird feststellen müssen, dass es hinsichtlich der Wählergunst eine symbiotische Beziehung beider Parteien gibt. Schon seit geraumer Zeit Gewinnen und Verlieren Linke und SPD in einem gemeinsamen Trend. Die Hoffnung Oskar Lafontaines hat sich zerschlagen, mit Gründung der Linken den kompletten Arbeitnehmerflügel  aus dem sozialdemokratischen Projekt zu extrahieren und damit quasi mittels einer eigenen neuen  Partei, die SPD von Außen zu kontrollieren. Der Glaube, dass er durch die Schwächung der SPD, die Regeln für eine neue Zusammenarbeit zwischen Linken und Sozialdemokratie diktieren konnte, hat sich nicht erfüllt. Bei den jetzt erreichten Umfragewerten ist eine gegenseitige Kanibalisierung nur noch Makulatur. Es ist klar: Die Linke kann die SPD nicht ersetzen.

Die Linke kann die SPD nicht ersetzen…

SPD und Linke werden daher zukünftig nur gemeinsam an Bedeutung gewinnen können und dies setzt voraus, dass beide Parteien miteinander in Schwingung geraten. Für dieses Schwingen werden vor allen Dingen in der Bundestagfraktion Akteure benötigt, die sowohl Kompetenzen im intrafraktionellen Wirken besitzen und die gleichzeitig darauf drängen, dass die ungeklärten Strategiefragen der eigenen Partei einer Lösung zugeführt werden.

Diesen Streit haben bisher Sahra Wagenknecht und Katja Kipping verkörpert. Die eine vertritt dabei vermeintlich das kosmopolitische Milieu der hippen urbanen Zentren. Erstere das traditionalistisch Arbeitermilieu. Freilich: Wagenknecht und Kipping haben sich bei diesem Zwist verausgabt. Keiner von beiden ist es gelungen ein Angebot an beide Milieus zu formulieren. Dass dies unmöglich gewesen wäre bleibt zu beweisen.

Denn zwischen den städtischen Milieus und der gewerkschaftlichen Arbeiterklasse gibt es einen gemeinsamen Nenner: Sie sind alle Lohnabhängige und zu ihrer Reproduktion auf den Verkauf ihrer Arbeitskraft angewiesen. Statt diese Milieus der Kosmopoliten und der Traditionalisten getrennt zu denken, ist deren gemeinsames gesellschaftlich historisches Schicksal der eigentliche Bezugspunkt beider gesellschaftlicher „Lager“.

Ein Vater der SPD Krise ? Die Mütter sind bekannt ?

Allerdings muss die Partei begreifen, dass Arbeitnehmerinteressen heute diverser sind. Der freie Mediengeestalter im urbanen Zentrum benötig eine andere Ansprache als der klassische Industriearbeitnehmer im gewerkschaftlichen Mitbestimmungsbetrieb eines Weltkonzerns. Es gibt aber keinen Grund nicht den verbindenden Nenner gleichen Nöte  zu finden und dafür in einem ideologischen rot-roten Bündnis Antworten zu geben. Beide Gruppen lohnabhängiger Interessen benötigen soziale und gesellschaftliche Sicherheit um eine lebenswerte und selbstbestimmte Zukunft gestalten zu können. Sie benötigen eine nachhaltige Absicherung für die Lebenszeit nach Beendigung ihrer Arbeitsbiografie. Und es muss in der Umverteilungspolitik eine klare Antwort dafür gefunden werden was soziale Teilhabe und ein würdiges Leben für diejenigen bedeutet, die nicht oder gerade nicht am Erwerbsleiben teilnehmen.

Antworten auf die Internationalisierung des Arbeitsmarktes und die ökologische Frage müssen gefunden werden…

Quelle       :        Potemkin           >>>>>         weiterlesen

————————————————————————-

Grafiquellen      :

Oben      —           Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

—————————————-

Unten        —        Scholz als SPD-Vize (2010)

  • CC BY-SA 2.0Hinweise zur Weiternutzung
  • File:2010-05-LPT 232.jpg
  • Erstellt: 2010-05-29 11:51:45

Abgelegt unter Niedersachsen, P. DIE LINKE, P.SPD, Überregional | Keine Kommentare »

Kein Platz für Antisemiten

Erstellt von DL-Redaktion am 11. Oktober 2019

Die angeblichen „Protokolle der Weisen von Zion“

PoleenWeiseVonZion.png

Quelle        :     Scharf  —  Links

Von Michael Lausberg

Die „Protokolle der Weisen von Zion“ sollen angeblich das Streben der Juden nach der Beherrschung der Welt beweisen. Die Verschwörungstheorie existiert seit langem und ist eins der Anknüpfungspunkte des modernen und auch des eliminatorischen Antisemitismus des neonazistischen Attentäters und Mörders am 9.10. 2019 in Halle an der Saale.

Die Echtheit des Dokuments, das Anfang des 20. Jahrhunderts erstmalig auftauchte, wurde von Beginn an angezweifelt. 1921 erschien in der ‚Times´ eine Artikelserie, in der die „Protokolle“ als Fälschung entlarvt wurden. Doch konnten derartige Hinweise die Verbreitung des Textes kaum aufhalten. Auch nicht das Urteil eines Schweizer Gerichts, das sich von 1933 bis 1935 mit der Entstehungsgeschichte des Dokuments befasste. Es stellte zwar fest, dass der Text ein Plagiat und dem Genre der „Schundliteratur“ zuzurechnen sei. Da aber der letztgenannte Teil des Urteils durch eine Berufungsinstanz zwei Jahre später wieder aufgehoben wurde, feierten Antisemiten das Verfahren dennoch als Bestätigung. Letztendlich ist die Echtheit des Dokuments den Anhängern der Verschwörungslegende angesichts der propagandistischen Wirkung ohnehin von zweitrangiger Bedeutung. Beweise konnten als Lügen der jüdischen Medienmacht abgetan und so selbst zum Bestandteil der Verbreitung werden.

Die so genannten Protokolle der Weisen von Zion sind eines der weitverbreitetsten und zählebigsten Dokumente des modernen Antisemitismus. In rechtsradikalen Kreisen dienen sie als das Beweisdokument für das vermeintliche Streben der Juden nach der Weltherrschaft. Der Text war und ist nicht zuletzt deshalb so erfolgreich, weil er für Menschen reaktionärer Denkweise eine einfache und griffige Welterklärung bietet, die sämtliche unerwünschte Erscheinungen der Moderne auf einen Verursacher zurückführt. Kern der Verschwörungslegende bildet eine geheime jüdische Verbindung, deren Ziel es sei, die traditionellen gesellschaftlichen Strukturen mit Hilfe von Demokratie, Liberalismus und Kapitalismus – im Zweifelsfall auch Sozialismus – zu zerstören und auf diese Weise die Weltherrschaft anzustreben.

Dabei konnte der Berner Prozess zweifelsfrei ermitteln, aus welchen Quellen sich die Schöpfer der „Protokolle“ bedient hatten. So z.B. den historisch-politischen Romanen von Hermann Ottomar Friedrich Goedsche. Der Redakteur der konservativen preußischen Kreuzzeitung war bestrebt, seiner Leserschaft eine antiliberale Überzeugung in einem geschlossenen Weltbild zu vermitteln. Seine Bücher, die er unter dem Pseudonym Sir John Retcliffe veröffentlichte, wären längst in Vergessenheit geraten, wäre da nicht eine Szene aus seinem Roman ‚Biarritz´ (1868). Sie spielt auf dem berühmten Prager Judenfriedhof, wo sich alle hundert Jahre die Vertreter der zwölf jüdischen Stämme treffen, um über den Stand der Welteroberung zu beraten. Der Autor führt an dieser Stelle die wesentlichen politischen und ökonomischen Entwicklungen der zweiten Hälfte des 19. Jahrhunderts auf die organisierten Aktivitäten der jüdischen Minderheit zurück. Damit leistete er einen bedeutenden Beitrag zur Popularität dieser Denkfigur und lieferte eine literarische Schablone, auf die andere Autoren zurückgreifen konnten. Die besagte Szene wurde seit 1881 auch in eigener Form als „Rede eines Oberrabbiners in geheimer Versammlung“ veröffentlicht und in zahlreiche Sprachen übersetzt.

Den Mythos der jüdischen Weltverschwörung hatte Goedsche damit nicht erfunden. Seine literarischen Anschuldigungen griffen ein in ganz Europa weit verbreitetes Phänomen auf, nämlich den im späten 19. Jahrhundert entstandenen modernen Antisemitismus. Dieser stellte ein wichtiges Verständigungsmittel reaktionärer Kräfte für ihren sozialen Protest dar. Der politische und ökonomische Umbruch jener Zeit verunsicherte viele Menschen, die sich anstelle der starren Ständegesellschaft nun der kapitalistischen Konkurrenzgesellschaft ausgesetzt sahen. Ihnen konnten die Juden als Wegbereiter und eigentliche Nutznießer der Moderne, als Sündenböcke für alles mögliche aktuelle Ungemach erklärt werden.

Das wilhelminische Kaiserreich stellte keineswegs einen Sonderfall in Europa dar. Um die Jahrhundertwende galt insbesondere Russland als Synonym für einen virulenten und gewaltsamen Antisemitismus, der sich im Gegensatz zu Westeuropa noch vornehmlich aus religiösen Motiven speiste. Dennoch griffen russische Rechtsextremisten auch auf deutsche Publikationen zurück und Bücher wie die „Rede eines Oberrabbiners“ waren weit verbreitet. Wer genau die „Protokolle“ letztendlich verfasste, konnte bis heute nicht zweifelsfrei geklärt werden. Eine vermutete Beteiligung des russischen Geheimdienstes oder der protofaschistischen Terrororganisation der „Schwarzen Hundertschaften“ ist letztendlich nicht nachzuweisen. Sicher ist nur, dass der Text 1903 in Russland zum ersten Mal publiziert wurde, bis zum Ersten Weltkrieg aber noch keine größere Wirkung erzielen konnte. Erst durch den Schock, ausgelöst durch Kriegsniederlage und bolschewistische Revolution, fanden die „Protokolle“ wieder verstärkt Beachtung. Nun zunehmend auch im westlichen Ausland.

La difesa della razza; Protocolli dei Savi di Sion.jpg

Im deutschen Sprachraum erreichte die „Protokolle“ bald zahlreiche Auflagen. Bereits 1922 diente die Legende zur Rechtfertigung bei der Ermordung des Reichsaußenministers Walter Rathenau. Ab 1929 erschienen die „Protokolle“ im Parteiverlag der NSDAP, welche die Rechte erworben hatte. Im Vorwort fand sich bereits ein Hinweis auf den bevorstehenden Völkermord: „Das kommende national-sozialistische Großdeutschland wird dem Judentum die Rechnung präsentieren, die dann nicht mehr in Gold zu bezahlen ist.“ Mit dem Machtantritt der Nationalsozialisten wurde die Verschwörungslegende dann zum offiziellen Lehrstoff an deutschen Schulen.

Die „Protokolle“ wurden bereits in fast jede Sprache der Welt übersetzt, auch wenn die Anziehungskraft der Verschwörungslegende in der westlichen Welt nach dem Ende des Zweiten Weltkriegs stark nachgelassen hat. Heute sind die sie der Mehrheit der Bevölkerung kaum noch bekannt. In der islamischen Welt stellen sie aber immer noch eine bedeutende propagandistische Waffe gegen den Staat Israel dar und insbesondere der Iran bemüht sich um eine weitere Verbreitung. Hierfür missbrauchen radikaler Islamismus wie westliche Ausschwitzleugner zunehmend das Internet, durch das sich auch Neonazi Stephan Balliet inspirieren und radikalisieren ließ.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————-

Grafikquellen       :

Oben      —         PoleenWeiseVonZion

Abgelegt unter Bücher, Kultur, Religionen, Überregional | Keine Kommentare »

Provinz und Metropole

Erstellt von DL-Redaktion am 9. Oktober 2019

So klappt’s auch mit den Nachbarn

Quellbild anzeigen

Essy von Anja Maier

Alle drängen in die Metropolen. Es braucht neue Strukturen, damit Dörfler gerne bleiben und Städter die Dörfer lieben lernen.

Sie wirken arglos. Aber sie sind es nicht. In der kleinen Brandenburger Gemeinde, die ich seit mehr als zwanzig Jahren meine Heimat nennen darf, treten sie in letzter Zeit vermehrt auf: Städter auf Immobiliensuche. Manche tragen Strohhütchen und ziehen Bollerwagen durch den Ort, drin sitzen ihre Kinder und nuckeln an Biobrezen. Andere preschen in Carsharing-Autos über die sandigen Schlaglöcher, steigen aus und schieben ihre Sonnenbrille ins Haar. Habitus: Ich weiß, ihr habt auf mich gewartet – jetzt bin ich ja da.

Ich beobachte sie von meiner Terrasse aus. Und sie tun mir leid. Ich sehe, wie sie, scheinbar beiläufig, über Hecken lugen und dabei Grundstücke und Häuser mustern. „Wie wäre es mit dem hier?“, fragen sie einander verstohlen und deuten mit einer Kopfbewegung auf die Laube unserer Nachbarin. Klick macht die Handykamera. Und tatsächlich, der Garten wirkt ungepflegt, das windschiefe Häuschen wie vergessen. Aber das ist es weiß Gott nicht. Denn gerade neulich erst hat die alte Frau P. ihr Grundstück verkauft. Und, halleluja, sie ist jetzt eine gemachte Frau. Strohhütchenmann und Sonnenbrillenfrau sind deutlich zu spät dran mit ihrer Idee, abseits des überteuerten Innenstadtbereichs nach was Eigenem zu suchen. Sorry, sold out!

Am liebsten würde ich sie am Ärmel zupfen und mit dem Finger weit ins Brandenburgische weisen, das nur achtzig Kilometer später schon Vorpommern heißt. Denn dort gibt es noch ausreichend Platz und Häuser und Wälder, samt Seen sowie Angler- und Jagdvereinen.

Es fehlt an Jobs

Aber ja, zugegeben, da draußen in der Provinz wartet auch jede Menge Unwägbarkeiten. Es fehlen die Jobs. Es ist umständlich, hinzukommen, und wirtschaftlich und habituell mindestens herausfordernd, dort sein Glück zu suchen. Die Provinz wählt zunehmend rechts, Provinzler gebärden sich als Opfer der Verhältnisse, denen sie es via Wahlschein heimzahlen zu meinen müssen. Auch wenn diese fatale, fast schon selbstverletzende Schlussfolgerung Unsinn ist – mit ihrem Gefühl der Zweitklassigkeit haben viele recht. Leider. Landschaft kann man bekanntlich nicht essen. Und Straßen, die ins wirtschaftliche Nichts führen, sind einfach nur sinnlos verbauter ­Beton.

Das muss sich schleunigst ändern. Die Dörfler sollten von der Politik durch gute Bedingungen dazu gebracht werden, zu bleiben, statt die Städte noch weiter zu verstopfen. Und die Urbaniten müssten den Umzug in die Provinz nicht als Niederlage, sondern vielmehr als Gewinn in mannigfacher Weise verstehen lernen. Das aber hieße: Es muss sich was ändern in diesem Land. Politisch, wirtschaftlich, ökologisch, kulturell.

Die Umstände und die Beziehungen zwischen Städtern und Provinzlern sind aktuell ziemlich gestört. Hier die Hinterwäldler mit dem Hang zum Fertighaus und dem Fahnenmast samt Schwarz-Rot-Gold im Schottergarten. Dort die elaborierten Urbaniten, die keinen bezahlbaren Platz finden, um ihren privaten Plan vom Glück umzusetzen. Wechselseitig ist jeweils eine ganze Menge Geringschätzung im Spiel. Und das, obwohl sich ein jeder nach dem jeweils anderen sehnt – nach der großartigen gefährlichen Stadt und dem entschleunigten Zauber des Ländlichen.

Toleranz und Interesse

Helfen könnten da ein bisschen mehr gegenseitige Wertschätzung und Toleranz sowie Interesse aneinander. Aber natürlich vor allem die gute alte Struktur- und Standortpolitik. Will sagen: Die Städter müssen raus ins Land gelockt werden. Und dafür muss das Land eine Verheißung sein, eine Anwartschaft auf ein anderes, aber vor allem ­gutes Leben in der gesellschaftlichen Mitte. Wenn das Dorf, die Kleinstadt nicht länger verdammt ist, sich selbst als die allenfalls dritte Wahl unter den gängigen Lebensentwürfen zu verstehen und von anderen auch so wahrgenommen zu werden – dann klappt’s auch wieder mit den Nachbarn.

Was es dafür braucht – manchmal nicht mehr, aber weitaus öfter auch noch nicht –, sind jene Netze, die der Mensch im 21. Jahrhundert grundsätzlich braucht. Der Deutsche Landkreistag hat das gemeinsam mit dem Bauernverband in diesem Sommer mal in einem Positionspapier an die Bundesregierung zusammengefasst. Die Forderungen sind derart naheliegend, dass man sich fragt, warum es überhaupt eine Kommission „Gleichwertige Lebensverhältnisse“ braucht, die seit Jahresfrist länglich und unter großem me­­dialem Getöse darüber berät, was wohl zu tun wäre, um mehr Menschen zu einem zufriedenen Leben zu verhelfen.

Kommunen und das Geld

Zum einen wäre da ein Nahverkehr, der die Menschen schnell, zuverlässig und sicher hi­nein- und hinausträgt. Zum Zweiten natürlich ein vernünftiges Breitbandnetz. Fangt endlich damit an, Herrgott! Und zwar bevor der letzte Handwerker, die beharrliche Architektin und der IT-Frickler ihre Gehöfte verlassen haben. Dann natürlich Ärzte. Und Kitas, Schulen, Horte, die ihren Namen verdienen. Außerdem: Jobs, Jobs, Jobs, und zwar nicht nur die miesen. Was wiederum bedeuten würde, Forschungseinrichtungen, Fachhochschulen, Behörden in der Provinz anzusiedeln. Schaut nach Bayern! Dort ist derlei seit Jahrzehnten politische Praxis. Und natürlich: Geld. Gebt den Kommunen endlich mehr Selbstbestimmung bei den Finanzen.

File:Migrants in Hungary 2015 Aug 007.jpg

Da sind mir die Nachbarn vom Dorf wesentlich angenehmer.

Und nicht zuletzt: eine neue, weitaus bessere Erzählung. Strukturschwach, abgehängt, vereinsamt – das ist das Wortbesteck der allermeist in den Landeshauptstädten lebenden und arbeitenden PolitikerInnen und Medienleute. Ihre Haltung: wohlmeinend; ihre Erzählung: mitleidig. Wer soll so was wollen, Leute?

Quelle         :       TAZ         >>>>>        weiterlesen

——————————————————————–

Grafikquellen         :

Oben     —       No Trespassing signs at an auction storage site in Putnam County, Tennessee, USA. „Trespassers will be shot on site,“ and „There’s nothing behind this gate worth dying for.“

Author Brian Stansberry
This file is licensed under the Creative Commons Attribution 3.0 Unported license.

—————————-

Unten      —          Migrants in Hungary near the Serbian border

Source http://szegedma.hu/hir/szeged/2015/08/migransok-szazai-ozonlenek-roszkerol-szegedre.html
Author Photo: Gémes Sándor/SzomSzed
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Feuilleton, Kultur, Mensch, Überregional | Keine Kommentare »

40 Jahre Die Grünen-Saar

Erstellt von DL-Redaktion am 7. Oktober 2019

 Ein Jubiläum für Petra Kelly und Greta Thunberg

Bündnis 90 - Die Grünen Logo.svg

Quelle     :      Scharf  —  Links

Von Dr. Nikolaus Götz

Im Sommer des Jahres 1979 fanden sich die ökologisch engagierten Menschen auch im Saarland zusammen, um anzufangen, etwas für den Klimaschutz zu tun. Doch diese Menschen wollten nicht nur protestierend durch die Straßen ziehen, sondern sie wollten in der Demokratie der Bonner Republik mit ihrer neuen Partei DIE GRÜNEN den Altparteien die politische Macht entreißen, um ökologische Reformen gegen das Wirtschaftsdiktat der Großindustrie wie das der Banken durchzusetzen. Dass dieses Ziel bis heute nicht erreicht wurde, ist wohl mit Ursache der neuen aktuellen ’Umweltrebellion’!

Aktiviert hatten vor 1979 diese ’Altgrünen’ nicht nur die aufrüttelnden wissenschaftlichen Expertisen von Umweltforschern (1972: Grenzen des Wachstums, durch den Club of Rome; 1977: Global 2000, durch Präsident Jimmy Carter, USA), sondern auch der desolate politische Zustand in der Bonner Republik unter der damaligen Regierung von Helmut Schmidt (SPD). Die damalige politisch alternative Jugendbewegung sah deshalb ’GRÜN’ und schloss sich dem Beispiel von Petra Kelly an, die wirklichen ’Lebensschutz’ für den Planeten Erde forderte, ebenso wie wirklichen ’Frieden’ für die in Ost-West gespaltenen Welt der Ära des Kalten Krieges sowie auch wirkliche ’Gleichberechtigung’ für die Frauen in der westlichen Industriegesellschaft.

Doch die damaligen ’Wutreden’ von Petra Kelly verhallten fast ungehört, obgleich ihr gezeigtes politisches Engagement zur Gründung der Partei Die Grünen führte, eine Partei, deren Mitglieder vielerorts vom „breiten Publikum“ diffamiert, als kommunistisch beschimpft und von den damaligen konservativen Parteien, zu der auch die SPD gehörte, stark bekämpft wurden. Das Unverständnis gegenüber den GRÜNEN, das sich bis heute in der Volksmeinung verfestigt hat, kumulierte sich negativ in Äußerungen wie: „Die GRÜNEN sind wie eine Tomate, zunächst grün und dann doch rot!“ Aber die eher Mitleid zeigende, doch positiv gemeinte Variante der politischen Kritik an der unverstandenen Partei DIE GRÜNEN wandelte den berühmten Slogan, „Wir haben die Erde nur von unseren Kindern geborgt“ (Wahlplakat DIE GRÜNEN), um in die elterlich herablassende, zustimmendes Verständnis vorgebende Meinung: „Die GRÜNEN sind Kinder, die noch erwachsen werden müssen!“

Doch unvergesslich, weil immer noch aktuell, sind die Worte auch der saarländischen Urgrünen in ihrem Gründungsaufruf vom 22. 9. 1979, in dem zu lesen steht:

„An alle

Umwelt und Naturschützer

Atomenergiegegner

Gegner eines zerstörerischen Wirtschaftwachstums

Freunde einer ökologischen Verkehrs- und Umweltpolitik

Freunde des biologischen Landbaus

an alle,

die den wirtschaftlich-technisch-politischen Gigantismus ablehnen und eine Politik nach Menschenmaß befürworten

die einfacher leben wollen und die Lebensqualität materieller Verschwendung vorziehen

die sich für die Bewahrung der Lebensgrundlagen für uns und für unsere Nachkommen verantwortlich fühlen…“

sie alle sind eingeladen zur Gründungsversammlung eines Landesverbandes der neuen Partei DIE GRÜNEN-Saar am 6. 10. 1979. Zu dieser ersten Versammlung ins Hotel Waldeck in Dillingen/Saar kamen immerhin 67 Personen wobei 36 Anwesende Gründungsmitglieder wurden. Heute 40 Jahre nach der Parteigründung im Saarland sind die Namen dieser Personen immer noch aus Rechtschutzgründen unveröffentlicht, obgleich sie als Avantgarde der deutschen Ökologiebewegung sich den Verdienst erworben haben, die Vorreiter der heuten Schülerprotestbewegung Fridays-for-Future-Bewegung zu sein. Das gestrige Engagement der Deutsch-Amerikanerin Petra Kelly (verstorben 1992; siehe auch: Wikipedia: Petra Kelly) weißt so hin zu ihrer heutigen ’Erbin’ Greta Thunberg, die von den berichtenden Medien gepuscht, den Schülerinnen und Schüler weltweit als ökologischer ’Revoluzzerin’ verkauft wird. Wie notwendig jedoch ein ökologischer Druck der Bürger auf die Konsumindustrien wäre, zeigt die einfache Tatsache, dass beispielsweise der Lebensmittelkonzern REWE die Einführung von Papiertüten bei seinen Kunden als besondere ökologische Leitung verkauft, parallel dazu aber, das Einkaufen in wiederverwendbaren metallenen Einkaufsdosen nicht  gestattet. Und so marschieren Altgrüne mit den Junggrünen gemeinsam auf dem langen Marsch durch die Institutionen der Industriegesellschaft, wobei der Klimawandel unentwegt mitschreitet.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————

Grafikquellen       :

Oben            —      Logo von Bündnis 90/Die Grünen

Abgelegt unter Bundestag, P.Die Grünen, Saarland, Überregional | 1 Kommentar »

Die fehlende Linke Substanz

Erstellt von DL-Redaktion am 5. Oktober 2019

Der lange Abschied der Sahra Wagenknecht

Eine Analyse von

Der Rückzug von Sahra Wagenknecht vom Fraktionsvorsitz könnte sich weiter verzögern. Das hat auch mit dem strategischen Dilemma zu tun, in dem die Linkspartei steckt.

Im März dieses Jahres hatte Sahra Wagenknecht ihren Rückzug vom Fraktionsvorsitz der Linkspartei aus gesundheitlichen Gründen angekündigt. Ein halbes Jahre später ist sie immer noch im Amt – und der Abschied könnte sich weiter hinziehen. Der Fraktionsvorstand im Bundestag werde der Fraktion vorschlagen, die Fraktionsspitze erst im Januar neu zu wählen, sagte der Parlamentarische Geschäftsführer Jan Korte den Zeitungen des RedaktionsNetzwerkes Deutschland.

Sollte die Fraktion dem zustimmen, wäre dies nun bereits die zweite Verschiebung. Ursprünglich hatte die Neuwahl im Juni – nach der Europawahl – stattfinden sollen. Wegen der wichtigen Landtagswahlkämpfe im Osten wurde der Termin dann auf November verschoben, wenn mit Thüringen das letzte und für die Linkspartei wichtigste ostdeutsche Bundesland gewählt hat. Schließlich geht es dort um die Verteidigung des Ministerpräsidentenamtes. Interne Streitigkeiten sollten den Wahlkampf nicht belasten, da waren sich im Mai ausnahmsweise mal alle einig gewesen. Warum aber jetzt eine erneute Verschiebung auf Januar?

In der Fraktionsvorstandssitzung vor einer Woche wurde darüber bereits heftig gestritten. Denn Wagenknechts Kritiker und Kritikerinnen, von denen es in der Fraktion eine Menge gibt, fürchteten natürlich, die prominente Frontfrau habe es sich anders überlegt und wolle nun doch im Amt bleiben. Wagenknecht habe in der Sitzung jedoch versucht, diesen Verdacht zu zerstreuen, berichten Teilnehmer. Sie sei fest entschlossen, den Fraktionsvorsitz abzugeben, soll sie dort erneut versichert haben.

Erst mal auf die SPD warten

Fraktionschef Dietmar Bartsch führt als Argument für die Verschiebung ins Feld, dass es besser sei, erst mal den SPD-Parteitag im Dezember und die damit zusammenhängende Entscheidung über die Fortsetzung der großen Koalition abzuwarten, bevor man selbst eine wichtige strategische Entscheidung treffe. Dahinter steckt wohl die Überlegung, dass die Fraktionsvorsitzenden bei der vergangenen Bundestagswahl auch die Spitzenkandidaten der Linkspartei waren. Sollte die Bundestagswahl vorgezogen werden, könnte die jetzige Fraktionsvorsitzendenwahl also auch eine Entscheidung über die Spitzenkandidatinnen sein.

Für Gegner und Gegnerinnen der Verschiebung ist dieses Argument allerdings nicht einleuchtend. „Wir brauchen dringend ein Aufbruchssignal“, sagt zum Beispiel die bayerische Abgeordnete Nicole Gohlke. Eine weitere Verzögerung der Wahl findet sie deswegen nicht glücklich. „Wir würden doch im November auch nicht die B-Liga wählen“, sagt eine andere Abgeordnete. Ohnehin gibt es keine zwangsläufige Verbindung zwischen Fraktionsvorsitz und Spitzenkandidatur. Wahrscheinlicher ist deswegen, dass Teile der Fraktion entweder hoffen, durch eine weitere Verschiebung die Besetzung des neuen Fraktionsvorsitzes in ihrem Sinne beeinflussen zu können – oder ihn mit der Neubesetzung des Parteivorstands, der regulär erst im kommenden Frühsommer ansteht, verbinden zu können.

Letztendlich macht der Streit um die Verschiebung der Vorsitzendenwahl so erneut das generelle strategische Dilemma der Linkspartei deutlich. Bei den vergangenen Wahlen hatte die Linkspartei deutliche Verluste hinnehmen müssen. Vor allem aber verliert sie seit Jahren besonders stark bei ihrer traditionellen Klientel: den Arbeitslosen und Arbeitern.

Auf Kurssuche

In der Partei wird deswegen schwer darum gerungen, wie man sich künftig ausrichten will, um zu verhindern, dass man Wählerinnen und Wähler auf der einen Seite an die Grünen und auf der anderen an die AfD verliert.

Bunte Westen 03.jpg

Wagenknecht und ihre Anhänger stehen dabei für einen migrationsskeptischen Kurs. Sie lehnen insbesondere die von der Parteispitze um Katja Kipping und Bernd Riexinger vertretene Forderung nach offenen Grenzen ab. Arbeitsmigration wollen sie eher begrenzen als erweitern. Und sie glauben, dass ein starker Sozialstaat am besten in nationalstaatlichen Grenzen zu organisieren ist. Das Kipping-Lager will die Linke dagegen als eine weltoffene, proeuropäische und sozial-ökologische Partei profilieren. Sie haben dabei auch die jüngeren Wählergruppen aus dem Großstadtmilieu im Blick.

Quelle          :            Zeit-online           >>>>>         weiterlesen

————————————————————–

Grafikquellen      :

Oben           —           Der Rechte Flügel ? Blogsport  / Ein ganzes Leben wie Göttin und Gott in Frankreich  – andere Arbeiten lassen !

——————————–

Unten      —         „Bunte Westen“ protest in Hanover, 16th february 2019

Abgelegt unter Opposition, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Ein Stadtgespräch aus Essen

Erstellt von DL-Redaktion am 1. Oktober 2019

RWE baut das Portfolio um – Heuchlerische Pläne

Kuckum.jpg

Von Ingo Arzt

Die RWE feiert sich dafür, dass man jetzt auf Ökoenergien macht. Dabei ist der Konzern viel zu spät dran und zerstört weiterhin Dörfer für die Kohle.

Sie nennen sich „Menschenrecht vor Bergrecht“ und hatten zumindest am Montag keine Chance gegen RWE: Der Essener Energiekonzern generierte eine Menge positiver Schlagzeilen an der Börse und in der Wirtschaftspresse. Am Morgen präsentierte Vorstandschef Rolf Martin Schmitz die Neuaufstellung des Konzerns und bastelte daraus eine Jubelmeldung.

Fast zeitgleich schickten Anwohner*innen des Tagesbaus Garzweiler II einen Brief an Schmitz. Sie forderten eine „Klarstellung, dass in Zeiten des beschlossenen Kohleausstiegs und der Klimakrise keine Dörfer mehr für den Kohleabbau zerstört werden dürfen“. Der Konzern will die Orte Keyenberg, Kuckum, Berverath, Ober- und Unterwestrich und weitere trotz Kohleausstiegs zerstören und abbaggern. Das, obwohl Berechnungen etwa des Deutschen Instituts für Wirtschaftsforschung ergeben haben, dass für die Restlaufzeit der Kraftwerke bis 2038 mehr als genug Kohle in den vorhandenen Tagebauen abgebaut werden kann.

Schmitz‘ Konzernumbau ist deshalb heuchlerisch. Bis 2040 will er RWE „klimaneutral“ und zu einem weltweiten Player für erneuerbare Energien machen. Bereits 2018 hat RWE dabei mit Eon, dem zweiten großen deutschen Energiekonzern, das Terrain in Sachen Energiewende abgesteckt: Die beiden Energiealphatiere haben die Eon-Tochter Innogy unter sich aufgeteilt. Eon bekommt die Stromnetze, die wegen der Energiewende digitaler und intelligenter werden müssen, und außerdem das Geschäft mit den Endkunden, also uns. RWE übernimmt dafür komplett die Stromerzeugung aus erneuerbaren Energien von Eon und Innogy.

20170613 xl P1120777-Ostsee-Windpark-zwischen-Deutschland-und-Schweden.jpg

Kurzum, beide Konzerne kommen sich nicht in die Quere, in guter, alter Tradition: Seit der Weimarer Republik haben sich in Deutschland RWE und die Firmen, aus denen Eon im Jahr 2000 zusammenfusioniert wurden, den deutschen Strommarkt staatlich abgesegnet fein aufgeteilt. In den Nullerjahren sprachen sich die Konzerne regelmäßig ab, das Bundeskartellamt sprach damals von einem „Duopol“.

Quelle         :      TAZ        >>>>>        weiterlesen

———————————————————————

Grafikquellen        :

Oben        —        Beschreibung Bildbeschreibung: Ortseingang Kuckum. Quelle: eigenes Foto… Fotograf/Zeichner: bodoklecksel 20:31, 25. Jun 2006 (CEST) Datum: Juni 2006… Sonstiges: …

Abgelegt unter Nordrhein-Westfalen, Überregional, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Saar-Linke ohne Neuanfang

Erstellt von DL-Redaktion am 1. Oktober 2019

Kein Angebot des Sammel-Pärchen aus ihrer Teflonpfanne

Es würde für Thomas Lutze mit Sicherheit nicht einfacher sich mit einstigen Brandstiftern an einen Tisch zu setzen. Nachgiebigkeit ist nicht immer die beste Basis für eine erfolgreiche Zusammenarbeit. Vielleicht bleibt man am Ende nur mit Luschen in den Händen zurück.

Von Christoph Schmidt-Lunauon

Thomas Lutze wurde mit großer Mehrheit zum neuen Chef gewählt. Doch der Saar-Linken-Parteitag war von Zankerei geprägt und endete im Eklat.

An diesem Sonntag war Bundesprominenz nach Wiebelskirchen angereist. Linken-Bundesgeschäftsführer Jörg Schindler überbrachte eine Botschaft für den Landesverband, der bei Wahlen nach wie vor zweistellige Ergebnisse einfährt, aber gleichzeitig vor allem mit Affären und gegenseitigen Anfeindungen Schlagzeilen macht: „Wir möchten, dass ihr zur politischen Arbeit zurückkehrt,“ rief Schindler.

Doch die Botschaft aus Berlin verpuffte. Auch dieser Parteitag der Saar-Linken war von persönlichen Angriffen, dem Streit über Geschäftsordnung und Redezeiten bestimmt. Mit großer Mehrheit wählten die Delegierten zwar einen neuen Chef, den parteiintern umstrittenen Bundestagsabgeordneten Thomas Lutze. Der gelobte auch Besserung, es werde fortan nur noch um Inhalte und Politik gehen. Doch zum Ausklang des Tages löste eine Personalie einen Eklat aus.

Es ging um die Kandidatur des Linken-Kommunalpolitikers Mekan Kolasinac für den Posten eines Beisitzers. Im Jahr 2017 hatte der für Schlagzeilen gesorgt, als der den Bundesvorsitzenden Bernd Riexinger als „falschen, hinterlistigen Juden“ beschimpft hatte. Die nachgeschobene Entschuldigung, er habe nicht „Jude“ sondern „Judas“ schreiben wollen, war nicht überall gut angekommen.

Neujahrsempfang Linke Saarbrücken.jpg

Aus Protest gegen ihn hielt deshalb die Parteijugend eine Flagge Israels in die Kameras. Eine „bodenlose Frechheit“ polterte der neue Landesvorsitzende und kündigte „Konsequenzen“ an. Die israelische Fahne, die ja auch die Fahne der Opfer des Holocaust sei, für parteiinterne Auseinandersetzungen zu missbrauchen, sei „vollkommen daneben“, sagte Lutze am Montag der taz; mit dem guten Ergebnis für Kolasinacs Wahl hätten die Delegierten in diesem Konflikt klar Position bezogen: „Der hat damals einen Fehler gemacht und sich entschuldigt; da muss man es auch mal gut sein lassen.“

Machtkampf entschieden

Quelle     :          TAZ          >>>>>          weiterlesen

———————————————————————

Grafikquellen          :

Oben          —         Grafikquelle:   Rodena de, gem. AWDL – ohne inhaltliche Übernahme der Artikelinhalte – frei zur Nutzung bei Quellnennung)“

————————–

Unten    —

Oben             —        Thomas Lutze auf einer Neujahrsempfangsansprache in Saarbrücken

Abgelegt unter P. DIE LINKE, Positionen, Saarland, Überregional | Keine Kommentare »

Linker – LPT. an der Saar

Erstellt von DL-Redaktion am 30. September 2019

Thomas Lutze neuer Chef der Saar-Linken

Neujahrsempfang Linke Saarbrücken.jpg

Von dpa

Nach mehr als eineinhalb Jahren hat die Saar-Linke einen neuen Vorstand und mit Thomas Lutze einen neuen Vorsitzenden. Nach heftigen internen Auseinandersetzungen riefen viele Delegierte die Partei zu Geschlossenheit auf.

Neunkirchen – Der Bundestagsabgeordnete Thomas Lutze ist der neue Vorsitzende der Linken im Saarland. Auf einem Parteitag in Neunkirchen-Wiebelskirchen konnte sich der 50-Jährige am Sonntag bereits im ersten Wahlgang überraschend klar mit 73,6 Prozent der Delegiertenstimmen gegen zwei Mitbewerber durchsetzen. Lutze ist seit 2009 Bundestagsabgeordneter, er zog jeweils über die Landesliste ins Parlament ein. Der Maschinenbauer ist in Elsterwerda (Brandenburg) geboren, in Leipzig aufgewachsen und lebt seit 1991 im Saarland. Derzeit ist er noch Vorsitzender des Kreisverbandes Saarbrücken.

LAG Brauereikultur Treffen TL.jpg

Wie die Zeit vergeht und der Titel steht !

Als seine Stellvertreter gewählt wurden Andrea Neumann, Kreisvorsitzende in Neunkirchen sowie die Landtagsabgeordnete Barbara Spaniol und Michael Bleines, Stadtverordneter in Saarbrücken.
Damit hat die Saar-Linke nach eineinhalb Jahren Vakanz wieder einen neuen Vorstand. Lutzes Vorgänger Jochen Flackus hatte wenige Monate nach seiner Wahl im November 2017 das Amt aus gesundheitlichen Gründen niedergelegt.
Quelle        :         Allgemeine Zeitung

Kommentar auf SR 3

Saar-Linke: „Chaos nach innen und nach außen“

Ein Kommentar von Florian Mayer Die Linken im Saarland haben sich gestern zum Landesparteitag in Wiebelskirchen getroffen. Wichtigster Tagesordnungspunkt: die Wahl eines neuen Landesvorsitzenden. Der Chefposten in der Partei war seit anderthalb Jahren vakant. Thomas Lutze wird ihn nun besetzen. Er soll eine Partei, die geprägt ist von Streit und Skandalen, politisch wieder auf Kurs bringen.
Chaos. Chaos nach innen. Chaos nach außen. Anders lässt sich der Zustand der Linken an der Saar schon seit Monaten nicht mehr beschreiben. Daran hat auch der gestrige Landesparteitag nichts geändert – im Gegenteil er hat das Chaos, in dem sich Die Linke befindet, nur noch anschaulicher gemacht.
—————————————————————
Grafikquellen        :

Oben             —        Thomas Lutze auf einer Neujahrsempfangsansprache in Saarbrücken

Abgelegt unter Feuilleton, P. DIE LINKE, Saarland, Überregional | 131 Kommentare »

Maria 2.0 wird scheitern

Erstellt von DL-Redaktion am 28. September 2019

– aber auf christliche Weise

Demonstration der Initiative Maria 2.0 nach einer Priesterweihe im Freiburger Münster (2).jpg

Von Philipp Gessler

Scheitern ist kein Problem im Christentum, zumindest kein größeres. Zur Erinnerung für den religiös unmusikalischen Teil der taz-Leserschaft: Jesus von Nazareth, auf den sich das Christentum bekanntlich beruft, endete als verschmähter Aufrührer im römischen Palästina der Zeitenwende am Kreuz, öffentlich zu Tode gefoltert – auf den ersten Blick nicht unbedingt der Messias und König, auf den das jüdische Volk so sehnlichst wartete.

Nun, die wenigen Anhängerinnen und Anhänger des so offensichtlich gescheiterten Wanderrabbis betonten, dass er nach drei Tagen auferstanden und ihnen noch leibhaftig, samt Kreuzesnarben, begegnet sei – das Ganze also kein wirkliches Scheitern war. Aber das überzeugte halt nur sie. Immerhin ist die Anhängerschaft Jesu seitdem beachtlich gestiegen: Weltweit sind es rund 2,2 Milliarden Menschen, allein in Deutschland über 40 Millionen.

Diese Definition von Scheitern sollte man im Kopf haben, wenn man sich die Initiative Maria 2.0 anschaut. Sie vereint in den deutschsprachigen Ländern Hunderte, wenn nicht Tausende Katholikinnen. Ihre Forderung: Zugang von Frauen zu allen Weiheämtern, wie das im katholischen Duktus heißt, also: das Frauenpriestertum. Dazu eine wirkliche Aufarbeitung des Mega-Skandals der sexualisierten Gewalt im Raum der katholischen Kirche. Schließlich das Ende des Pflichtzölibats, also der Ehelosigkeit katholischer Priester.

Die Mittel der „Maria 2.0“-Aktivistinnen (nur fürs Protokoll: Es sind auch ein paar Männer dabei): Sie verweigern ihren Dienst in der Kirche, also zum Beispiel das ehrenamtliche Schmücken des Altars, das Putzen der Kirche oder die Kinderbetreuung in den Gemeinderäumen. Auf Deutsch gesagt: Sie haben keinen Bock mehr, die Drecksarbeit zu machen, während nur Männer alle Macht behalten und in der Öffentlichkeit glänzen können, ja allein berechtigt sind, das Zentrum der katholischen Frömmigkeit, die Eucharistie, zu feiern.

Jetzt die Steile These: Maria 2.0 wird scheitern – aber auf christliche, genauer: katholische Art und Weise. Das bedeutet: am Ende eigentlich nicht.

Es ist nicht zu erwarten, dass die katholischen Bischöfe in Deutschland, der Papst in Rom oder gar ein weltweites Konzil zu Lebzeiten der „Maria 2.0“-Aktivistinnen das Frauenpriestertum einführen. Die deutschen Katholiken dürften das gar nicht allein, aber vor allem sind dafür die Beharrungskräfte in der Weltkirche noch viel zu stark, und das nicht unbedingt nur im Vatikan. Man frage zum Beispiel einmal polnische oder afrikanische Bischöfe, was sie vom Frauenpriestertum (und von der Homo-Ehe) halten.

Aber eines Tages wird es das Frauenpriestertum auch in der katholischen Kirche geben, vielleicht zu der Zeit, wenn wir auch den Mars besiedelt haben. Ob dann aber die katholische Kirche noch eine Rolle spielt, ist nicht ausgemacht. Die Mehrheit der Frauen wird sie bis dahin wahrscheinlich verloren haben.

Die meisten Frauen, die sich bei Maria 2.0 engagieren, dürften ähnlich denken – aber ihr Handeln ist dennoch aller Ehren wert, ja dringend nötig. Denn sie halten das Thema, genauer: den Skandal der offensichtlichen Diskriminierung der Hälfte der katholischen Christenheit in der Öffentlichkeit. Sie benennen es als das, was es ist, nämlich eine weder biblisch, noch historisch, noch theologisch zu begründende Idiotie, Schweinerei und Herzlosigkeit.

Demonstration der Initiative Maria 2.0 nach einer Priesterweihe im Freiburger Münster (4).jpg

Jesus hat sich nie, auch nicht mit einer Silbe oder einer irgendwie so zu interpretierenden Aussage, gegen das Frauenpriestertum ausgesprochen. Im Gegenteil war sein Umgang mit Frauen seiner Zeit weit voraus. In den ersten Jahrzehnten des Christentums gab es Apostelinnen, unter anderem Maria Magdalena, und Gemeindevorsteher*innen – und aus diesem Kreis entstand später das Priestertum der christlichen Kirche. Auch theologisch ist die Argumentation, die das Priestertum nur Männern zubilligt, im besten Fall abenteuerlich, in der Regel aber schlicht absurd. (Eine solch irrwitzige „Argumentation“ lieferte jüngst etwa der emeritierte katholische Dogmatik-Professor Karl-Heinz Menke aus Bonn.)

Quelle       :           TAZ          >>>>>          weiterlesen

————————————————————————–

Grafikquellen       :

Oben         —          Demonstration der Initiative „Maria 2.0“ nach einer Priesterweihe im Freiburger Münster. Sie kämpft dafür, dass Frauen ALLE Ämter in der römisch-katholischen Kirche bekleiden können.

Abgelegt unter Mensch, Religionen, Überregional, Wirtschaftpolitik | Keine Kommentare »

Von deckeln und enteignen

Erstellt von DL-Redaktion am 28. September 2019

Erfolg oder Scheitern des Mietendeckels wird auf der Straße entschieden

Redler.jpg

Quelle        :        AKL

Von Lucy Redler, Berlin

Ohne die Berliner Mieter*innenbewegung der letzten Jahre und die Initiative “Deutsche Wohnen & Co enteignen” würde in der Hauptstadt Mitte Oktober kein Mietendeckel beschlossen. Die Debatte der letzten Monate über Enteignung von großen Immobilienkonzernen zeigt, wie eine kleine Initiative eine Stimmung in der Bevölkerung aufgreifen und in Aktivität für eine weitgehende Forderung entwickeln und dabei weitreichende Zugeständnisse erreichen kann. 

Die Idee des Mietendeckels war zu Beginn eine Reaktion der SPD auf den Vorstoß der Initiative “Deutsche & Co enteignen”. Diese fordert, Immobilienkonzerne mit mehr als dreitausend Wohneinheiten zu enteignen und in öffentlicher Hand zu demokratisieren. Dabei wurde sie von der LINKEN unterstützt. Der Versuch der SPD, der Initiative durch einen Mietendeckel den Wind aus den Segeln zu nehmen, scheiterte, da die Bewegung und auch Die LINKE auf eine Kombination von Mietendeckel und Enteignung setzen.

Ende August wurde ein Entwurf für den Mietendeckel aus der Senatsverwaltung für Stadtentwicklung geleakt, die der LINKE-Senatorin Katrin Lompscher untersteht. Dieser wurde von Mieter*inneninitiativen in der Stadt als großer Wurf gefeiert. Das Wichtigste an dem Entwurf: Fünf Jahre sollte es keine Mieterhöhungen mehr geben. Ein allgemeiner Anspruch auf Mietsenkung sollte entstehen, wenn die Nettokaltmieten eine Obergrenze von 3,42 Euro bis 7,97 Euro übersteigen.

Die Immobilienwirtschaft, die bürgerlichen Medien, FDP, CDU und AfD schrien Zeter und Mordio, die Berliner Morgenpost behauptete gar, DIE LINKE wolle Berlin “anzünden”. Aber auch SPD und Grüne kritisierten den Entwurf öffentlich.

Abschwächung des Entwurfs 

Der Leak war von der LINKEN und der Senatsverwaltung nicht beabsichtigt. Dabei wäre gerade die Veröffentlichung einer radikalen, mit den anderen Parteien im Senat  nicht abgestimmten Position ein positives Beispiel dafür, wie DIE LINKE im Senat agieren sollte: Die eigenen Positionen selbstbewusst in der Öffentlichkeit vertreten, mit Bündnispartner*innen der außerparlamentarischen Bewegung für ihre volle Umsetzung kämpfen und das gesellschaftliche Kräfteverhältnis durch den Aufbau von Gegenmacht so verschieben, dass mehr durchsetzbar wird. In jedem Streik passiert genau das.

Leider wurde der Entwurf nach massivem Druck der Immobilienwirtschaft und der anderen Parteien stark verwässert. Die Position der Grünen war auf einmal, dass Mieterhöhungen weiter möglich sein müssten. Dabei sei daran erinnert, dass es auf Bundesebene in den 1940er Jahren ein Mietendeckel eingeführt wurde, der bis 1972 galt, in West-Berlin gar bis 1988.

Die wesentlichen Änderungen des abgeschwächten Mietendeckels sind:

  • Höhere Richtwerte für Mietobergrenzen von bis zu 9,80 Euro pro m², abhängig vom Baujahr und Ausstattung
  • Zur Berechnung wird der Mietspiegel 2013 statt des Mietspiegels 2011 herangezogen
  • Liegen Mieten unter den Richtwerten, sind Erhöhungen von jährlich 1,3 Prozent möglich
  • Modernisierungszuschläge sind bis zu 1 Euro pro m² möglich, für Modernisierungen der letzten fünfzehn Jahre kann die Mietobergrenze zudem um 1,40 Euro pro m² angehoben werden
  • Ausnahmeregelungen für Vermieter*innen bei “unbilligen wirtschaftlichen Härten”
  • Statt einem allgemeinen Anspruch auf Mietsenkung gibt es einen individuellen Anspruch für Menschen, deren Nettokaltmiete die Obergrenze und dreißig Prozent des Haushaltseinkommens „bei angemessener Wohnungsgröße“ übersteigt.

Rechtssicherheit?

Ein Argument der Koalition, das auch von der LINKEN vertreten wird, ist die Rechtssicherheit des Mietendeckels, damit er gegenüber Klagen vor dem Bundesverfassungsgericht Bestand hat. Der Republikanische Anwaltsverein hat ausführlich begründet, dass es durchaus möglich ist, einen scharfen Mietendeckel rechtssicher zu formulieren. Zudem sollte es DIE LINKE mit Ferdinand Lassalle halten, demzufolge Rechtsfragen Machtfragen sind und auch ein Bundesverfassungsgericht die Stimmung im Land zur Kenntnis nehmen wird.

Durch den neuen Entwurf wären viel weniger Menschen anspruchsberechtigt. Aus einer Untersuchung des Soziologen Sigmar Gude geht hervor, dass ein Fünftel der Berliner mindestens dreißig Prozent des Haushaltseinkommens für die Kaltmiete aufbringen.

„Wird einbezogen, dass die Wohnungsgröße angemessen sein muss, reduziert sich der Kreis der Anspruchsberechtigten für eine Mietsenkung jedoch auf nur noch knapp zehn Prozent.“

Der Kreis der Anspruchsberechtigten würde sich zudem

„voraussichtlich sogar noch weiter reduzieren. Denn einen Anspruch auf Absenkung soll es nur dann geben, wenn die neuen Mietoberwerte, die zwischen 5,95 und 9,80 Euro pro Quadratmeter für normal ausgestattete Wohnungen liegen, überschritten werden.“

Wie weiter?

Natürlich wäre auch der jetzige Mietendeckel-Entwurf ein gewisser Fortschritt zum Status Quo und ein Eingriff in das Eigentumsrecht. Er würde jedoch viel zu wenige Mieter*innen betreffen und der Run der Immobilienkonzerne auf Berlin wäre nicht gestoppt, weil mit der Miete weiter ordentliche Profite gemacht werden können.

Daher ist es richtig, jetzt alle Kraft darauf zu verwenden, für die Kernelemente des ursprünglichen Entwurfs und die Forderungen von “Deutsche Wohnen &Co enteignen” zu mobilisieren und die vom Berliner Mietenbündnis geplante Großdemonstration am 3. Oktober unter dem Motto “Richtig deckeln, dann enteignen – Rote Karte für die Spekulation” zu einem Erfolg zu machen:

  • Für einen allgemeinen gesetzlichen Anspruch auf qualitative Mietsenkung
  • Runter mit den Mietobergrenzen, Stopp jeglicher Mieterhöhungen und Modernisierungszuschläge
  • Mietendeckel ohne Ausnahmen

Die wesentlichen Rückschritte des veränderten Variante müssen zurückgenommen werden.

Im Aufruf zur Demo heißt es zurecht:

“Lasst uns verhindern, dass die Koalition unter dem Druck der Immobilienlobby noch weitere Zugeständnisse macht! (…) Wir brauchen jetzt einen Mietendeckel, der hält und uns langfristig vor Mieterhöhungen schützt. Der keine Ausnahmen zulässt und die überteuerten Mieten wirksam senkt. Zusätzlich brauchen wir verlässliche Bedingungen für Sozialmieter*innen, wir brauchen Schutz vor Zwangsräumungen und den sicheren Erhalt von Jugendzentren und Freiräumen in der Stadt. Für einen echten Kurswechsel brauchen wir Wohnraum in der Hand der Gesellschaft. 

Im Oktober wird über den Mietendeckel entschieden. Bringen wir unseren Protest auf die Straße: Mit einem löchrigen Deckel geben wir uns nicht zufrieden. Zeigen wir dem Senat, dass wir erst den richtigen Mietendeckel, dann die Enteignung der Immobilienkonzerne wollen! Wir wollen Wohnraum, der nicht als Ware gehandelt wird, und eine Stadt, in der alle leben können.“

Die Warnung des Bündnisses vor weiteren Zugeständnissen an die Immobilienwirtschaft ist mehr als berechtigt. So hat sich der Regierende Bürgermeister Michael Müller (SPD) am 18. September bereits öffentlich gegen die Möglichkeit von Mietsenkungen ausgesprochen und damit einem Kernelement des Mietendeckels eine Absage erteilt.

Rolle der LINKEN

Der Landesverband der LINKEN ist nun gefordert, sich mit voller Kraft an der Vorbereitung und Mobilisierung zur Demonstration zu beteiligen. DIE LINKE Neukölln hat bei ihrer Mitgliederversammlung Anfang September einen offenen Brief an die zuständige Senatorin der LINKEN und die Fraktion im Abgeordnetenhaus beschlossen, in dem es unter anderem heißt:

“Holt den ursprünglichen Entwurf aus dem Hinterzimmer, diskutiert ihn mit uns und lasst ihn uns gemeinsam mit den Miet-Aktivist*innen verteidigen!“

Der Bezirk plant Mobilisierungsaktionen mit eigenen Plakaten und Flugblättern. Nun ist es am Landes- und den anderen Bezirksverbänden, bei der Mobilisierung nachzuziehen und einen Beitrag zum Aufbau von Initiativen und einer starken Bewegung zu leisten.

Der Landesverband sollte außerdem einen außerordentlichen Landesparteitag nach der Demo und vor der Senatsentscheidung im Oktober durchführen, um zu diskutieren und zu entscheiden, wie sich die Abgeordnetenfraktion und die Mitglieder des Senats angesichts des gesellschaftlichen Kräfteverhältnisses in Verhandlungen im Senat verhalten sollen. Wenn SPD und Grüne darauf beharren, dass Mieterhöhungen möglich sein müssen oder sich Müller damit durchsetzen sollte, Mietsenkungen auszuschließen und dadurch die Koalition in Frage gestellt wäre, müssten SPD und Grüne dies den Mieter*innen in Berlin erklären und es wird deutlich, wo die Konfliktlinien verlaufen.

Gleichzeitig ist es wichtig, dass DIE LINKE dabei hilft, die Bewegung für Enteignung von Immobilienkonzernen weiter aufzubauen und verhindert, dass der Initiative durch den Senat juristische Steine in den Weg gelegt werden. Für die Initiative ist es wichtig, zeitnah mit der zweiten Stufe beginnen zu können.

Gewerkschaften

Auch die Gewerkschaften müssen jetzt ins Boot geholt werden, um die Demo am 3.10. zu einem Erfolg zu machen. Bisher unterstützt die Gewerkschaft ver.di die Demonstration. Um politisch über die Forderungen aufzuklären und zu mobilisieren, wären Betriebsversammlungen mit entsprechenden Informationen ein erster Schritt einer gewerkschaftliche Kampagne. Wichtig ist, auch die Kolleg*innen, die bei den Immobilienkonzernen, Genossenschaften und städtischen Wohnungsbaugesellschaften beschäftigt sind, politisch für den Mietendeckel und die Forderung nach Enteignung gewinnen.

Aber selbst wenn der Mietendeckel in der verschärften Form käme, würde das die grundlegenden Probleme nicht lösen. Rouzbeh Taheri, einer der Sprecher der Initiative “Deutsche Wohnen & Co enteignen”, wies gegenüber dem Tagesspiegel darauf hin, dass der Deckel zeitlich befristet sei und die Konzerne zudem Mittel und Wege hätten, diesen zu umgehen, um ihre Profite zu erhalten und zu steigern, beispielsweise durch Umwandlung von Mietwohnungen in Eigentumswohnungen, die Reduzierung der Kosten für Instandhaltung oder die Erhöhung der Nebenkosten.

Mietendeckel löst grundlegende Probleme nicht

Im Kapitalismus werden die großen Konzerne immer wieder Umgehungsstrategien finden, um ihre Profite zu steigern. Das ist keine Ausnahme, sondern die Triebfeder dieses Systems, das auf Profitmaximierung und Konkurrenz basiert. Die Enteignung der größten Immobilienkonzerne wäre ein riesiger Schritt, um die Mondmietpreise zu stoppen. Es wäre eine politische Ermutigung, auch in anderen Bereichen die Eigentumsfrage zu stellen. Trotzdem stünden die vergesellschafteten Konzerne weiterhin in Marktkonkurrenz gegenüber privaten Konzernen in Deutschland und international.

Es ist Aufgabe der LINKEN, die Offenheit gegenüber der Idee der Enteignung dazu zu nutzen, um Debatten zu befördern, wie eine sozialistische Systemalternative aussehen könnte und wie wir solche Ideen heute verbreiten können.

Ganz praktisch geht es darum, zu helfen, die Demo zu einem Erfolg zu machen und einen Beitrag zur Organisierung von Mieter*inneninitiativen zu leisten.

Wenn die Großproteste von Fridays for Future und die Mietenbewegung eines zeigen, dann, dass die wesentlichen Erfolge nicht im Parlament oder von Regierungen, sondern auf der Straße, in Schulen und Betrieben erstritten werden.

Lucy Redler ist Mitglied im Parteivorstand DIE LINKE, aktiv in der SAV und Bundessprecherin der Antikapitalistischen Linken (AKL).

Dieser Beitrag wurde zuerst auf www.sozialismus.info veröffentlicht.

akl - Antikapitalistische Linke

—————————————————————-

Grafikquelle        :          Lucy Redler, * 17. awgusta 1979, Hann. Münden

Abgelegt unter Niedersachsen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Alte – Linke Hüte an der Saar?

Erstellt von DL-Redaktion am 28. September 2019

High Noon im Saarland

Von Jana Frielinghaus

Überall im Westen der Republik ist die LINKE im Aufwind. Ausnahme: das Saarland. Ausgerechnet hier, wo die Partei gemessen an der Einwohnerzahl überdurchschnittlich viele Wähler und Genossen gewinnen konnte, befindet sie sich in einer dramatischen Situation – die ausschließlich hausgemacht zu sein scheint.

Am Sonntagnachmittag soll auf einem Parteitag in Neunkirchen ein neuer Landesvorstand gewählt werden. Allein: Bislang ist nicht bekannt, wer überhaupt kandidiert. Der Posten des Landesvorsitzenden ist seit anderthalb Jahren vakant, Stellvertreterin Barbara Spaniol war für »nd« am Donnerstag nicht zu erreichen.

Einer wird zumindest erneut antreten: Landesschatzmeister Manfred Schmidt bewirbt sich wieder um dieses Amt. Im Gespräch mit »nd« sagte er am Donnerstag jedoch zugleich: »Ich wage zu bezweifeln, dass ich wiedergewählt werde.« Zu oft habe er Kollegen im Vorstand »auf die Füße getreten«. Innerhalb des Gremiums gebe es bereits seit acht Jahren zwei Lager, die miteinander im Clinch liegen, sagt Schmidt. Die Auseinandersetzungen hätten aber weniger politische als persönliche Gründe. Die Fronten verliefen zwischen Anhängern des ehemaligen LINKE-Bundesvorsitzenden und heutigen Landtagsfraktionschefs Oskar Lafontaine und solchen des Bundestagsabgeordneten Thomas Lutze. Viele Genossen wollten sich die Arbeit in vergiftetem Klima nicht mehr antun, daher werde es wohl wenig Interesse an Vorstandsposten geben, sagt Schmidt.

Rücktritte gab es seit der letzten Vorstandswahl Ende 2017 einige. So legte Landeschef Jochen Flackus sein Amt im Februar 2018 nieder. Gegen einen der beiden noch amtierenden Stellvertreter, Andreas Neumann, liegt seit Anfang September ein Strafbefehl wegen Titelmissbrauchs vor.

Spieglein, Spieglein im Hintergrund – guck ich so krank oder seit ihr gesund?

Seit Wochen ist die LINKE Saar nur seinetwegen in den Schlagzeilen. Neumann hat bislang lediglich erklärt, er werde nicht erneut für den Vorstand kandidieren. Seinen Rücktritt hat er bislang nicht erklärt. Vielmehr hat sein Verteidiger gegen den Strafbefehl Einspruch eingelegt, wie die »Saarbrücker Zeitung« am Mittwoch berichtete. Das Amtsgericht Saarlouis hatte gegen ihn eine »Verwarnung mit Strafvorbehalt« verhängt, diese jedoch zur Bewährung ausgesetzt. Er soll eine »Bewährungsauflage« in Höhe von 1800 Euro zahlen. Eine Verurteilung zu 90 Tagessätzen à 50 Euro behält sich das Gericht vor. Neumann hat laut Staatsanwaltschaft über Jahre einen von der nicht existierenden »St. Paul University and Lancaster University« verliehenen Doktortitel geführt.

Quelle          :        ND         >>>>>         weiterlesen

—————————————————————–

Grafikquellen        :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

——————————

Unten         —       Red. DL/Saar – privat  /Aufnahme vom Fernseher – licensed under  C C Attribution-ShareAlike 3.0 Unported License.

Abgelegt unter P. DIE LINKE, Positionen, Saarland, Überregional | Keine Kommentare »

Zündler und Rohrkrepierer

Erstellt von DL-Redaktion am 25. September 2019

Beginnen die Finger an der Saar auch zu zittern
oder erstarren sie im Schmutz

 

Leo Stefan Schmitt – zwischen Oskars gefährlichste Waffe und einem einfachen Rohrkrepierer

Von Maximilian Heiligenreich

Er hat sich einen Namen gemacht und letztlich eine Spur der Zerstörung hinterlassen. Zuerst läuft bei Leo Stefan Schmitt alles nach Plan. Er wird Polizist, Sozialdemokrat und dann viele Jahre Landtagsabgeordneter in Oskars SPD. Alles in trockenen Tüchern, könnte man meinen.

1999 war Schluss mit dem eigenen Abgeordnetendasein. Peter Müller (CDU) wurde Ministerpräsident an der Saar und die SPD landete auf den ungewohnten Oppositionsbänken. Trotz der Titel innenpolitischer Sprecher und parlamentarischer Geschäftsführer der SPD hatte seine Partei einen anderen im Wahlkreis Saarlouis ganz nach vorgestellt und Schmitt geriet ins Abseits. Daraus entstand ein Trauma, dass sein weiteres politisches Leben prägte.

Doch seine Beziehungen reichten noch so weit, dass er im Jahr 2000 angestellter Geschäftsführer der SPD-Landtagsfraktion im weit entfernten Freistaat Sachsen wurde. Dort hatte man 40 Jahre Erfahrungen mit Saarländern, wenn auch nicht aus Bous sondern aus Wiebelskirchen. Der Platz an der parlamentarischen Sonne war bei gleichem Gehalt zwar futsch. Aber den blöden Ossis zu erklären wie Politik funktioniert, dass durfte schon drin sein. In Sachsen konnte Schmitt nicht viel kaputt machen. Die Ost-SPD wurde als West-Partei wahrgenommen. Die Einheimischen wählten, wenn sie überhaupt wählen gingen, entweder die regierende CDU oder die oppositionelle PDS.

Und wenn beides nicht mehr ging, dann die Nazis von der NPD.

Schmitt hatte zwar sein Auskommen, aber auch Langeweile in der Fremde. Da passte es gut, dass Oskar Lafontaine der SPD endgültig tschüss sagte und mit PDS und WASG DIE LINKE gründete. Und hier wurden alte Fachkräfte dringend gebraucht. Auch Schmitt folgte seinem großen Führer, wenn auch mit drei Jahren Verspätung. Schließlich wechselt ein richtiger Schmitt erst, wenn der neue Job sicher ist.

Den Job gab es in Bremen. Dort erreichte DIE LINKE 2006 erstmals Landtagsmandate im Westen. Politisch erfahrene Leute fürs Parlament hatte man zwar. Es gab aber nur wenige, die den parlamentarischen Betrieb aus dem ff konnten. Die Chance für den Saar-Leo als Fraktionsgeschäftsführer. Bis 2011, dann war Finale. Schmitt ging als leitender Angestellter gegen seine eigenen Chefs vor und makelte die Listenaufstellung für die zweite Wahlperiode. Allerdings ohne Erfolg. Er wurde bei vollem Gehalt freigestellt, was er mit dem Spruch kommentierte: „Ich mache mir einen schönen Lenz“.

Die Pause dauerte nicht lange. Die Bundesgeschäftsstelle der Linken suchte einen erfahrenen Geschäftsführer für den hoffnungslos zerstrittenen Landesverband Rheinland-Pfalz. Schmitt war frei und wurde nach Mainz delegiert. Aufbau West so das Motto. Trotz dem Titel DIE LINKE erreichte der Nachbarlandesverband von Oskars Hochburg nur landesweite Wahlergebnisse im West-PDS-Format – also unter ferner liefen. Da Schmitt bei aller Erfahrung auch nicht zaubern kann, zettelte er lieber den Streit mit den gewählten Parteimitgliedern an. Und hier suchte er sich gerade mit dem Bundestagsabgeordneten Alexander Ulrich einen engen Oskar-Vertrauten und WASG-Gründungsmitglied als Hauptfeind heraus. Vorwurf wie in Bremen: Mitgliederlisten und Listenaufstellungen seien manipuliert. Auch wenn Schmitt mit diversen Anzeigen und Gerichtsverfahren alle Register zog, scheiterte er. Und Schuld waren natürlich wieder alle anderen, nur nicht er.

Bildergebnis für Wikimedia Commons Bilder Gregor Gysi

Zurück in der Saar-Dispora blieb Schmitt Parteimitglied. Eine aktive Mitarbeit schloss er aber lange aus Altersgründen und Desinteresse aus. Als Ende 2017 ein neuer Landesvorstand für einen personellen Neuanfang gesucht wurde, meldete sich Schmitt, wenn auch nicht ganz freiwillig. Zuvor war auf einem Landesparteitag der Versuch gescheitert, einen ehemaligen AFD-Funktionär als Landesgeschäftsführer zu installieren. Da der Oskar-Vertraute Jochen Flackus (MdL) bereits als Landeschef gewählt war, brauche man nun ganz schnell einen Ersatz für den peinlichen AFD-Mann. Schmitt ließ sich überreden und wurde gewählt.

Seine Amtszeit dauerte nur wenige Monate, dann warf er zusammen mit Flackus und Heinz Bierbaum hin. Sich demokratischen Gepflogenheiten zu unterwerfen, wonach das gemacht wird, was eine Mehrheit im Vorstand entschieden hatte, war weit unter Schmitts Niveau. Und trotzdem reichte der Titel „ehemaliger Landesgeschäftsführer“ noch aus, um aktuell in der Saarbrücker Zeitung Schlagzeilen gegen die eigene Partei zu produzieren. Bremen und Mainz lassen grüßen.

Linke Kettenhunde an der Saar

Ein Besserwisser zurück an die Saar ?

Grafikquellen      :

Oben      —           Wikipedia – Dieses Werk wurde von seinem Urheber the Eadweard Muybridge Online Archive als gemeinfrei veröffentlicht. Dies gilt weltweit.

—————————–

Unten        —        Wahlplakat

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license. Subject to disclaimers.
Attribution: Rjh1962 at the English language Wikipedia

Abgelegt unter P. DIE LINKE, Saarland, Überregional | 14 Kommentare »

„F f. f.“ in Bad Kreuznach.

Erstellt von DL-Redaktion am 25. September 2019

Erlebnisse und Eindrücke auf der DEMO
„Fridays for future“ in Bad Kreuznach.

Bahnhof Kreuznach Front.jpg

Quelle     :        Scharf  —  Links

Von Wolfgang Gerecht

Gegen 11:30 Uhr sammelten sich nacheinander die Demonstrant Innen, Schüler und Erwachsene, junge und ältere Menschen am Bahnhof in Bad Kreuznach.

Mit hunderten selbstgemachten Schildern auf denen ihre Forderungen an die Politik phantasievoll mit Wort und Bild dargestellt werden, zogen sie durch die Innenstadt von Bad Kreuznach.

Für mich beeindruckend war das beschriftete Leinen-Tuch mit dem Text:

„WARUM für die ZUKUNFT lernen wenn ihr sie ZERSTÖRT?“  und das Schild“

„Euch gehen die Ausreden aus UNS DIE ZEIT“.

Aus meiner Sicht, richten sich solche Fragen und Aussagen inhaltlich sehr treffend an die Bundesregierung aus CDU-CSU-SPD.

Besondere Verantwortlichkeit trifft  die Ober-BremserIn einer sachgerechten Umwelt und Naturschutz-Politik, die heutige Bundeskanzlerin Frau Merkel. Ausgerechnet sie war von 1994 bis 1998 Bundesministerin für Umwelt, Naturschutz und Reaktorsicherheit in der Regierung von Bundeskanzler, Herr Kohl.

Diese war von den einkaufenden Passanten und Mit-Bürger Innen stark frequentiert, zumal an diesem Freitag-Mittag die Markt-Beschicker aus Bad Kreuznach und Umgebung vor Ort waren. Frisches Obst und Gemüse, selbsthergestellte Fleisch und Wurstsorten bis Fisch, Käse und das übliche Angebot aus der Region Bad Kreuznach waren im Angebot.

Die „Fridays for future“ Aktivisten vorwiegend jung aber auch von einer bedeutenden Anzahl älterer Menschen begleitet, konnten ihre Forderungen an die Politik in Berlin deutlich bei den Menschen vor Ort bekannt machen. Dazu bedienten die Schüler Innnen sich auch nicht nur der Info auf Papier sondern benutzen auch Laut-Sprecher-Geräte um die einkaufenden Mit-Bürger Innen auch akustisch gut zu erreichen.

Der nicht enden wollende „Zug“ durch die Innenstadt führte über die Nahebrücke. Am Ufer der Nahe, in Blickweite der Paulus-Kirche, endete der Demonstrations-Zug, der von den Veranstaltern mit ca. 1.200 Teilnehmer Innen angegeben wurde. Am Endpunkt der „DEMO“ waren Tische u Bänke mit mehren Zelten aufgebaut. Dort konnten sich diejenigen die nicht mehr so gut bei Fuß waren niederlassen. Hungrige sich mit Essbarem und Getränke versorgen.

Für gute Stimmung sorgte die gute Musik einer Band zur  Freude aller TeilnehmerInnen.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————-

Grafikquelle      :      Train station of Bad Kreuznach

Abgelegt unter Opposition, Rheinland-Pfalz, Überregional, Umwelt | Keine Kommentare »

Im Westen nichts Neues:

Erstellt von DL-Redaktion am 24. September 2019

’Fridays for Future’
mit immerhin 1% der Saarländer!

Quelle       :          Scharf  —  Links

Von Dr. Nikolaus Götz

Es hätten auch weniger Teilnehmer sein können! Doch wenn man den Angaben der ermittelnden Polizei Glauben schenkt, dann haben allein am letzen Freitag in Saarbücken, der Landeshauptstadt der westlichsten Westprovinz der B(erliner) R(epublik) D(eutschland), sich unglaubliche „10 000“ Menschen für eine weitergehende Klimapolitik engagiert und sind mit ihren Forderungen protestierend auf die Straße gegangen. Wie der politisch Engagierte weiß, korrigiert die ’objektiv’ schätzende Staatsmacht unbewusst-bewusst jedoch solche Anzahldaten stets nach unten, denn „Ruhe“ ist bekannter Weise die „erste Bürgerpflicht“. Natürlich halten die Organisatoren des ’Ereignisses’ stets mit einer größeren Teilnehmerzahl dagegen, allein schon um ihre eigene Bedeutung und die Größe der Einflussnahme zu erhöhen.

Ob es nun mehr oder weniger Teilnehmer waren, sicher ist, dass die ’Deutsche Ökologiebewegung’ in der saarländischen Region seit langem keine solch große Anzahl an Unterstützern aktivieren konnte. Alles was da Rang und Namen hatte war zusammengekommen, wobei ein buntes Bündnis von inzwischen etablierten Umweltorganisationen und Anderen, wie beispielsweise Parteien und Gewerkschaften, die Vielfalt der ’Freitags für eine Zukunft’-Bewegung unterstützte: BUND, Campact, Greenpeace, Klima-Allianz, NABU, Naturfreunde-Saar, TogetherforFuture, ParentsforFuture, PeopleforFuture, Attac, DGB, Pax-christi, Friedens-Netz-Saar, Solid u.a. seien beispielsweise genannt. Dieses NGO-Konglomerat, ebenso wie die für einen geordneten und friedlichen Ablauf des Demonstrationszuges sorgende Polizei und die unwahrscheinlich gute, sonnige Wetterlage, machte den Freitags-Demo-Erfolg möglich. Deshalb sei der den Startschuss gebenden, aufsässigen ’Jugend’ an dieser Stelle besonders gedankt! Geholfen hat der Protestmarsch zwar nicht und er hat auch fast nichts politisch bewirkt, denn das trotzige Geschreie der noch unmündigen Kinder (Vgl. auch: scharf-links.de vom 20. September 2019: Fridays for future in Saarbücken: „Wenn Kinder brüllen dürfen!“) wurde von ihrer deutschen ’Mutti’ in Berlin glatt überhört. Diese war nämlich gerade dabei, ihre neuste ’Fehlgeburt’ zur Klimapolitik in die Welt zu setzen, wobei die im Kreissaal anwesenden, unterschiedlichsten ’Väter’ für diesen hässlichen ’Bastard von Missgeburt’ die Verantwortung mittragen.

Der stolze Weckruf der rund 10 000 saarländischen ’Kinder’ verhallte ungehört, zumal „die Erde ja keine Bank ist!“(Alternativer politischer Slogan) Doch und zudem, immer wieder diese Wessi-Wessis oder auch „Saarländer“! Wie jeder richtige Bundesbürger weiß, ist das Saarland ein dicht bewaldetes deutsches Bundesland. Es liegt direkt an der Grenze zu Frankreich und Luxemburg, weswegen die Saarländer sich durch ihre besondere ’Frankreichkompetenz’ von allen anderen Deutschen unterscheiden. Seinen definitiven Namen hat dieser lothringische Landstrich, ehemals einerseits bayerisch und anderseits preußisch, erst ab 1918 nach seinem Hauptfluss „die Saar“ erhalten. Wie bekannt wechselten die Saarländer in den zurückliegenden Zeiten mehrfach ihre ’Mutter’. Stiefmütterlich von Deutschland behandelt saugten sie an der Mutterbrust von ’Marianne’ das französische Sponsoring ein, zumal diese ’kämpferische Jungfrau’, die Saarländer innig liebend, sie so gerne auf ewig adoptiert hätte. Doch die braven ’Saarfranzosen’ (99%) kehrten stets heim zur ’Mutter Deutschland’ sei es ins Reich oder zuletzt in den Bund. Und so kommt es auch, dass die Identität oder die Mentalität der Saarländer zweigeteilt ist: Sie trinken Bier wie im Ruhrpott oder saarvorieren ihren Mosel-Saar-Ruwer-Wein à la française. Während ihr Herz für die revoltierenden ’Gillet jaunes’ (Gelbwesten) in Frankreich schlägt, erdulden sie, doch laut maulend, ihre Regierung im fernen, ’preußischen’ Berlin.

„10 000“ Teilnehmer im Saarland, titelt überrascht wie erschreckt das regionale Zeitungsblatt (Vgl.: Saarbrücker Zeitung, vom 21./22./9. 2019) und deren Leser denken beeindruckt: „Wau – so viele protestierende Saarländer!“ Wie jeder Demograph aber weiß, hatte das Saarland im Jahr 2017 genau 994 187 Einwohner, eine Zahl, die für 2019 jedoch wohl noch geringer ist. Damit hätten sich eigentlich nur rund 1% aller Saarländer an diesem Freitag in der letzten Woche aufgemacht, um gegen die aktuelle Politik der CDU-SPD-Koalition unter der deutschen Kanzlerin Angela Merkel zu demonstrieren. 99% des saarländischen Volkes aber, die ewig „schweigende Masse“, auf der sich die Regierenden ausruhen und auf die sie sich bei ihrem ’Nichtstun’ stets berufen, stehen diesem EINEM Prozent Demonstranten gegenüber. So wird sich ’Mutti’ liebevoll und in vollster Zufriedenheit ihrem just ’Neugeborenen’, dem ’Klimapaket’ zuwenden können, denn es gibt, ähnlich wie an der Kriegsfront des Ersten Weltkrieges, an der Klimafront des 21. Jahrhunderts „Im Westen nichts Neues!“

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquelle      :         „Warum lernen ohne Zukunft“ – Berlin, 25. Januar 2019

Abgelegt unter APO, Saarland, Überregional, Umwelt | Keine Kommentare »

Fridays For Future Köln

Erstellt von DL-Redaktion am 22. September 2019

Ein globales Signal

Datei:Bundesarchiv B 422 Bild-0086, Köln, Rheinufer, Hochwasser.jpg

Quelle           :      Scharf   —  Links 

Von Jimmy Bulanik

Köln – weit über 70.000 Menschen aus allen Segmenten der Zivilgesellschaft aus natürlichen Personen, juristische Personen kamen zwecks Fridays For Future Klimastreik, Demonstration um 11 Uhr zum DGB Haus am Hans – Böckler – Platz bis zum Hohenzollernring. Mit mittels Absperrungen, Beeinträchtigungen für den Verkehr auf den Straßen von Köln. Das Mobilfunknetz in Köln war zeitweilig überlastet. Köln stellt in NRW die größte Anzahl der Teilnehmerinnen und Teilnehmer und somit einer der größten Demonstrationen in der Bundesrepublik Deutschland. In NRW haben sich über 270.000 Menschen an den Veranstaltungen beteiligt. Bundesweit handelt es um über 1,4 Millionen Demonstrantinnen und Demonstranten. Begleitet wird dies von Gewerkschaftlerinnen und Gewerkschaftler wie Verdi, DGB als auch dem Künstlerinnen und Künstler, wie beispielsweise der Band Cat Ballou welche für ihr Lied „Et jitt kei Wood“ bundesweit bekannt ist. Sehr viele anwesende Demonstrantinnen und Demonstranten werden im Bundesland NRW künftig Erstwählerinnen und Erstwähler werden. In jedem Fall leidenschaftlich politisiert und im harmonischem Einklang mit der Generation ihrer Eltern und Großeltern. Die Ziele bestehen in der so zeitnah als möglich Einleitung einer Energiewende insgesamt Sowohl persönlich (mit der Auswahl des Stromanbieter wie Greenpeace Energy eG, der persönliche Pizza Konsum) als auch gemeinschaftlich als Binnenmarkt und international.

Mittlerweile konstatieren Ökologische Strom Anbieter wie Greenpeace Energy eG das nicht allein natürliche Personen zu ihren Kundschaft zählen, als auch juristische Personen wie Büros von den Bündnis 90 / Die Grünen. Selbst eine Gesellschaft mit Bussen und Züge in grüner Farbe gehört zu solch einem Geschäftskunden.

Es werden künftig mehr Geschäftskunden werden. Das Bewusstsein bei den Menschen in der gesamten Gesellschaft besteht seit langem, wächst jedoch weiter. Dies bemerken auch Lebensmittelgeschäfte bei ihren Verkaufszahlen von fleischlosen Lebensmittel.

Die Sonne schien in Köln bei zirka 13 Grad Celsius. Die Stimmung war fröhlich und ausgelassen. Die Menschen, welche am Köln Bahnhof West der Route der Demonstration leben, zeigten aus geöffneten Fenstern mit ihrem Zuwinken und Daumen in Richtung blauen Himmel zeigend ihre Zustimmung.

Tatsache ist das die ökologischen Themen von allen demokratisch wählbaren Parteien aufgegriffen werden. Über Modalitäten des Sparens von Energie wird vielfältig gerungen.

In meinen Interviews mit den Demonstrantinnen und Demonstranten vor Ort in Köln wurde die massive Förderung eines egalitär bezahlbarer DB Bahnkarte 100 der zweiten Klasse im Jahres Abo verlangt. Somit wird der Verkehr auf den Straßen, Autobahnen gravierend entlastet. Ungeachtet der Form des Energieträgers ob fossil oder basierend auf regenerativ gewonnener Strom für Batterie oder noch besser Wasserstoff. Ziemlich verteidigend waren die (jungen) Leute zum Thema Windräder. Sie erkannten für sich das mit den modernen und effizienten Windrädern welche heute größer sind, als der Kölner Dom die Energiewende steht.

Der Internationalismus kommt bei den Fridays For Future Demonstrantinnen und Demonstranten nicht zu kurz. Sie artikulieren mitunter das es für alle Menschen nur eine Welt besteht in der wir gemeinsam leben, sich darin gegenseitig brauchen. Die Informationen über die Anzahl derer welche heute global für das Klima von ihrem verbrieften Grundrecht auf Versammlung den öffentlichen Raum friedlich und demokratisch in Anspruch nehmen motiviert die anwesenden in Köln.

Alles in allem steht eine stärkere Verbindung von Ökologie, produzierender Ökonomie mit ebensolchen Erwerbsarbeitsplätzen in der Bundesrepublik Deutschland bevor. Von der Bundesrepublik Deutschland kann ein Mondscheineffekt für andere Volkswirtschaften darstellen.

Dies zu bewerkstelligen obliegt uns allen.

 Jimmy Bulanik

 Quellen:

 https://fridaysforfuture.de

 https://www.greenpeace-energy.de

 https://www.gruene.de

 Cat Ballou – Et jitt kei Wood

 https://www.youtube.com/watch?v=VF6p-BGQcl4

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————-

Grafikquelle        :        Namensnennung: Bundesarchiv, B 422 Bild-0086 / Sers, Günter / CC-BY-SA 3.0

Abgelegt unter Köln, Nordrhein-Westfalen, Überregional, Umwelt | 1 Kommentar »

Wahlnachlese im Osten

Erstellt von DL-Redaktion am 16. September 2019

Von der AfD überholt –
Warum die Linke im Osten abstürzt

File:Andre Hahn und Klaus Tischendorf - by Die Linke Sachsen.jpg

Von Theresa Martus

Einst war sie Volkspartei, jetzt reicht es gerade für 10 Prozent – die Linke ist im Osten tief gefallen. Ein Ortsbesuch in Sachsen.

So richtig weiß Michael Bagusat-Sehrt immer noch nicht, was da eigentlich passiert ist. Wenn man den Direktkandidaten der Linken im Wahlkreis Nordsachsen 3 fragt, warum seine Partei bei der Landtagswahl so ins Bodenlose gestürzt , so weit hinter den Umfragen zurückgeblieben ist, zieht er an seiner E-Zigarette, bevor er antwortet. Das Gerät blubbert leise, Bagusat-Sehrt atmet lange aus. „Rational“, sagt er dann, „ist der Ausgang der Wahl für mich nicht zu erklären.“

 Die Stimmung vor der Wahl? Gut. Die Leute? Offen für die Themen seiner Partei. Der Wahlkampf – der „geilste Wahlkampf meines Lebens“. Was etwas heißt, denn Bagusat-Sehrt macht seit gut 20 Jahren Wahlkämpfe. „Ich hätte am Sonntag noch Stein und Bein geschworen, wir schaffen 16, 18, 20 Prozent.“

Es kam anders. Die Linke, mehr als 15 Jahre stärkste Oppositionspartei im Freistaat, stürzte ab auf Platz drei, ganze 17 Prozentpunkte hinter der neuen stärksten Oppositionspartei – der AfD.

Der Sachse als Mensch zweiter Klasse?

Nirgends verlor die Partei so viel wie hier in Arzberg, am nördlichen Rand Sachsens. Rund eine Stunde ist es von hier mit dem Auto nach Leipzig, nach Dresden noch etwas länger. Nach Torgau, in den nächsten Ort mit Bahnhof, braucht man 15 Minuten – mit dem Auto, denn ohne kommt man hier weder hin noch weg. Eine Grundschule gibt es, eine Kirche und einen Lebensmittelladen. „‚Abgehängt‘ ist ein blödes Wort, aber es trifft genau zu“, sagt Bagusat-Sehrt. „Man ist Mensch zweiter Klasse, weil man im Osten wohnt.“

Vor Arzberg.JPG

Die Stimme derer, die das so empfinden, das war lange die Linke, vor dem Zusammenschluss mit der WASG die PDS. Nach der Wende war die Partei Ansprechpartner und Anker für viele, die in der Flut der Veränderungen unterzugehen drohten. Mitglieder halfen beim Ausfüllen von Formularen und Anträgen, die Parteispitze kämpfte für bessere Renten im Osten und gegen Hartz IV.

Der Dank waren spektakuläre Erfolge. In Sachsen holte die Partei regelmäßig ein Viertel der Stimmen. In anderen Bundesländern im Osten schaffte die Partei es sogar in die Regierung, in Thüringen regiert derzeit mit Bodo Ramelow ein linker Ministerpräsident. Die Linken, einmal angetreten als größtmöglicher Schrecken der Regierenden, gehören längst selbst zum Establishment.

Quelle           :    Berliner-Morgenpost          >>>>>           weiterlesen

——————————————————————–

 Grafikquellen          :

Oben     —      André Hahn und Klaus Tischendorf

Source André Hahn und Klaus Tischendorf
Author dielinke_sachsen
w:en:Creative Commons
attribution
This file is licensed under the Creative Commons Attribution 2.0 Generic license.
Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on September 14, 2009 by the administrator or reviewer File Upload Bot (Magnus Manske), who confirmed that it was available on Flickr under the stated license on that date.

———————————

Unten      —        Arzberg    /   Gemeinde im Landkreis Nordsachsen, Sachsen,

Straße von Südost

Abgelegt unter P. DIE LINKE, Positionen, Sachsen, Überregional | Keine Kommentare »

Linkes Ausschlussverfahren

Erstellt von DL-Redaktion am 12. September 2019

 gegen Landes-Vize der Linken angekündigt

BHPANAS.jpg

Drei Herzen – ohne linken Seelen ?

Von dpa

Nach einem Strafbefehl wegen Titelmissbrauchs gegen den stellvertretenden Landeschef der saarländischen Linke, Andreas Neumann, will die Partei  ihn ausschließen. Der Ortsverband der Linke in Saarbrücken-Malstatt habe am Montagabend beschlossen, einen entsprechenden Antrag auf Parteiausschluss zu stellen, sobald der Strafbefehl gegen Neumann rechtskräftig geworden sei, teilte der Sprecher der Linke am Dienstag in Saarbrücken mit.

Das Amtsgericht Saarlouis hat gegen Neumann einen Strafbefehl erlassen, weil dieser nach der Vorlage von Dokumenten einer nicht existierenden Universität fälschlicherweise einen Doktortitel getragen hat. Es erging eine „Verwarnung mit Strafvorbehalt“ – quasi eine Geldstrafe auf Bewährung: Die Verurteilung zu 90 Tagessätzen zu je 50 Euro – also insgesamt 4500 Euro – bleibt vorbehalten. Zudem wurde eine Bewährungsauflage von 1800 Euro ausgesprochen.

Nach Angaben des Amtsgerichts ist der Strafbefehl derzeit in der Zustellung an Neumanns Verteidiger. Nach dem Empfang habe Neumann zwei Wochen Zeit, Einspruch einzulegen. Bisher hätten weder der Angeschuldigte noch dessen Verteidiger sich „substanziiert inhaltlich“ zu dem Tatvorwurf geäußert, teilte das Gericht mit.

Die Linke teilte mit, Neumann habe „dem Ansehen und der Glaubwürdigkeit der Partei“ im Saarland schwer geschadet. Ein Verfahren auf Parteiausschluss werde sich „über eine längere Zeit hinziehen“, sagte ein Sprecher. „Deshalb wäre es uns allen lieber, er würde freiwillig die Partei verlassen. Aber da er das wahrscheinlich nicht tun wird, ist das hier zumindest mal ein Zeichen.“

Linke Saarbrücken-Malstatt

Quelle        :           Volksfreund – Trier         >>>>>         weiterlesen

Anmerkung: Nicht die Partei will den stellvertretenden Landeschef ausschließen

Ein Ausschluss ist das Ansinnen des Sprecherinnenrates des OV Malstatt, mit mehreren Mitgliedern vom parteinahen Jugendverband solid  besetzt. Das ist umso befremdlicher, da genau „diese“ Solid-Mitglieder die öffentlichen, parteischädigenden Auftritte  des Herrn Adolf L.  gebilligt und geduldet haben. 

———————————————————————

Grafikquelle       :            dieLinke Stadtratsfraktion Saarbrücken 05.02.2010; Birgit Huonker, Andreas Neumann, Astrid Schramm

Abgelegt unter P. DIE LINKE, Saarbrücken, Saarland, Überregional | Keine Kommentare »

DIE LINKE – nach der Wahl

Erstellt von DL-Redaktion am 11. September 2019

Systemkritik mit einer Utopie

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–142.jpg

Von Andreas Fritsche

Volkswirt Martin Günther analysiert Wahldebakel seiner Linkspartei und macht Vorschläge.

Diana Golze und Anja Mayer, die Doppelspitze der brandenburgischen Linkspartei, wollen in nächster Zeit durch das Bundesland reisen und mit ihren Genossen das Debakel bei der Landtagswahl gründlich analysieren, um Schlussfolgerungen daraus zu ziehen. Währenddessen hat nun als erstes Mitglied des Landesvorstands Martin Günther bereits Thesen und Vorschläge als Diskussionsangebot schriftlich vorgelegt.

Die LINKE war am 1. September von 18,6 auf 10,7 Prozent abgestürzt. »Bitter« nennt Günther das. »Eine endgültige Antwort, was im Wahlkampf passiert ist und was in den Jahren davor, was zu diesem Ergebnis geführt hat, ist schwer und zwangsläufig immer unvollständig«, weiß er. Der 37-Jährige erhebt mit seinem vierseitigen Papier ausdrücklich nicht den Anspruch auf Vollständigkeit und behauptet auch nicht, die Wahrheit gepachtet zu haben.

Als Ausgangspunkt seiner Analyse nimmt er das Wählerstromkonto. 11 000 Wähler hat die LINKE von der SPD abgezogen, ihrerseits aber 30 000 Wähler an die SPD abgegeben, unter dem Strich also 19 000 Wähler an die Sozialdemokraten verloren. Nicht nur Günther glaubt, dass viele Brandenburger an dieser Stelle taktisch gewählt haben, weil sie wollten, dass die AfD nicht stärkste Kraft wird. Das LINKE sei in der rot-roten Koalition »nicht deutlich genug erkennbar gewesen«, stellt Günther fest. Schließlich hatte eine Umfrage ergeben, dass 70 Prozent der Brandenburger nicht sagen konnten, was die LINKE in der Regierung eigentlich bewirkt habe. »Da wir im Kern sozialdemokratische Politik gemacht haben, wählten die Leute das Original«, glaubt Günther. Er schlussfolgert: »Wir müssen unser eigenständiges Profil schärfen und in Abgrenzung zur SPD auch herausstellen.«

Von der Angst vor dem Klimawandel profitierten die Grünen. An sie verlor die LINKE 13 000 Wähler, während sie umgekehrt nur 1000 Wähler gewinnen konnte. »Unser spezifischer Ansatz«, beim Klimaschutz die soziale Frage zu beachten, sei bisher weder bekannt, noch werde er hinreichend widerspruchsfrei kommuniziert. Auch müsse die LINKE verlorenes Vertrauen als Bürgerrechtspartei zurückgewinnen. Die LINKE hatte einen Entwurf von Innenminister Karl-Heinz Schröter (SPD) in Verhandlungen erheblich abgemildert, aber letztendlich einer Fassung zugestimmt, die immer noch eine Verschärfung des Polizeigesetzes bedeutete.

An die AfD verlor die LINKE zuletzt noch einmal 12 000 Wähler und hat ihr umgekehrt nur 1000 Wähler entzogen. Günther erkennt, dass ein Teil dieser Wähler schon immer rassistische Ansichten hegte. Die könne man allenfalls zurückholen, wenn ihnen andere Themen wieder wichtiger werden. »Eine Anbiederung an die AfD stärkt nur das Original«, sagt der Volkswirt. »Da brauchen wir weiterhin klare Kante.« Über die sozialpolitischen Positionen der AfD aufzuklären, sei zwar nötig, werde aber nur begrenzt dazu führen, Wähler zur Abkehr von der AfD zu bewegen.

An die Freien Wähler verlor die LINKE 5000 Wähler, ohne dieser Partei selbst Anhänger abzunehmen. Für Günther sind die hier verlorenen Wähler Menschen mit einem mittleren Einkommen, die gleichwohl existenzielle Probleme fürchten. Denn als Altanschließer sollten sie viele Tausend Euro für die Kanalisation bezahlen oder eine vergleichbar hohe Summe als Anlieger für den Straßenbau. Die LINKE hatte sich vor der Landtagswahl 2009 vergeblich für die Altanschließer eingesetzt, aber nichts erreicht. Das war verständlich. Als Opposition konnte sie ihre Stichtagsregelung, die das Problem erledigt hätte, nicht durchsetzen. Doch auch als Regierungspartei hat die LINKE die Hoffnungen der Altanschließer dann enttäuscht. Sie konnte den Koalitionspartner SPD nicht umstimmen. Günther schreibt, die soziale Frage stelle sich auch für die Mittelschicht. Hier müsse sich die LINKE darum kümmern, dass soziale Härten vermieden werden.

Quelle       :     ND         >>>>>         weiterlesen

—————————————————————

Grafikquellen        :

Oben       —          Bundesparteitag Die Linke 2018 in Leipzig

Abgelegt unter Brandenburg, P. DIE LINKE, Sachsen, Überregional | Keine Kommentare »

Egotronics Torsun Burkhardt

Erstellt von DL-Redaktion am 10. September 2019

„Wut tut gut“

Egotronic.jpg

Von Jürgen Ziemer

Interview mit  Egotronics Torsun Burkhardt will Deutschland an die Wand stellen und ärgert sich über die Hufeisentheorie

Torsun Burkhardt ähnelt stark dem Philosophen Slavoj Žižek. Ein bärtiger Querkopf, der mit seiner Band Egotronic seit 18 Jahren Punk und Electro zu widerständigen Hymnen verbindet. Mit seinem Humor eckt er nicht nur bei Nazis und Rechten an, die er in den Liedern durchgängig verspottet und bekämpft. Auch Facebook zeigte letztes Jahr wenig Verständnis, als sich Burkhardt der Zerstörung von Dresden mit einer viel beachteten Büttenrede widmete. Inklusive Narhallamarsch und dem Kommentar: „Fresst das, Pegida-Arschgeigen“. Das neue Egotronic-Album Ihr seid doch auch nicht besser enthält wieder jede Menge linksradikale Ohrwürmer. Die einschlägigen Wutbürger und Bedenkenträger aus der rechten Ecke meldeten sich bereits zu Wort.

Hallo Torsun, Sie und Ihre Band sorgen in rechten Blogs und Netzwerken gerade für ziemliche Empörung: „Linksextreme Band verherrlicht Morde an Rechten“ heißt es etwa auf „Journalistenwatch“. Und Compact meldet: Im „Kantholz“-Video der Electropunkband Egotronic wird Journalist Matthias Matussek erschossen“.

Torsun Burkhardt: Für mich war seine Party zum 65. eine ziemliche Zäsur. Prominente Vertreter der Mitte und sich liberal schimpfende Leute hatten kein Problem mit stramm Rechten zu feiern und sich dabei gegenseitig zu fotografieren. Da waren ja alle dabei, Spiegel-Kollegen, Reinhold Beckmann, der mit der Wandergitarre aufgetreten ist, bis zu Erika Steinbach und dem identitären Nazi Mario Müller. Die über Facebook bekannt gewordenen Bilder der Party, waren die Grundlage für das Artwork des Albums und die ersten beiden Videos.

Wo sind all die Linksradikalen mit dem Schießgewehr?“ fragen Sie in „Linksradikale“, vor dem Hintergrund exaltierter Prösterchen. Im bald darauf veröffentlichten „Kantholz“-Video bekommt die Geschichte einen anderen Dreh. Eine Attentäterin zielt auf die Akteure der Feier, die vor Angst ihren Rotwein verschütten.

Das erste Video bildet ab, das zweite ist eine Fantasie. Das sieht man am Stil, der sich an Action-Filmen orientiert. Beim Clip zu Linksradikale lag das Hauptaugenmerk auf dem Social-Media-Aspekt, weil die Party ja nur durch Social-Media bekannt wurde.

Aber ist das nicht trotzdem leicht misszuverstehen? Was, wenn eine rechte Band eine ähnliche Fantasie wie das „Kantholz“-Video veröffentlichen würde?

Der Titel spielt ja schon auf rechte Propaganda an. Es geht um die Attacke auf einen AfDler in Bremen, der danach behauptete, mit einem Kantholz angegriffen worden zu sein. So wurde ein Mordanschlag herbeifantasiert und genau das zeigt auch das Video. Nazis behaupten, das von uns gezeigte Szenario sei real, was faktisch selbstverständlich Unsinn ist. Dass sie sich so darauf stürzen müssen, zeigt sehr deutlich, dass es es keine Entsprechung dazu in der Realität gibt. Es ist somit ein Unterschied ums Ganze.

Haben Egotronic häufiger Ärger wegen Texten oder Videos?

Laut Mattuseks Twitter-Profil hat er uns gerade angezeigt.

Wegen des „Kantholz“-Videos?

Ja, genau.

Und davor? In Texten beziehen Sie ja relativ klar Stellung, wenn auch meist ironisch: „Wir stellen Deutschland an die Wand, Sachsen ist als erstes dran“.

Im letzten, oder vorletzten Jahr wurde uns mal bei einem Konzert Polizei auf die Bühne geschickt, aber da ist nie was gekommen.

Das ist alles durch die Freiheit der Kunst gedeckt?

Ja, da sind wir relativ entspannt. Auf der Twitter-Seite von Matussek steht zwar, das sei ein Aufruf zum Mord, aber das ist hanebüchener Unsinn. Im Video sind überhaupt keine Morde zu sehen und es fällt auch kein einziger Schuss.

Egotronic - Rock am Ring 2017-AL3707.jpg

Glauben Sie, dass die Wut in den Texten von Egotronic eine Wut ist, die viele spüren, aber oft nicht artikulieren können.

Genau, so bin ich ja auch politisiert worden. Durch Punkbands, die das Unbehagen formuliert haben, dass ich als Teenager mit mir herumtrug. Zum Beispiel Slime, aber auch Ton Steine Scherben. In dieser Tradition sehe ich mich beim Texten. Es ist der Versuch, die Wut, oder den Zorn über Zustände und Umstände zu artikulieren und rauszuschreien. Weil’s in dem Moment auch einfach gut tut.

Steht dahinter auch der Wunsch Dinge zu verändern, politisch etwas anzustoßen?

Quelle        :       Der Freitag          >>>>>          weiterlesen    

——————————————————————

Grafikquelle       :

Oben          —        Konzert der Elektropunkband Egotronic in Wunstorf. Aufgenommen am 16. März 2007. Links Sänger Torsun, rechts Hoerm, der inzwischen die Band verlassen hat.

Abgelegt unter Debatte, Feuilleton, Kultur, Überregional | Keine Kommentare »

Über den Osten sprechen

Erstellt von DL-Redaktion am 9. September 2019

Wege aus der Desaster-Rhetorik

Quellbild anzeigen

Von Andreas Willisch

Was hilft denn nun gegen rechts? „Sachlichkeit“, heißt es häufig. Aber reden wir eigentlich sachlich über den Osten des Landes?

In Sachsen und Brandenburg wurde letzten Sonntag gewählt. Obwohl sehr viele Menschen – vielleicht zum ersten Mal in dieser Breite und Buntheit – für die Demokratie in Ostdeutschland gekämpft haben, haben die extremen Rechten ihre Stärke gezeigt. Eine bunte, junge, engagierte Zivilgesellschaft hat sich gewehrt, aber fürs Erste nicht gewonnen. Dafür kommen neue Stimmen und ein neuer Ton in die Debatten im und über den Osten.

Seit Jahrzehnten spielt sich der Diskurs in den immer gleichen Defizitschleifen ab: Die Wirtschaft, ja, die Menschen der DDR waren so marode, dass mit ihnen der Aufbau einer sozialen Marktwirtschaft und demokratischer Strukturen nicht als Nachbau der westdeutschen Verhältnisse gelingen konnte. Als offenbar wurde, dass diese Kopie misslingen würde, hauten die Ostler massenweise in den Westen ab, und die Frauen unter ihnen stellten das Kinderkriegen ein. Daher leben, so eine Meldung von vor dem Sommer, heute im Osten so wenige Menschen wie 1905. Die bleiben mussten, drängten der Mehrheit im neuen Deutschland ihre Thematik der abgehängten Regionen auf: Sie neigen autoritär-populistischen Gestalten zu und sind voll Rachegelüsten gegenüber der Mehrheit. Das ist in etwa die rhetorische Schleife seit 20, 25 Jahren.

Was hilft denn nun gegen rechts? „Sachlichkeit“, heißt es häufig. Aber wird eigentlich sachlich über Ostdeutschland gesprochen? Ich war zwei Tage vor den Wahlen in Demmin. Zwei mecklenburg-vorpommersche Staatssekretäre hatten zur Sommertour geladen. Die Leute vom T30 – einem Kultur-, Kunst- und Demokratieladen schräg gegenüber dem AfD-Büro – sollten besucht werden. Sie hatten zur Vorbereitung andere Vereine und Menschen mit Ideen für ihre Stadt gebeten, Zukunftsprojekte zu erarbeiten, die in großer Runde mit der Politik diskutiert werden könnten. Heraus kamen 15 Vorschläge, wie das Leben in Demmin angenehmer gemacht werden könnte. Doch die Diskussion drohte im Würgegriff der Demografie zu ersticken: Tags zuvor waren die neuesten Prognosen bekannt geworden, wonach Demmin in 20 oder 30 Jahren noch einmal stark schrumpfen würde.

So geht die „sachliche Debatte“ seit Jahren: Engagement läuft ins Leere, weil wir in Zukunft weniger werden. Aber wer sagt eigentlich, dass Gesellschaften sich so entwickeln müssen, dass überall gleich viele Menschen leben? Können nicht auch kleinere Dörfer und Städte in dünn besiedelten Regionen ein gutes Leben führen? Ist nicht die Art und Weise, wie die Leute zusammenleben, wie sie Gesellschaft an jedem Ort selber machen, wesentlicher als die Anzahl der Bewohner?

Falsche neoliberale Politik

Hinter der demografischen Desaster-Rhetorik verbirgt sich etwas viel Entscheidenderes: Irgendwie sind die Menschen, die da weggehen oder nicht hingehen, die älter werden und erst recht die Frauen, die keine oder nicht genügend Kinder kriegen, schuld, dass es dem Ort und der Region schlechtgeht. Für die verantwortliche Politik ist das bequem, enthebt es sie doch scheinbar der Aufgabe, dafür politische Entscheidungen zu treffen und am Ende womöglich für eine Region, in der sich die Leute so sehr selbst schädigen, mehr statt weniger Geld auszugeben.

Ein Blick in die Berichte zum Stand der deutschen Vereinigung der Bundesregierung belegt das. Im ersten rot-grünen Bericht von 1999 steht, dass die Politik der schnellen Treuhand-Privatisierung mit ihren Fehleinschätzungen den Zusammenbruch der Industrie zur Folge hatte. 2007 liest sich das ganz anders. Da wird der demografische Wandel dafür verantwortlich gemacht, dass der Osten weiter zurückbleibt. An die Stelle falscher neoliberaler Politik tritt eine ganz und gar unpolitische Sicht auf die Gesellschaft: Wo Menschen weniger und älter werden, ist staatliche Politik außen vor. Der Staat kann nur noch die Schrumpfung moderieren und hier und da ein Mehrgenerationenhaus einweihen. Diese Lesart dominiert seitdem als „sachliche Expertensicht“.

Auch die Autoritätshörigkeitsscheife beherrscht seit vielen Jahren die Talkshows, Kommentare und Berichte zu Ostdeutschland. Erst der Typ mit der nassen Hose, später die NPD-Kader, die von der Straße in die Parlamente drängten. Die Alternative für Deutschland ist da allerdings von einer anderen Qualität. Sie bietet eine Projektionsfläche für alles Misslungene und Ungerechte.

Eine Art Lumpenproletariat

Lange konnten die in den Parlamenten vertretenen Parteien gut damit leben, dass ein Teil ihrer Wählerschaft keineswegs ihren Werten anhing, solange er ihnen die Mehrheit brachte. Unter denen, die freundlich als Protestwähler gezählt werden, befindet sich schon seit 1990 eine Art Lumpenproletariat, Gabriel hat es mal Mob genannt, das so lange willkommen war, wie es auf die Verheißungen der blühenden Landschaften hereinfiel und die bittere Medizin, dass aus der DDR ohnehin nichts zu retten gewesen wäre, brav geschluckt hat. Das sind die gleichen Leute, die aus dem emanzipativen Ruf „Wir sind das Volk!“ die Konsumformel „Wir sind ein Volk!“ gemacht und damit eine gesellschaftliche Revolution gekapert haben.

Jetzt wenden sich viele, ironischerweise wieder mit der Emanzipationsformel „Wir sind das Volk!“ von den Parteien ab, deren Werte sie zwar nicht vertreten, die ihnen aber Unterschlupf geboten haben. Mehr noch, sie wenden sich vom parlamentarischen System ab und bekämpfen es. Nun ist die Not groß – so groß, dass selbst die ehemalige Protest- und Staatspartei koalitionsfähig wird, auf jeden Fall dazugehört zur Demokratie.

Quelle       :        TAZ         >>>>>         weiterlesen

————————————————————————-

Grafikquellen     :

Oben          —         Deutsch: Wahlplakat der AfD zur Bundestagswahl 2017 „Neue Deutsche? Machen wir selber.“ Aufgenommen am 22.09.2017 in München, S-Bahnhof Heimeranplatz.

Izvor Vlastito djelo postavljača
Autor Valodnieks
w:hr:Creative Commons
imenovanje autora dijeli pod istim uvjetima
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International licens

——————–

Unten       —     Via –   Wikimedia Commons  Twitter    GRÜNE Mittelsachsen

Abgelegt unter Brandenburg, P.AfD, P.CDU / CSU, Sachsen, Überregional | Keine Kommentare »

AKL in der Linken

Erstellt von DL-Redaktion am 8. September 2019

Ausgang der Landtagswahlen in Sachsen-Brandenburg
SOFORT UMSCHALTEN! VERÄNDERUNG BEGINNT MIT OPPOSITION!

Andre Hahn, August 2009 - by Die Linke Sachsen.jpg

Quelle     :      AKL    in der Linken

Stellungnahme der Antikapitalistischen Linken

Die Erfolge der LINKEN weder auf dem Altar der Regierungsbeteiligung mit SPD und GRÜNEN opfern, noch die Illusion schüren, die AfD-Wähler*innen wären einfach zurückzugewinnen.

Wie schon nach den EU-Wahlen vom Mai dieses Jahres sind sich fast alle Beobachter*innen in und außerhalb der LINKEN darüber einig, was die Ursachen für den heftigen Absturz der LINKEN bei den Wahlen in Ostdeutschland sind. Sie hat ihre politische und immer mehr auch organisatorische Identität verloren. Warum das geschehen ist und wie die Entwicklung gestoppt und umgedreht werden kann, dazu sollte die Debatte geführt werden und nicht über einzelne Fragen des Personals.

1.

Die Wahlen zu den Landtagen in Brandenburg und Sachsen haben den Parteien der Koalition in Berlin eine schallende Ohrfeige verpasst. 30 Jahre nach der Wiedereingliederung der DDR in die kapitalistische Wirtschaftsordnung Gesamtdeutschlands haben die damaligen Verkünder der „blühenden Landschaften“ ein weiteres Mal erheblich an Legitimation verloren. Sowohl die CDU als auch die SPD müssen die „schlechtesten“ und „historisch niedrigsten“ Wahlergebnisse hinnehmen. Die Koalition, die sich selbst „groß“ nennt, ist zu einem Minderheitenprojekt geschrumpft, nicht nur in der Ausrichtung ihrer Politik auf die Interessen einer gesellschaftlichen Minderheit (das war schon immer so), sondern jetzt auch – wie schon auf Bundesebene und in den meisten anderen Ländern – in den Abstimmungsergebnissen bei allgemeinen Parlamentswahlen.

Trotz einer deutlichen Steigerung der Wahlbeteiligung um etwa fünfzehn Prozentpunkte konnten SPD und CDU diesen historischen Absturz nicht verhindern. Aber auch bei dieser Wahl hat ein gutes Drittel der Wahlberechtigten nicht von seinem Wahlrecht Gebrauch gemacht. In Sachsen 12 Prozent und in Brandenburg gut 5 Prozent der abgegebenen Stimmen wurden durch die undemokratische Fünf-Prozentklausel zu Nullstimmen entwertet.

Die Partei der Profis und Marktradikalen, die FDP, konnte an absoluten Stimmen zwar zulegen, verpasste aber in beiden Wahlen den Einzug in den Landtag.

2.

Die GRÜNEN konnten ihre Erfolge der letzten Wahlen auch in Sachsen und Brandenburg fortsetzen, aber deutlich weniger als erwartet und von den Meinungsforschungsinstituten noch am Vorabend vorhergesagt. Die Demoskopie gehört generell zu den Verlierer*innen dieser Wahl: Auch die besser als erwarteten Ergebnisse der CDU in Sachsen und der SPD in Brandenburg wurden trotz aller Anstrengungen der Meinungsforschungsinstitute nicht vorhergesagt. Zum Glück müssen sie keinen Schadensersatz zahlen, aber soviel Differenz zwischen Vorhersage und Endergebnis war selten.

Die GRÜNEN haben auch bei diesen Wahlen einen „optimistischen“ Wahlkampf mit ihnen als Retterin des Kapitalismus und als Partei gegen den Klimawandel organisiert. Sie wurden als wenig abgenutzte, bürgerliche Alternative zu CDU und SPD, aber auch zu den gruseligen Rechten angesehen. Links sind diese GRÜNEN nicht. Sie haben keinen Hehl daraus gemacht, dass sie auch mit der CDU koalieren würden, wenn es genügend Pöstchen gibt.

Flag of Die Linke

3.

Absolute Wahlgewinnerin beider Wahlen ist die Alternative für Deutschland (AfD). Fast 300.000 Stimmen in Brandenburg und fast 600.000 in Sachsen stimmten für die AfD. Die AfD wird in beiden Landesverbänden von ihrem rechten Flügel bestimmt, so dass anzunehmen ist, dass der sogenannte „Flügel“, die völkisch-nationalistische Gruppierung in der AfD, großen Auftrieb erhalten wird. Die AfD konnte sämtliche andere Rechtsparteien pulverisieren, die entweder gar nicht mehr antraten oder marginale Stimmenergebnisse erzielten. Der AfD gelang es in Sachsen auch, fast so viele Direktmandate zu gewinnen, dass die vom Verfassungsgericht verfügte Deckelung auf 30 Listenplätze ausgeglichen werden konnte. Jetzt verfügt die AfD in Sachsen über 38, in Brandenburg über 23 gut bezahlte Abgeordnetenmandate.

Die AfD hat im Wahlkampf und bei der Aufstellung ihres Personals bewusst Grenzen zu faschistischen Positionen überschritten. Alle ihre Flügel sind sich aber einig, ihr Projekt einer breiten nationalistischen und rassistischen Mobilisierung der Bevölkerung zielstrebig weiter zu verfolgen, kombiniert mit einer Selbstdarstellung als Partei der Ostdeutschen und der kleinen Leute.

Weder das neoliberale und sozialdarwinistische Programm, noch die Auswahl der Kandidat*innen entsprechen dieser Selbstdarstellung, aber das wurde der AfD abgenommen. Ohne die demoskopischen Erhebungen überzubewerten, ist festzustellen, dass mehrere Untersuchungen und Umfragen noch einmal bestätigten, dass die AfD nicht die Partei der Ausgegrenzten und Armen ist, obwohl sie sich als diese ausgibt.

Sie ist eine Partei der Mitte, allerdings geprägt von Abstiegsängsten und Fixierung auf eine Politik des starken Staates. Gut Dreiviertel der AfD-Anhänger*innen bekennen laut dieser Umfragen, dass sie die AfD nicht trotz, sondern wegen und in Kenntnis ihres rassistischen Programms und Weltbildes wählen würden. Eine Protestwahl von „besorgten Bürger*innen“, die „ernst genommen“ und „zurückgeholt“ werden müssen, ist das nicht oder nicht mehr vorrangig. Hier verfestigt sich ein Rechtspol in der Gesellschaft, der nur durch den Aufbau eines starken Linkspols und realer Verankerung in Stadtteilen, Betrieben, Schulen durch die organisierte Linke zurückgedrängt werden kann und nicht einfach durch ein vermehrtes Aufgreifen der sozialen Frage in Worten.

Der AfD ist es gelungen, bei diesem Ergebnis verwundert das nicht, den anderen Parteien die Themen und die Wahlkampfstrategie aufzudrängen. Alle Parteien haben – quasi als Gegenseite dieser Medaille – brav beteuert, dass sie niemals mit der AfD gemeinsame politische Geschäfte erledigen würden. Das ist auf kommunaler Ebene schon lange Geschichte, und auch in diesem Wahlkampf und in den ersten Stunden nach Verkündung des Ergebnisses erklingen schon vermehrt Stimmen, man müsse die AfD „entzaubern“ und sie „in die Verantwortung zwingen“.

4.

Sowohl in Brandenburg als auch in Sachsen ist nur eine Regierungsbildung mit mindestens drei Parteien möglich – sofern die Unvereinbarkeit mit der AfD so bleibt wie verkündet. Wir machen keine Prognose, wie lange es dauert, bis insbesondere die CDU in dieser Frage zu schwanken beginnt, aber das wird so kommen.

Bisher sind in Brandenburg deshalb nur Bündnisse aus SPD, GRÜNEN und LINKE oder SPD, CDU und GRÜNEN und in Sachsen nur ein Bündnis aus CDU, GRÜNEN und SPD möglich. Es werden in jedem Fall keine linken Regierungen, sondern Regierungen des Weiter-So und der Krisenverwaltung sein. Speziell in Sachsen könnte auch die in Deutschland so verhasste Minderheitsregierung (wie schon einmal in Sachsen-Anhalt) ins Gespräch kommen.

5.

Absolute Wahlverliererin ist die LINKE. Sie hat in Brandenburg 50.000 Stimmen (minus 10,7 Prozentpunkte) und in Sachsen 85.000 Stimmen (minus 8,5 Prozentpunkte) verloren. 224.000 Menschen in Sachsen und 136.000 in Brandenburg gaben der LINKEN noch ihre Stimme. In den letzten 15 Jahren hat die LINKE (PDS) damit Zweidrittel ihrer Stimmenanteile verloren. Parallel zu dieser Wahlentwicklung hat die LINKE in den Ostländern kontinuierlich Mitgliederbestände und Parteistrukturen abgebaut.

Es gibt wie immer zahlreiche Gründe für diesen Absturz, auch aktuelle. Der parteiinterne Streit um das beide Landtags-Wahlkämpfe bestimmende Thema Flüchtlingspolitik hat die LINKE als unklare und in einer Schlüsselfrage zerstrittene Partei vorgeführt. Die Querelen um die bekannteste Führungsfigur der LINKEN, Sahra Wagenknecht, und ihre verbalen und mit dem „Aufstehen“-Projekt auch organisatorischen Attacken gegen die LINKE, blieben auch in Brandenburg und Sachsen nicht verborgen, auch wenn die Bedeutung dieser Vorgänge in den Debatten in der LINKEN gerne und viel übertrieben wird. Die schlechte Performance der LINKEN in der EU-Wahl als unentschiedene Partei, hat fast schon einen Trend zur Wahlniederlage vorgeprägt.

Der Hauptgrund für den Absturz der LINKEN ist aber hausgemacht und in Politik und Auftreten der Partei speziell in den Ostbundesländern seit Anbeginn schon angelegt.

Die LINKE in Sachsen hat sich über Jahrzehnte – schon als PDS in den neunziger Jahren – nur als politische Kraft in Abhängigkeit von anderen dargestellt. Sie wollte die Regierung in der Opposition spielen und nichts sonst. Selbst die frustrierenden Wahldebakel mit einer Orientierung auf Regierungsbeteiligung und Rot-Rot-Grün haben die LINKE-Sachsen nicht aufgeweckt. Ein Aufbau der Partei außerhalb solcher Wahlkämpfe mit Regierungsoption fand nicht statt, sondern wurde auf kommunaler Ebene in verschiedener Intensität noch vorangetrieben. Die LINKE als Appendix von anderen Kräften – das kann nicht gut gehen, selbst dann nicht, wenn nur pragmatische und „realpolitische“ Ziele verfolgt werden – und schon gar nicht, wenn eine wirkliche linke Partei mit einer antikapitalistischen Perspektive und Strukturen der aktiven Selbstermächtigung das Ziel ist. Seit Jahren wird dieser entpolitisierende Kurs von denselben Spitzenleuten in der Partei verfolgt, mit immer weniger Elan und Erfolg. Da ist es schon Ironie der Geschichte, dass ausgerechnet dieser Landesverband der LINKEN den Ehrenpreis erhält, als erster Landesverband im aktuellen Wahlkampf ein Plakat geklebt zu haben, auf dem der Sozialismus als Ziel verkündet wird. Nicht wenige haben das dann auch als Selbstveräppelung angesehen.

In Brandenburg hat die LINKE ein ähnliches Trauerergebnis, aber auf anderen Wegen erzielt. Dort ist sie Regierungspartei und macht alle Fehler, die bei einer linken Regierungsbeteiligung gemacht werden können. Sie beteiligt sich nicht nur an einer fehlerhaften Politik – insbesondere zu den Themen Schuldenbremse, Verfassungsschutz, Polizeigesetz und Braunkohletagebau – sondern sie übernimmt, zuweilen in vorauseilendem Gehorsam die Verantwortung für diese Politik. Es sind die LINKEN, die als erstes Scheiße für Gold erklären, ohne damit die Verantwortung der größeren SPD für die Regierungspolitik damit zu relativieren.

Statt öffentlicher Aufklärung und Mobilisierung verschanzte sich die SPD-LINKEN-Regierung in Potsdam in fast klandestiner Krisenverwaltung. Das war keine linke Regierung und noch nicht einmal eine irgendwie „offene“ Regierung, die gegebenenfalls sogar zufällig Möglichkeiten für wirkliche linke Politik eröffnet hätte.

Wie zum Hohn hat die LINKE dann einen Wahlkampf einer Opposition in der Regierung geführt. In bester Tradition der SPD wurde das ein Wahlkampf gegen sich selbst.

6.

Aus diesem selbst verursachten Dilemma kann die LINKE auch nur selbst wieder herausfinden. Die Menschen, die heute nicht mehr wählen und insbesondere der LINKEN, wie sie ist, den Rücken kehren, können politisch gewonnen und mobilisiert werden.

Dazu muss aber sofort Schluss gemacht werden mit der Orientierung auf Regierungsbündnisse mit SPD und GRÜNEN. Wir beziehen dabei ausdrücklich auch Thüringen mit ein, wo im Oktober gewählt wird.

Eine umfassende Orientierung auf eine Politik der Opposition im Land muss sofort begonnen werden. Wir müssen die Partei der Jugend werden, die Partei des entschlossensten Widerstandes gegen die AfD und den rechten Spuk; die Partei der Klimaproteste; die Partei der radikalen Arbeitszeitverkürzung, der Rentenreform und der ausreichenden Löhne; die Partei des Kampfes gegen die innere Aufrüstung durch Polizei, Verfassungsschutz und Überwachungsbehörden und der äußeren Aufrüstung mit noch mehr Rüstung, Bundeswehr und Kriegseinsätzen; die Partei der internationalen Solidarität.

Die Strukturen der Partei insbesondere in der Fläche müssen schrittweise wiederaufgebaut und darüber hinaus ansprechende Formate für neue Mitglieder in Form von Betriebsgruppen, Schulgruppen und Aktionsgruppen geschaffen werden.

Die LINKE muss außerdem und vor allem begreifen, dass angeblich „realpolitische“ Handwerkelei im vorgegebenen Rahmen keine ausreichende linke Perspektive bietet. Die „neuen Ideen“, die jetzt überall in den Zeitungsartikeln als bei der LINKEN fehlend ausgerufen werden, sind in unseren programmatischen Grundlagen durchaus vorhanden. Ein flottes Update in Richtung einer sozialistischen Aktivist*innenpartei, die in allen wichtigen sozialen und ökologischen Fragen besser aufgestellt ist, könnte aber nicht schaden. Wenn unsere zerfledderten Ostverbände, sich aufraffen würden, in dieser Hinsicht eine neue Vorreiterrolle zu übernehmen, und mit ihnen alle unter ähnlichen Krisen leidende Teile der Partei, dann ist die linke Welt schneller wieder in Ordnung als die jetzige Katerstimmung vermuten lässt.

akl - Antikapitalistische Linke

————————————————————————

Grafikquellen       :

Oben          —        André Hahn

Abgelegt unter Brandenburg, P. DIE LINKE, Sachsen, Überregional | Keine Kommentare »

Anlass zur Unruhe

Erstellt von DL-Redaktion am 7. September 2019

AfD gewinnt, LINKE verliert deutlich

Quelle     :          AKL   

Von Claus Ludwig

Dass die AfD in keinem Bundesland zur stärksten Partei geworden ist, ist kein Grund zur Entwarnung. Die Landtagswahlen vom 1. September markieren eine Stabilisierung der offen rechtsextrem auftretenden AfD auf hohem Niveau und bestätigen deren Ergebnisse der Bundestags- und Europawahlen.

Die gestiegene Wahlbeteiligung basiert teilweise darauf, dass es eine Anti-AfD-Mobilisierung in letzter Minute gab, die überwiegend den jeweiligen Parteien des Ministerpräsidenten – CDU in Sachsen, SPD in Brandenburg – nutzte. Die Parteien der Berliner Koalition sind Wahlverlierer, doch mit dem blauen Auge davongekommen, weil es keine sichtbare Alternative zu ihrer Regierung gab.
Trotz des beschämenden Wahlergebnisses der SPD in Sachsen wird diese dort zum Regieren dringlicher gebraucht als je zuvor. Ihr Absturz beschleunigt nicht das Ende der sogenannten GroKo, sondern stabilisiert diese zunächst.
Aufgrund der gestiegenen Wahlbeteiligung legen AfD, Grüne, FDP in beiden Ländern bei den absoluten Stimmen zu, ebenso die CDU in Sachsen und die SPD in Brandenburg. Die LINKE hingegen wird in beiden Ländern prozentual fast halbiert, verliert in Brandenburg fast 48.000 (CDU: 30.000) und in Sachsen 85.000 (SPD: 38.000) Stimmen.
Die schwelende Krise der Partei, mit Schwächen bei mehreren Landtagswahlen, einem mittelmäßigen Ergebnis bei der Bundestagswahl 2017 und dem schwachen Abschneiden bei der Europawahl hat damit einen akuten Zustand erreicht.

Profillose LINKE verliert

Dafür gibt es nicht nur einen Grund. Der erste und wichtigste Schritt raus aus dem Tief der LINKEN wäre, nicht mehr so viel falsch zu machen, selbst wenn man noch nicht so genau wüsste, was danach käme. Brandenburg ist ein Paradebeispiel für die verheerende Wirkung der Regierungsbeteiligung.
Die Brandenburger LINKE hat dem repressiven Polizeigesetz zugestimmt. Sie hat entgegen dem bundesweiten Programm die Ausdehnung des Braunkohle-Abbaus mitgetragen. Sie hat Kürzungsmaßnahmen im öffentlichen Dienst beschlossen und keinen Ansatz geboten, die Probleme von Provinzflucht, schlechter Versorgung und geringer Mobilität anzugehen. 70% äußerten in einer Umfrage, die LINKE hätte „in der Landesregierung nichts durchgesetzt, was mir besonders aufgefallen wäre“. [1]

Das ist in Sachsen nicht grundlegend anders. Hier erbringt DIE LINKE den Beweis, dass man auch als Oppositionskraft eine staatstragende Haltung an den Tag legen kann.
Während diese Tatsachen für jede*n klar erkennbar sind, gehen Teile der Partei- und Fraktionsführung, vor allem die Vorsitzende Katja Kipping und der Fraktionsvorsitzende Dietmar Bartsch in die Offensive, um die Bereitschaft für das Mitregieren in Ländern und im Bund zu erhöhen. Angesichts des grünen Höhenflugs ist R2G rechnerisch wieder wahrscheinlicher geworden. Doch politisch ändert dies nichts.

Eine Zusammenarbeit mit dieser SPD und diesen Grünen ist nur um den Preis der politischen Selbstaufgabe der LINKEN zu haben. Im Osten hat die Partei ihre Funktion als soziale Protestpartei bereits weitgehend verloren, sie wird als Teil des Establishments gesehen und wird überflüssig, weil die Grünen den Spagat zwischen fortschrittlich klingenden Versprechungen und kapitalistischer Realpolitik eleganter aussehen lassen.
Es mag Zwischenhochs geben wie aktuell in Berlin oder Anfangseuphorie wie in Bremen. Am Ende kommt die Rechnung dafür, von einer grundlegend anderen Politik geredet, aber nicht geliefert zu haben.
Nichtregieren allein ist auch keine Lösung. Die sächsische LINKE gebärdet sich seit Jahren wie eine Regierungspartei im Wartestand. In ihrem Programm zur Landtagswahl spricht sie von einer „Privatisierungsbremse“, aber nicht davon, Privatisierung komplett abzulehnen und die schon privatisierten Betriebe wieder in öffentliches Eigentum zu überführen. Den sozialen Wohnungsbau
wolle man „ankurbeln“, aber die Aussage, dass das Land und die Kommunen die Wohnungen bauen werden, wollte die sächsische LINKE nicht treffen.

Soziale Frage unterbetont?

In der LINKEN wird seit Längerem darüber gestritten, ob man die „soziale Frage“ genug betone. Vor allem die Anhänger*innen von Sarah Wagenknecht behaupten, die LINKE hätte diese vernachlässigt und wäre den Grünen zu ähnlich, als großstädtische Partei, die auf Fragen wie Antirassismus und Umweltschutz setze.
Natürlich sind die bereits erlittenen sozialen Abstiege im Osten, niedrige Löhne, prekäre Jobs und Sorgen bezüglich kommender wirtschaftlicher Verwerfungen oder Altersarmut und auch die realen Erfahrungen mit der LINKEN an der Regierung Teil des Frustrations-Mixes, auf dem die Angst-
Propaganda der Rechtspopulisten basiert.
Allerdings waren soziale Gerechtigkeit und wirtschaftliche Probleme nicht die ausschlaggebenden Faktoren bei dieser Wahl. 58% in Brandenburg und 75% in Sachsen sind mit ihrer wirtschaftlichen Lage nach eigenen Angaben zufrieden. Hingegen fürchten 63% in Sachsen, dass „der Klimawandel unsere Lebensgrundlagen zerstöre“ und 60%, der „Einfluss des Islam“ werde in Deutschland „zu stark“. [2]
Es nutzt nichts, die „soziale Frage“ wie eine Monstranz vor sich her zu tragen. Sie muss konkret beantwortet werden. Dazu gehört, eine klare antirassistische Position zu formulieren. Die LINKE sollte in der Klimafrage in die Lücke stoßen, welche die Grünen lassen: Für eine radikale ökologische Wende eintreten und gleichzeitig dafür kämpfen, dass nicht die Arbeiter*innenklasse dafür bezahlt, sondern die Reichen und die Konzerne.

Klimaschutz und Arbeitsplätze

Die AfD hat flächendeckend unter „Arbeitern“ [3] gut abgeschnitten, zudem war sie im Lausitzer Braunkohlerevier erfolgreich. Mit einer Ausnahme ist sie dort in allen Wahlkreisen stärkste Partei geworden. Das Gegeneinander-Ausspielen von Ökologie und Ökonomie, von Klimaschutz und Arbeitsplätzen hat gegriffen. Wohl aus Sorge um ihre Jobs haben viele Arbeiter*innen die Klimaleugner-Partei gewählt. Hier hilft weder der opportunistische Kurs der Brandenburger LINKEN, die an der Braunkohle festhalten will noch die ignorante Haltung der Grünen, sich um die Jobs nicht zu scheren. Hier müsste eine Linke agieren, die ohne Zögern für den Ausstieg aus dem Klimakiller Braunkohle kämpft und genauso kompromisslos dafür eintritt, dass die Löhne der Braunkohle-Beschäftigen unbefristet weiterbezahlt werden bis eine gleichwertige Anschlussbeschäftigung gesichert ist. Dies wird nicht funktionieren, wenn man sich scheut, die Eigentumsfrage – die notwendige Vergesellschaftung der Energiewirtschaft unter demokratischer Kontrolle – aufzuwerfen.

Hahn Wahlkampfauftakt, August 2009 - by Die Linke Sachsen.jpg

Nachvollziehbar ist auch, dass die Braunkohle-Arbeiter*innen allgemeinen Versprechungen von Ersatzarbeitsplätzen und Strukturprogrammen angesichts Kohls historischer Lüge von den „blühenden Landschaften“ nicht trauen. Die LINKE müsste für ein umfassendes öffentliches Programm zum ökologischen Umbau der Industrie eintreten, dafür aktiv auf die Straße gehen, müsste auch in den Gewerkschaften für diese Position argumentieren und den Beschäftigen eine Perspektive aufzeigen, wie diese selbst aktiv werden können, um ihren Lebensstandard zu verteidigen.

System change

Die „soziale Frage“ lediglich defensiv aufzugreifen, im Sinne eines zweiten Aufgusses der Sozialdemokratie, wird nicht funktionieren. Es gibt keinen Platz für eine „Kümmererpartei“, welche sich anbietet, den ausgefransten Sozialstaat zu flicken. Die Klassenfrage ist untrennbar mit den großen Zukunftsfragen Migration und Klima verbunden, mit der Frage, wie wir leben wollen und wer darüber entscheidet. Die Partei sollte die „soziale Frage“ nach vorne gerichtet aufgreifen. Dazu müsste sie offensiv antikapitalistisch agieren.
Das System befindet sich, ungeachtet des noch im Bewusstsein wirkenden relativen Aufschwungs in Deutschland, in einer strukturellen ökonomischen, ökologischen, sozialen und politischen Krise. Die LINKE wird nur aus ihrer strategischen Klemme herauskommen, wenn sie Antworten auf diese Krise bietet und in den konkreten Auseinandersetzungen zeigt, dass sie sie einen Gebrauchswert hat, weil sie dies Auseinandersetzungen inhaltlich und praktisch befördern kann.
Solange der LINKEN der Mut zur grundlegenden Infragestellung des Kapitalismus fehlt, solange sie Fragen wie Klimaschutz, Wohnungsnot, Rassismus und Armut durch die Augen einer Werbeagentur sieht und sich fragt, welches Thema man wann auf die Plakate schreiben soll, gar einige einen Widerspruch darin sehen anstatt verschiedene Aspekte einer Krise des Systems, wird die Partei den Entwicklungen hinterherlaufen. Die Partei muss die Vision einer grundlegenden anderen Gesellschaft vermitteln, sie braucht eine sozialistische Perspektive, die mit konkreten
Vorschlägen untermauert werden muss.
Weder die weitere Anpassung an SPD und Grüne noch gegenseitige Schuldzuweisungen und neue Personaldebatten helfen der Partei jetzt weiter. Die LINKE muss umschwenken von einer parlamentarisch fixierten, auf die Establishment-Parteien starrenden Politik, hin zu Kampagnen, rein in die sozialen Auseinandersetzungen, muss sich als aktive Kraft beweisen, die einen Gebrauchswert für die Menschen vor Ort hat. [4]

AfD zeckt sich fest

Die Krise des Systems, das Auseinanderdriften der EU und gewachsene Widersprüche zwischen den Regionen der Welt führen zu einer Polarisierung – nach links und nach rechts. Nur findet die Polarisierung nach links, die sich aktuell in großen antirassistischen Protesten sowie der Bewegung Fridays for Future ausdrückt, keine Entsprechung auf Wahlebene. Der AfD ist es gelungen, die rechte Polarisierung bei Wahlen nahezu zu monopolisieren.

Die AfD verfügt über Eigenschaften einer „Protestpartei“. So sagen 87% der AfD-Wähler*innen in Brandenburg und 83% in Sachsen, das wäre die einzige Partei, mit der man einen Protest gegen die Etablierten ausdrücken könne.
Doch es handelt sich dabei nicht um einen fehlgeleiteten Sozialprotest, der sich leicht nach links umlenken lassen würde. Nur 14% der AfD-Wähler*innen in Brandenburg gaben an, Löhne und Renten wären ausschlaggebend für ihre Wahlentscheidung gewesen, 11% in Sachsen sagten dies über die soziale Sicherheit. 97% in Brandenburg und 99% in Sachsen gaben an, dass sie die AfD gut fänden, weil diese „den Zuzug von Ausländern und Flüchtlingen begrenzen“ will, 30% bzw. 34% sagten, Forderungen in diese Richtung wären ausschlaggebend für ihre Wahlentscheidung gewesen. [5]

Erfolg für den „Flügel“

Horst Kahrs von der Rosa-Luxemburg-Stiftung schreibt in seiner Wahlanalyse: „Wer AfD wählt, will eine andere Gesellschaft.“ Das ist vereinfacht, aber nicht falsch. Der Protestcharakter der AfD
basiert auf tiefsitzenden völkischen und rassistischen Einstellungen, sie schwimmt mit auf der weltweiten Welle reaktionärer Antworten auf die Krise des Kapitalismus. Nur 24% der AfD-Anhänger*innen sind der Meinung, die Lebensumstände hätten sich massiv verschlechtert. Aber
92% sorgen sich vor dem Einfluss des Islam und 80%, dass sich „unser Leben“ zu stark verändere.
Das erklärt auch, warum die klare Rechtsentwicklung der Partei kaum deren Beliebtheit einschränkt. Die Landesverbände in Sachsen und Brandenburg sind zur aktivistischen, militanten Rechten hin offen, der Brandenburger Spitzenkandidat Kalbitz selbst hat Kontakte zu bekennenden Nazis. Im gesamten Osten ist der völkische, aggressiv rassistische „Flügel“ um Bernd Höcke dominant.
So schnell werden wir die AfD nicht los. In einer Phase, in der soziale Kämpfe nicht offen ausgetragen werden und die Klassenfrage in den Hintergrund tritt vor scheinbaren „Wertefragen“ kann die AfD die Widersprüche zwischen ihre prokapitalistischen Wirtschafts- und Sozialpolitik und der Demagogie, sich als Vertreterin der „kleinen Leute“ zu gebärden, relativ einfach verschleiern.
Ihr Aufstieg ist kein Grund zur Panik, aber sollte Anlass zur Unruhe sein. Die AfD in der Opposition verschiebt den politischen Diskurs nach rechts und treibt vor allem die CDU vor sich her.
Durch die Wahlerfolge im Stammland von Höckes „Flügel“ wird der völkische, offen rechtsextreme Teil der Partei gestärkt. Höcke hat bereits angekündigt, sich auf die im Herbst anstehenden Wahlen für den Parteivorstand vorzubereiten. Gleichzeitig wird die AfD einem stärkeren
Anpassungsdruck ausgesetzt sein. Bald werden die Stimmen in der sächsischen oder brandenburgischen CDU lauter werden, die AfD „einzubinden“, sie zu „entzaubern“.
Eine Regierungsbeteiligung der AfD würde dem Protest- und Anti-Establishment-Gehabe der Partei einigen Schwung nehmen. Die österreichische Erfahrung zeigt allerdings, dass die Rechtspopulisten nicht durch diese derartige „Entlarvung“ strukturell geschwächt werden. Dort konnten sie sich festigen und treiben die gesamte etablierte Politik weiter nach rechts.

Zum Autor

Claus Ludwig lebt in Köln und ist Mitglied im Landessprecher*innen-Rat der Antikapitalistischen Linken NRW und im Bundesvorstand der Sozialistischen Alternative.

***

[1] Zitiert nach: Kahrs, Horst: Die Wahl zum 7. Landtag Brandenburg und zum 7. Sächsischen Landtag am 1. September 2019, Wahlnachbericht, erste Kommentare und Daten, Rosa-Luxemburg-Stiftung.

[2] Ebd.

[3] In der Wahlanalyse sind damit Arbeiter*innen im klassischen Sinn, Handarbeiter*innen in der Industrie und im Handwerk, gemeint.

[4] Zitiert nach: Kahrs, Horst: Die Wahl zum 7. Landtag Brandenburg und zum 7. Sächsischen Landtag am 1. September 2019, Wahlnachbericht, erste Kommentare und Daten, Rosa-Luxemburg-Stiftung.

[5] Ebd.

akl - Antikapitalistische Linke

———————————————————————

Grafikquellen      :

Oben       —        von Foto René Lindenau auf scharf – links

———————————–

Unten       —          Dr. André Hahn bei Wahlkampfauftakt der sächsischen LINKEN

Abgelegt unter Köln, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Die linke Krise

Erstellt von DL-Redaktion am 7. September 2019

Wie soll es weitergehen?

Bodo Ramelow, Kerstin Kaiser, André Hahn und Lothar Bisky.jpg

Aus Dresden und Erfurt Anna Lehmann

Die Linkspartei ist in Brandenburg und Sachsen auf das Ergebnis von 1990 zurückgefallen. Mit dem Ende als Ostpartei steht auch ihre Existenz als bundesweite Kraft auf dem Spiel. Wie soll es weitergehen?

erena Meiwald wird in den nächsten Tagen die Plakate abnehmen und ihr Büro im Sächsischen Landtag ausräumen. Und sich nach einem neuen Job umschauen. Der Landessportbund hat Interesse signalisiert. „Irgendwas wird sich schon finden“, sagt sie am Telefon.

Meiwald, 53 Jahre alt, saß zehn Jahre für die sächsische Linke im Dresdner Landtag. Seit Sonntag ist die einstige sportpolitische Sprecherin raus. Ihr Listenplatz 19 galt eigentlich als sicher: Die Umfragen sagten der Linken Ergebnisse um die 15 Prozent voraus. Doch am Sonntag wählten nur knapp über 10 Prozent der WählerInnen Meiwalds Partei.

Sie sei immer noch durch den Wind, erzählt Meiwald am Mittwoch. Das Wahlergebnis traf sie unvorbereitet. „Das ist jetzt nicht euer Ernst!“, habe sie gedacht, als die ersten Prognosen kamen. In Brandenburg, wo ebenfalls ein neuer Landtag gewählt wurde, das gleiche Debakel. 133.000 Zweitstimmen hat die Partei in beiden Ländern im Vergleich zu 2014 verloren. In den Landtagen ist sie jetzt nahezu halbiert.

Bei der Wahlparty der Linken in Dresden ist am späten Sonntagabend nur noch Frustsaufen angesagt. „Schreibst du mal’ne Pressemitteilung. Ich kann das nicht mehr“, sagt ein Genosse zum anderen. Am Montag steht immer noch keine Pressemitteilung im Netz. Wie soll man in Worte fassen, was viele GenossInnen nicht begreifen?

Die ostdeutsche Linke, die in den 90ern als PDS im Osten zur Volkspartei aufstieg, ist zurück auf dem Stand von 1990.

Man sucht nach Gründen: Der Wahlkampf sei geprägt gewesen von der Auseinandersetzung zwischen AfD und CDU. Leute, die eigentlich Linke wählen wollten, seien zur CDU gegangen, um zu verhindern, dass die AfD stärkste Kraft wird. Als Erklärung reicht das kaum aus. Die Linke hat an alle Parteien verloren – an AfD und CDU, aber auch an Grüne und SPD. Sogar an die FDP.

Die Wählerinnen im Osten waren immer eine Bank für die Partei, die vor 12 Jahren aus der Wahlalternative Soziale Gerechtigkeit (WASG) im Westen und der PDS im Osten hervorging. In der Parteizentrale in Berlin gilt die Faustformel: Um 7 bis 8 Prozent bei Bundestagswahlen zu erreichen, muss die Linke im Osten etwa 20 Prozent einfahren. Doch nach dieser Formel käme die Partei derzeit nicht einmal über die 5-Prozent-Hürde.

Die Wahlen in Sachsen und Brandenburg besiegeln nicht nur das Ende der einstigen Ostpartei. Sie stürzen die Linke auch als Gesamtpartei in eine existenzielle Krise.

Der Niedergang im Osten zeichnete sich seit Längerem ab. Als sich der Bundestag 2017 konstituierte, hatte die Fraktion erstmals deutlich mehr Abgeordnete aus den alten als aus den neuen Ländern. Die taz fuhr damals nach Dippoldiswalde, in das Büro von Meiwalds Kreisverband. Damals schilderten die Mitarbeiter, wie es ist, wenn die Zahl der Mitglieder, die sich ins Jenseits verabschieden, schneller steigt als die Zahl der Neu­eintritte: dass man kaum noch jemanden finde, der als Abgeordnete für den Kreistag kandidiert; dass die Beitragseinnahmen sinken und man daher Mitgliedern zu runden Geburtstagen nur noch Glückwunschkarten statt Blumen schicke. Heute, nur zwei Jahre später, wird das Dippoldiswalder Büro wohl über kurz oder lang geschlossen.

Seit Montag sucht die Linke fieberhaft nach einem Weg aus der Krise. Im Osten denken nicht wenige, dass die Ursachen dafür auch in der Vereinigung von WASG und PDS liegen. Diese sei auf Kosten des Ostens gegangen.

Hahn Wahlkampfauftakt, August 2009 - by Die Linke Sachsen.jpg

So sieht es auch die Brandenburger Linke-Vorsitzende Anja Mayer. Unterschiede seien damals zu wenig anerkannt worden, sagt sie. Mayer wuchs in Rothenburg ob der Tauber auf und lebt seit 2015 in Potsdam. Viele halten sie für eine Urbrandenburgerin, vielleicht weil sie als Arbeiterkind so bodenständig tickt. „Wir haben viel Zeit für Debatten aufgewandt, die nichts mehr mit den Leuten zu tun hatten“, sagt Mayer. Wie lange habe man sich etwa über die Frage gestritten, ob es im Programm nun „Freiheit und Sozialismus“ oder „Freiheit durch Sozialismus“ heißen müsse.

Der Rentnerin, die von 850 Euro leben muss, ist es wahrscheinlich völlig schnuppe, dass sich „Freiheit und Sozialismus“ durchsetzte. Die fragte Mayer im Wahlkampf eher, warum die Linke in Brandenburg noch immer nicht die Renten erhöht habe, obwohl sie doch seit zehn Jahren regiere. „Dass das auf Bundesebene geregelt werde, lassen die Menschen als Antwort nicht gelten.“

Quelle         :       TAZ         >>>>>           weiterlesen

—————————————————————————

Grafikquellen       :

Oben        —       German Left Party politicians Bodo Ramelow, Kerstin Kaiser, André Hahn, and Lothar Bisky in Dresden

——————————

Unten      —         Dr. André Hahn bei Wahlkampfauftakt der sächsischen LINKEN

Abgelegt unter Brandenburg, P. DIE LINKE, Sachsen, Überregional | Keine Kommentare »

Sieben grüne Gebote

Erstellt von DL-Redaktion am 6. September 2019

Wahlen in Brandenburg und Sachsen

File:Grüne protests against nuclear energy.jpg

Von Georg Löwisch

Die Grünen haben in Sachsen und Brandenburg glamouröse Prozentzahlen verpasst. Aber entscheidender ist, was sie daraus machen.

Zum grünen Höhenflug hat der Brandenburger Spitzenkandidat Benjamin Raschke vor drei Wochen einen im Rückblick klugen Satz gesagt: „Wir bleiben auf dem Teppich, auch wenn der Teppich fliegt.“ Tatsächlich ist es nämlich so, dass der Teppich nicht dort gelandet ist, wo es sich die Partei gewünscht hätte. Jedenfalls nicht, wenn man sich an die Äußerung von Raschkes Brandenburger Mitstreiterin Ursula Nonnenmacher erinnert, die sich ein wenig verfrüht als Ministerpräsidentin empfahl. Jetzt sind es in Brandenburg bloß 10,8 Prozent geworden und in Sachsen 8,6 Prozent: eher ein Höhenflügchen.

So schnell und hoch hinaus geht es eben nicht. Den Aufstieg einer Partei muss man sich eher wie eine Treppe vorstellen, die man Stufe für Stufe nehmen muss. Die Grünen sollten mal durchatmen und überlegen, wo sie stehen. Seit Annalena Baerbock und Robert Habeck die Partei führen, haben sie in Bayern, Hessen, Bremen und bei der Europawahl Stimmen hinzugewonnen. Die vielen Mandate in den Parlamenten haben die Gestaltungsmacht der Partei nur sehr begrenzt erweitert, denn sie regieren ebendort, wo sie schon vorher regierten.

Nun aber kommen zwei Länder dazu, in denen die Grünen gute Chancen haben zu regieren. In Brandenburg sind Rot-Rot-Grün und Rot-Schwarz-Grün die möglichen Koalitionen, daneben gibt es noch eine Option mit SPD, CDU und Freien Wählern und – sehr unwahrscheinlich – eine SPD-geführte Regierung mit CDU und Linkspartei. In Sachsen geht sogar nur eine schwarz-grün-rote Keniakoalition, weil Ministerpräsident Michael Kretschmer für seine CDU eine Zusammenarbeit mit der Linken oder der AfD ausgeschlossen hat

Der Erfolg einer Partei bemisst sich nicht in reiner Zustimmung, sondern daran, ob sie diese in Gestaltungsmacht umsetzen kann. Die Frage ist nicht, wie glamourös die Prozentzahlen der Grünen sind. Die Frage ist, was sie daraus machen. Sieben Punkte sind wichtig:

Erstens: Die Grünen müssen verinnerlichen, dass sie es nun sind, die den Staat verteidigen. Die Partei hat eine staatskritische Tradition, von der sie sich den scharfen Blick auf die Bürgerrechte unbedingt erhalten muss. Aber aus ihrer Geschichte heraus pflegt sie auch gern bequeme Feindbilder. Gerade in Sachsen ist es in fast drei Jahrzehnten CDU-Regierung von Biedenkopf und seinen Nachfolgern zum Selbstverständnis der Grünen geworden, sich als Rebellen wider die Staatsmacht zu sehen. Der wackere Underdog, moralisch stets im Recht – das ist auch von Brandenburg bis Bayern immer noch eine klare, einfache Rolle vieler Grünen.

Erst langsam vollzieht sich der Rollenwechsel, und der Partei dämmert, was auf dem Spiel steht. In diesem Jahr ging eine Grüne einen wichtigen Schritt in dieser Beziehung: In Görlitz steckte Franziska Schubert bei der Oberbürgermeisterwahl zugunsten des CDU-Kandidaten zurück, um den AfD-Bewerber zu stoppen. Das war richtig. Jetzt muss den Grünen klar sein, dass es um das Grundgerüst der Republik geht: Scheitert Kretschmer, scheitern wir.

Zweitens: Die Grünen dürfen sich nicht abspeisen lassen. Sie können selbstbewusst übers Regieren verhandeln. Michael Kretschmer ist jetzt belastbar. Sein Vorgänger Stanislaw Tillich trat zurück, nachdem die sächsische CDU bei der Bundestagswahl auf 26,9 Prozent gefallen war. Dagegen sind die 32,1 Prozent von diesem Sonntag stattlich. Der Erfolg – im Übrigen auch in seinem Görlitzer Wahlkreis – festigt Kretschmers Position gegenüber den Rechtskonservativen in seinem Landesverband, die durchaus mit der AfD was versuchen würden. Wäre der Ministerpräsident geschwächt, würden sie sich womöglich durchsetzen.

Chance, nicht Notgemeinschaft

Dann gibt es noch etwas, das sich die Grünen von der CDU teuer abkaufen lassen können: Strategisch bietet eine Regierung mit den Grünen der Union nämlich die Chance, sich zu modernisieren und in den Großstädten den Anschluss zu finden. Das gilt genauso für die unfassbar müde brandenburgische SPD von Dietmar Woidke, die neidisch auf die Grünen-Erfolge im Berliner Speckgürtel blickt. Wenn die Ministerpräsidenten klug sind und ihre Partner der anderen Parteien auch, dann begreifen sie ihr Bündnis nicht als Notgemeinschaft, sondern als Chance.

File:Heuschrecke, Großes Heupferd.JPG

Die Heuschrecke hat ihre Farbe nicht gewechselt

Drittens: Die Grünen müssen Themen dazugewinnen. Die Wahlen in Brandenburg und Sachsen spitzen das Problem zu, dass der Partei im Klimaschutz sehr viel zugetraut wird – aber nicht in Ressorts wie Verkehr oder Landwirtschaft, die doch für die Bewältigung der Klimakrise wichtig sind. Während nach einer Befragung der Forschungsgruppe Wahlen 39 Prozent der Sachsen die Grünen für kompetent im Klimaschutz halten, sagen das zum Beispiel nur 4 Prozent für den Bereich Infrastruktur.

Quelle         :         TAZ        >>>>>>         weiterlesen

——————————————————————–

Grafikquellen      :

Oben      —          Bündnis 90/Die Grünen protest against nuclear energy near nuclear waste disposal centre Gorleben in northern Germany

Source Politprominenz
Author Paula Schramm
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.
This image was originally posted to Flickr by kleine gelbe Ente at https://www.flickr.com/photos/84544439@N00/3016027992. It was reviewed on by FlickreviewR and was confirmed to be licensed under the terms of the cc-by-sa-2.0.

——————————–

Unten       —         Grünes Heupferd, Tettigonia viridissima, Weibchen

Author Joachim K. Löckener

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported, 2.5 Generic, 2.0 Generic and 1.0 Generic license.

Abgelegt unter Brandenburg, P.Die Grünen, Sachsen, Überregional | Keine Kommentare »

Demokratie auf Reisen?

Erstellt von DL-Redaktion am 6. September 2019

Nach den Landtagswahlen in Brandenburg

Quelle         :      Scharf  —    Links 

Von René Lindenau

Am 1.September 2019 ging die Wahl zum 7. Landtag über die politische Bühne. Einige hat sie hoch gespült, andere hat sie verstoßen. Das ist der Lauf der Demokratie. Problematisch wird es allerdings, wenn eine völkische, nationalistische, ja rechtsradikale Partei ausgerechnet am 80. Jahrestag des Beginns des Zweiten Weltkrieges erneut Lebensraum im Osten erobert.

Mit über 23 Prozent und einem Stimmenzuwachs von 11,3 Prozent stehen der AfD nun 23 Sitze zu. Nur knapp wurde die SPD erneut stärkste politische Kraft, obwohl auch sie verloren hat (26,2 / -5,7 Prozent). All zuviel Grund zur Freude hat die alte Tante mit ihrem Landesvater Dietmar Woidke also nicht. Zu einem hat seine Partei viele altgediente prominente Abgeordnete und Minister verloren und zum anderen wurde deutlich, wie tief der Riss durch die brandenburgische Gesellschaft geht. Wer es immer noch nicht gemerkt hat: Das Land hat ein Problem mit dem Rechtsextremismus, der mehr und mehr auch die Mitte der Gesellschaft erfasst hat. Faschismus kommt nicht mehr plump und nicht mehr in Springerstiefeln, sondern in Nadelstreifen und schleichend auf leichten Sohlen daher. Alle demokratischen Parteien sind endlich gefordert gemeinsam mit der Zivilgesellschaft wirksame Konzepte und Strategien zu erarbeiten und zur Anwendung zu bringen, sodass es gelingt die AfD in die Schranken zu weisen. Eine

Partei deren einziges Kapital ihre Goldreserven, Fake News, Angriffe auf Meinungs-Pressefreiheit, auf die Kunst, den Sozialstaat und rechten Geschichtsrevisionismus u.a. sind,. darf nicht mal in die Nähe einer Regierungsbank kommen.

Kommen wir zur Partei meines Vertrauens (trotz alldem), der LINKEN. Sie hat als Koalitionspartner erneut Verluste hinnehmen müssen. Schon 2014 waren es fast 9 Prozent. Da ging aber regierungstechnisch noch was. Nunmehr verlor sie weitere 7,9 Prozent und fuhr mit 10,7 Prozent ein Ergebnis ein, das an 1990 erinnert. Was ist passiert? Wurde das Warnsignal, das die Vorwahl von 2014 hatte auslösen müssen ignoriert oder wurde es schlicht überhört? Ich denke die Wahrheit hat hier mehrere Kerne. Gehen wir daran sie heraus zu schälen. DIE LINKE hat es wieder nicht vermocht die Ergebnisse ihres Regierungshandelns in die Öffentlichkeit zu tragen. Um es mit Karl Jaspers zu sagen, sie ist zu wenig das „Wagnis (mit) der Öffentlichkeit“ eingegangen. Selbst in die eigene Mitgliedschaft traten Vermittlungsprobleme und Kommunikationsschwierigkeiten zutage.

Dabei hätte es viel zu vermitteln und zu kommunizieren gegeben. Nicht nur Fehler, Versäumnisse und Ziele, die man nicht erreicht hat. Aus meiner Sicht war das lavieren in der Energiepolitik ein Grund für den gesunkenen Wählerzuspruch. Das dieses Thema innerhalb der LINKEN von Beginn an, des öfteren die Wellen hoch schlagen lässt, darf angesichts der globalen Öko Bilanz nicht länger als Entschuldigung gelten. Immerhin könnte man noch als mildernden Umstand einfügen, das mit der Regierungsbeteiligung von LINKS ein Vorrang für die erneuerbaren Energien befördert werden konnte. Nicht zufriedenstellend, ich weiß. Ein anderer Makel der linken Regierungsbilanz war die mehrheitliche Zustimmung der Fraktion zum Polizeigesetz. Auch wenn noch durch die Linkspartei einige Eingriffe in Bürgerrechte sowie gewisse Härten raus verhandelt werden konnten, das entschuldigt nichts. Folge ist, viele Akteure der Zivilgesellschaft,Vereine,Verbände – bislang potentielle Bündnispartner der LINKEN wurden auf diese Weise verprellt und sehen sich verunsichert. Vielleicht hätten die Gesetzeswerker vorher Benjamin Franklin lesen sollen: „Wer die Freiheit aufgibt um Sicherheit zu gewinnen, der wird am Ende beides verlieren“. Dank an dieser Stelle an die zwei Abgeordneten, die das Kreuz hatten, dagegen zu stimmen.

Dennoch halte ich den rapiden Rückgang in der Wählerakzeptanz für unverständlich, lässt mich fassungslos sein und mit zahlreichen Fragen, aber auch Forderungen zurück. Persönlich tut es mir um viele gute Landtagskandidaten leid, die nicht geschafft haben. Das gilt auch für erfolgreiche Minister, die nach Abgabe der Regierungsverantwortung ihre Arbeit nicht mehr werden, fortsetzen können. Inhaltlich finde ich, wenn man sich die Bilanz LINKEN Regierungshandelns von 2009 bis 2019 ansieht, kann sich durchaus sehen lassen. Nicht kritiklos, das sei nochmal betont, aber ein besseres Wählervotum hätte Brandenburgs LINKE durchaus verdient. Auch aus den eigenen Reihen! Denn viele progressive Inhalte und Forderungen konnte DIE LINKE durchsetzen So konnten in den letzten 10 Jahren 850 Millionen Euro Schulden abgebaut und gleichzeitig Rücklagen gebildet werden. Allein aus dem Nachtragshaushalt von 2018, der durch neuerliche Überschüsse möglich wurde, flossen z.B. 20 Millionen Euro in Krankenhäuser, 23 Millionen Euro in den ÖPNV,10 Millionen Euro in den Start für eine gebührenfreie Kita, 28 Millionen Euro in ein kommunales Investitionsprogramm und 36 Millionen Euro gingen in die Digitalisierung. Ist das nicht solide (linke!) Finanzpolitik? Mindestlöhne wurden fortlaufend erhöht.,ein Schüler Bafög, ein Vergabegesetz wurde eingeführt. Investitionen in die Infrastruktur wurden getätigt – statt schwarze Nullen zu hofieren., Einstellungen tausender neuer Lehrer und Kita Erzieher, die Schaffung von 400 neuen Polizeistellen, Schulneubau und Sanierung standen auf der Agenda. Ebenso die Ankurbelung des sozialen Wohnungsbaus. Die Finanzausstattung der Kommunen wurde erhöht, nicht zuletzt wurden den 4 kreisfreien Städten ein Schuldenerlass gewährt, was ihnen wiederum eine größeren Gestaltungsspielraum zurück gab. Ferner wurden auch in Verantwortung von LNKEN Ministern alle 56 Krankenhausstandorte nicht nur erhalten, sondern zum Teil ausgebaut, Die Bekämpfung der Armut war ein weiteres Thema, wobei man auch Fortschritte erzielte. Das war doch alles nichts? Das macht so eine Partei in meinen Augen nicht (so krass jedenfalls) weniger wählbarer. Ich verstehe es nicht!? Was bleibt?

Die Kommunikation innerparteilich wie in die Öffentlichkeit muss endlich nicht nur auf den Prüfstand, sie muss danach soweit auch fundiert, den Praxistest bestehend, die Mitglieder neu motivieren und sie dann mitnehmen, um verlorene Wählerschichten zurück zu gewinnen. Die schon einmal erreichte Verankerung in der Gesellschaft ist zurück zu gewinnen. Ich sehe hier die übrig gebliebenen Abgeordneten und ihre Wahlkreismitarbeiter, aber auch alle Gremien sämtlicher Ebenen, nicht zuletzt jedes Mitglied in Verantwortung. Zahlreiche inhaltliche Unklarheiten sind endlich zu entschlüsseln und sind einer Beschlusslage zu zu führen.Vollständig wird das nie gelingen, aber manche dieser Fragen, sind schon fünfmal und mehr über das Richtfest hinaus. Möglicherweise brauchen wir eine neue linke Erzählung á la Brandenburg – aber in lesbarer verständlicher Form. Es kann künftig nicht nur um Mitgliedergewinnung gehen..Worum es geht, ist der Aufbau von politischen Nachwuchs. Dabei können auch ausgeschiedene Abgeordnete bzw. Vorstandsmitglieder helfen. Die Partei muss raus aus dem Krisenmodus, indem sie erneut steckt. Nur Ratschläge und Analysen zur Wahl von einer Sahra Wagenknecht, die in den letzten Jahren nur noch durch die Ignoranz von Mehrheitsbeschlüssen der LINKEN, durch Medienschelte ihrer Partei, beim Überschreiten roter Linien gesehen, aber seit Jahren nicht mehr im eigenen Wahlkreis – spreche ich jedes Recht sich entsprechend zu äußern. Da wirft sie doch der LINKEN vor, sie habe sich von „Unzufriedenen entfremdet“. Sagt die Frau, die sich eher mit Frau Petry auf das Podium setzt, als bei unteilbar „Gesicht zu zeigen“.

Dass ein Minderertrag an Wählerzuspruch ein Automatismus ist, der zwingend mit linker Regierungsbeteiligung einhergehen muss, das Gegenteil beweisen gerade die Berliner Genossen. Sie haben ihre ersten 10 Senatsjahre kritisch und solidarisch ausgewertet, Fehler benannt, offen mit der Basis diskutiert und Schlussfolgerungen gezogen. Und nun läuft es weit besser.

Vielleicht gehen beide Landesverbände jetzt mal in Klausur, um das „Was tun“ zu beraten.

Der Gang in die Opposition ist aus Sicht der Linkspartei wohl, der Weg, der ansteht. In ihr gilt es sich personell und konzeptionell zu erneuern, vielleicht auch zu alter innerparteilicher Solidarität zurückzufinden – wie ich sie anfangs kennenlernte. Möge sie sich wieder finden, ehe sie sich womöglich noch weiter der 5 Prozent Hürde nähert.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————–

Grafikquelle       :

Text & Foto René Lindenau auf scharf – links

Foto von einer Regionalkonferenz

Abgelegt unter Brandenburg, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Adé Linkspartei… ??

Erstellt von DL-Redaktion am 5. September 2019

Vom Mosaik zum Flickenteppich

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–100.jpg

Von  jpsb

Es war klar: Der Abend würde nicht schön werden für die Partei Die Linke. Die Umfragen deuteten die Demontage als Volkspartei im Osten an. Der Wähler spitzte den Paradigmenwechsel zu. Mit knapp zweistelligen Ergebnissen zeigten die nackten Zahlen die Agonie der Erben des Kasernensozialismus an. Und nicht allein der rasante Aufstieg der AfD war Teil der Grabesprozession der Genossen, sondern auch das Wegsterben der eigenen Wählerklientel gehört zum Todeskampf einer Partei, die zu viele Jahre zu sorglos allein von den Schwächen anderer politischer Kräfte mühselig am Leben gehalten worden war.

Granden aller Flügel erheben nun Anspruch auf die richtige Fehleranalyse. All dies klingt nach einer fatalen Mischung aus “Haltet den Dieb” und “Pfeifen im Walde”. Denn die Probleme der Partei liegen tiefer. Eine Auswechslung der inhaltlich schwachen und formatlosen Parteivorsitzenden bringt nichts mehr. Die Partei hat auf dem Parteitag in Göttingen die Chance auf einen echten Machtkampf verpasst. Riexinger und Kipping sind lediglich der Ausdruck dafür, dass die politische Klasse der Partei lieber gemeinsam auf einem immer löchrigeren Rettungsboot ausharren will, als unter Einsatz echter persönlichen Risiken um eine zukunftsfähige Partei zu kämpfen.

Die Zeiten in denen Reformer im Stile eines Joschka Fischer um die ideologische Macht in der Partei kämpfen wollten gab es nie in der Linken. Immer galt die Devise, dass im Osten die Regierungsgeschäfte als Volkspartei dafür Sorge tragen würden, dass es genug Posten, Pöstchen und Minipöstchen zu verteilen gab. So wurde die harte der Schule des Kampfes um eine gesamtdeutsche Linkspartei gar nicht erst in Angriff genommen. Die damit verbundene Profillosigkeit der Partei hat sie nun im wahrsten Sinne des Wortes zu Tode geschrumpft.

Bunte Westen 03.jpg

Das Personal, welches an diesem Sonntag seine Arbeitsgrundlage im Politikbetrieb verloren hat, kann nicht mehr in einem anderem Teil des darbenden Apparates  untergebracht werden. Auch das ist eine fatale Folge der Niederlagen.

Quelle         :        Potemkin         >>>>>       weiterlesen

————————————————————————

Grafikquellen        :

Oben        —      Bundesparteitag Die Linke 2018 in Leipzig

Abgelegt unter Berlin, P. DIE LINKE, Schicksale, Überregional | Keine Kommentare »

Verpackungsmüll vermeiden

Erstellt von DL-Redaktion am 5. September 2019

eine Erfahrung bei REWE Saarbrücken-Burbach

File:Burbach Bergstraße.JPG

Bergstraße im Zentrum von Burbach

Quelle       :       Scharf  —  Links

Von Dr. Nikolaus Götz

Die Mitarbeiter von REWE-Saarbrücken-Burbach sabotieren die angestrebten Ökoziele von REWE-Deutschland, verärgern die Kunden und gefährden so das Umweltimage des REWE-Konzerns.

„Um Verpackungsmüll zu reduzieren, arbeitet die REWE Group daran, Verpackungen nach Möglichkeit durch umweltfreundlichere Lösungen zu ersetzen. So wurden bereits die Verpackungen von über 1.400 Artikeln umgestaltet und auf diese Weise alleine bei REWE und PENNY über 8.200 Tonnen an Kunststoff pro Jahr gespart.“

(Siehe: rewe-group.com/de/startseite)

Während die deutsche Zentrale der REWE Group gerade 10 Jahre Nachhaltigkeits-berichterstattung feiert und sich selbst für ihre tolle Ökobilanz lobt, sabotiert die Saarbrücker Mitarbeiterbasis des Verkaufsmarktes in SB-Burbach die lobenswerte Bemühungen ihrer Zentrale. Am Samstag dem 31. August 2019 erteilte so das verantwortliche Management des REWE-Marktes von Saarbrücken-Burbach (Käthe-Kollwitz-Srtraße 16, 66115 SB-Burbach; Tel. 0681/761 980) einem Kunden Hausverbot, weil dieser seine Wurstwaren in einer wiederverwendbaren Frischhaltebox einkaufen wollte. Unglaublich dieser Fall von Borniertheit und Intoleranz gegenüber einem Kunden, der laut Aussagen der Managerin bei REWE Frau K. als Kunde „kein König“ sei, wie eigentlich die diesbezügliche deutsche Rede lautet. Auch der geforderte Einblick in die zitierte REWE-Verordnung, mit der der Einkauf der Fleischwaren in die metallene Box verweigert wurde, wurde nicht gestattet. Diese Anweisungen seien, so die Begründung der Filialleiterin, nämlich „nur betriebsintern zu verwenden“. Der Kunde beendete umgehend sein Beschwerdegespräch, da reine Zeitverschwendung und beglich an der REWE-Kasse noch seinen vorab getätigten Wareneinkauf. Am Kassenschalter eröffnet ihm dann der ansonsten stets freundliche Kassierer, dass die ’Hausleitung’ ihm ab sofort „Hausverbot“ erteilen würde, ohne eine Begründung für das ausgesprochene Verbot zu geben. Der natürlich ob des Vorfalles verärgerte Kunde verließ den Geschäftsteil des REWE-Ladens mit den Worten: „Ich muss doch nicht bei REWE einkaufen!“ Er fuhr umgehend zum nahe gelegen EDEKA-Markt, wurde allerfreundlichst an der dortigen Fleischtheke bedient und bekam seine Frischhaltedose wie gewünscht gefüllt. Danke EDEKA!

File:Saarbrücken St Johanner Markt Brunnen.jpg

Saarbrücken St Johanner Markt Brunnen

Neben dem EDEKA sind auch andere Zwischenhandelsmärkte einem starken Konkurrenzkampf ausgesetzt. Deshalb werben sie intensiv mit Sonderangeboten um die Kunden, bieten saisonale Regionalprodukte für den mehr ökologisch kaufenden Verbraucher an und versuchen mit ’Bioprodukten’ zu glänzen. Neben der EDEKA-Kette bieten auch die saarländischen Globusmärkte ihren Kunden inzwischen die Möglichkeit, eine eigene wiederverwendbare Einkaufbox mitzubringen. Doch das Verpackungswunschziel heißt „plastikfreie“ Einkaufsbox! Für einen ökologisch handelnden Menschen beginnt so die Suche nach seiner Idealverpackung. Glas als Boxmaterial scheidet, da zu schwer und ggf. zu zerbrechlich, aus und auch ein Pappekarton ist eher ungeeignet. Alle Plastikbehälter scheiden, da ja aus Plastik, aus, doch was bleibt dann? Die Erinnerung geht zurück in die „gute alte Zeit“, als es noch Butterbrotboxen für das Pausenbrot gab, womit die Lösung gefunden wäre. Ein kleine sogenannte ’Butterbrotbox’ (siehe google: butterbrotbox) ist ideal auch zum Fleischeinkauf geeignet. Das im Einkaufsmarkt auf Papier gewogene Fleischprodukt kann sogar mit in die Box gelegt werden und verbessert so die Hygiene. Nach dem Abwiegen des Produktes kann der Preis für die Fleischware auf den verschließbaren Deckel geklebt werden und garantiert so wie eine Plombe an der Kasse eine richtige Befüllung. Doch ein solch relativ einfaches Pro cedere übersteigt scheinbar die Ordnungskapazität des Managements im REWE-Kaufmarkt von Saarbrücken-Burbach. Schade! Doch gibt ja neben REWE wie erwähnt auch andere ökologisch orientierte Einkaufsmärkte.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquelle       :

Oben         —        Bergstraße im Zentrum von Burbach, Saarbrücken, Saarland

Author atreyu
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Unten         —         

DescriptionSaarbrücken St Johanner Markt Brunnen.jpg
Deutsch: Stiefel links
Author LoKiLeCh

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Saarbrücken, Saarland, Überregional, Umwelt | Keine Kommentare »

Schwere Verluste für LINKE

Erstellt von DL-Redaktion am 4. September 2019

bei der Landtagswahl am 01.09.2019 in Brandenburg

Quelle       :         Scharf  –   Links

Von Wolfgang Gerecht

DIE LINKE taumelt orientierungslos durch den politischen Ring. Erste Stimmen in der LINKEN rufen nach der 999. Strategie-Debatte.

Mit einem katastrophalen Ergebnis von ursprünglich 18,6% auf 10,7% also ein Verlust von 7,9% bekommen die Mit-Regierungs-Fans in Brandenburg von den Wählern die Meinung gesagt. Der Linken wird von ihren potentiellen Wählern abgesprochen, dass sie eine soziale Alternative für sie sei.

Spitzen-Kandidatin Frau Dannenberg plappert in den Fernseh-Runden genau so hilflos einige Standard-Sätze daher wie der Bundesgeschäftsführer  Schindler in der Berliner Runde.

Der Verzicht von vielen potentiellen LINKEN-Wähler Innen ist insbesondere eine Quittung für die permanente Missachtung der politischen Programmatik der Partei in Regierungsverantwortung. Einige konkrete Beispiele:

  • für die Akzeptanz des klimaschädlichen Braunkohlen-Abbaus ohne eine einzige nennenswerte Bemühung für einen Strukturwandel zugunsten der Beschäftigten in der Braunkohle-Industrie in 10 Jahre Mit-Regieren in Brandenburg.
  • für die Akzeptanz der Hartz IV-Verwaltung (DIE LINKE: Hartz IV muss weg), deren Gesetzgebung maßgeblich durch die SPD und deren Architekten der AGENDA 2010, den SPDler Steinmeier, konstruiert wurde.
  • für die Akzeptanz des Inlands-Geheimdienstes („Verfassungsschutz“) (NSU-Ausschüsse im Bundestag und zahlreichen Bundesländern, als Konsequenz fordert DIE LINKE propagandistisch die Abschaffung dieses Inland-Geheimdienstes.)
  • für die Akzeptanz zur Möglichkeit der Autobahn-Privatisierung im Bundesrat. Auch zeigte DIE LINKE ihre Zuverlässigkeit für die internationalen Finanz-Investoren (Blackrock und viele andere)  und gleichzeitig ihre totale Unbrauchbarkeit für die Interessen des Gemeinwohls der Gesellschaft.
  • für die Akzeptanz der neuen Polizei-Gesetze. Der Parteiausschluss-Antrag des  Kreisverbandes DIE LINKE. Siegen-Wittgenstein (www.scharf-links.de/90.0) gegen die LINKEN-Zustimmer zu den neuen Polizeigesetzen im Brandenburgischen Landesparlament hat durch die Wähler – nicht durch die Partei DIE LINKE – eine gewisse Bestätigung erhalten.

7 von vorher 17 – mit Steuergeldern hoch dotierte Mandate sind weg. Und dennoch ist DIE LINKE noch im Spiel um – das nicht nur im Osten  geliebte „Rot“-„Rot“-GRÜN zu praktizieren. Wahrscheinlich werden die PDL-Oberen in Brandenburg und in der Partei-Zentrale in Berlin (Karl-Liebknecht-Haus) bereit sein,  jede politische Zumutung zu akzeptieren, nur um nochmals in die Landesregierung zu kommen. Dabeisein und für sich selbst und ihre Günstlinge zu profitieren, ist offenbar die Hauptsache. Einen pflegeleichteren Koalitionär  kann Herr Woidke (SPD) nicht bekommen.

Ob das Herrn Woidke (SPD) ausreicht wird sich zeigen. Eine deutlichere Mehrheit hat er, wenn er mit der CDU statt mit DER LINKEN koaliert. Das wäre auch der natürliche SPD Standard-Partner, wie langjährig in der Bundespolitik und Landespolitik praktiziert. So wird es auch in Sachsen wahrscheinlich laufen („Kenia“-Koalition nennen es die „Experten“, wie bereits in Sachsen-Anhalt).

Es haben sich potentielle LINKE-Wähler Innen der Partei in den vergangenen 10 Jahren (2009: 26 Sitze, 2014: 17 Sitze, 2019: 10 Sitze) stetig, von LTW zu LTW von der Partei abgewendet.

Der Grund dafür muss wohl sein, dass sie feststellen mussten, dass auf diese selbsternannte LINKE,  kein politischer Verlass ist, dass DIE LINKE Brandenburg ihren Wählern mehr Schaden als Nutzen brachte.

Die „Eroberung von Mandaten“ zum Zwecke der eigenen ökonomischen Sicherheit und der Stärkung ihrer parteipolitischen internen Machtstellung im Sinne der Aufstellung auf einen günstigen Listenplatz bei den nächsten Wahlen ist wohl für „die da Oben“ wichtiger als ein sachgemäßer Einsatz für die Interessen der arbeitenden Bevölkerung auf Basis der programmatischen (Wahl-Programm-) Aussagen.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————

Grafikquelle      :       Ein bunter Scherbenhaufen von rot  bis braun – ein Scherbenhaufen

Abgelegt unter Brandenburg, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Saar-Linke-Fraktionschef

Erstellt von DL-Redaktion am 3. September 2019

 Lafontaine hält Politik der SPD für ihr Problem

Bundesarchiv B 145 Bild-F079284-0010, Münster, SPD-Parteitag, Lafontaine.jpg

Ja, irgendwo haben die, welche sich selbst zu Politikern schmückenden Barden wohl immer recht, zumindest reden sie so lange darüber bis sie es selber Glauben, dass auch andere ihren Geschwätz glauben schenken. Aber jetzt, nach all den Jahren mit einer neuen Partei, ebenfalls auch so ziemlich alle Zeile verfehlt zu haben, würde ich mich bei meinen Reden vor einen Spiegel stellen, um mich selber beobachten zu können!

Aber – hielt er selber die Parteizügel nicht in beiden Händen, um dementsprechend die Richtung vorgeben zu können? Bringt die Besserwisserei heute noch etwas? Ändert es etwas an der Sachlage, oder ist es nicht mehr als eine melancholisch versteckte Kritik an die eigenen Versäumnisse und den Kurs seiner Nachfolger ? Vielleicht sind die Denkmale, welche Politiker so gerne für die Nachwelt hinterlassen möchten, noch nicht hoch genug um die eigene Eitelkeit zu befrieden?

Sorgen die Politiker Innen durch die eigene Überschätzung ihrer Möglichkeiten und ihres Verstandes nicht für die größten Querelen innerhalb ihrer Parteien ? Sollte sich ein Oskar Lafontaine nicht genau über die Stärken und Schwächen seines Kontrahenten Gerhard Schröder informiert haben? Sich also von der Situation überraschen lassen haben? Wenn es so war wie es heute aussieht, spräche es nicht gerade für Klugheit, den Posten für Finanzen  angenommen zu haben, da scheint es auch besser aus einer Partei hinaus geschmissen zu werden, anstatt davon zulaufen !

Red. – DL  – IE

Von dpa/lrs

Die SPD muss sich aus Sicht des früheren Vorsitzenden und jetzigen Linke-Politikers Oskar Lafontaine vor allem inhaltlich neu aufstellen.

„Das Problem der SPD in den letzten Jahren waren nicht allein die Vorsitzenden. Das Problem der SPD ist ihre Politik“, sagte der saarländische Linke-Landtagsfraktionschef der Deutschen Presse-Agentur (DPA) in Saarbrücken.

Quelle     :           Saarbrücker-Zeitung               >>>>>           weiterlesen

——————————————————————

Grafikquelle       :

Oben     —       For documentary purposes the German Federal Archive often retained the original image captions, which may be erroneous, biased, obsolete or politically extreme. 30.8.-2.9.1988 SPD-Parteitag in Münster, Halle Münsterland

Abgelegt unter Feuilleton, P. DIE LINKE, Saarland, Überregional | 1 Kommentar »

Linke Wahlniederlage Osten

Erstellt von DL-Redaktion am 3. September 2019

Mietendeckel und ökologisches Profil der Partei

Karl-Liebknecht-HausSchuschke.JPG

Quelle     :     AKL      

Bericht von der Parteivorstandssitzung vom 01./02.09.2019

von den AKL-Bundessprecher*innen im Parteivorstand Thies Gleiss und Lucy Redler

Die PV-Sitzung war erneut mäßig besucht mit 28 anwesenden Mitgliedern des Parteivorstands am Sonntag und etwa gleichviel am Montag. Montag waren zusätzlich die Spitzenkandidat*innen aus Brandenburg und Sachsen anwesend.

Am Sonntag waren die dominierenden Themen der Mietendeckel, die Haltung der LINKEN zur CO2-Bepreisung und einige Schlussfolgerungen aus den Europawahlen.

Mietendeckel

Kurz vor der Parteivorstandssitzung wurde ein erster weitgehender Entwurf zum Mietendeckel aus der Senatsverwaltung von Katrin Lompscher (LINKE) in der Öffentlichkeit bekannt.

Dieser Entwurf war eine radikale Ansage an die Immobilienwirtschaft mit deutlichen Obergrenzen und der klaren Option auf Absenkung der Mieten. Er kam außerordentlich gut an bei Mieterinitiativen und außerordentlich schlecht bei der Immobilienwirtschaft.

Es folgte eine breite öffentliche Debatte mit massiven Angriffen auf DIE LINKE durch FDP, CDU, AfD und Immobilienverbänden. Es wurde klar, dass der Mietendeckel eine klassenpolitische Frage ist und ein Instrument, das für alle Mieter*innen Verbesserungen bedeuten kann. Bürgerliche Medien regierten mit Schaum vorm Mund und Sozialismus- und Planwirtschaftsvorwürfen und der Darstellung, dass DIE LINKE Berlin anzünde (Morgenpost).

Thies Gleiss stellte in der Sitzung fest, dass dieser erste Entwurf und dessen (wenn auch ungeplante Veröffentlichung) ein positives Beispiel sei, wie das Agieren der LINKEN aussehen müsste: lautstark ohne Rücksicht auf die Koalitionspartner in der Öffentlichkeit verkünden, was man fordert, dafür in der Bevölkerung Unterstützung mobilisieren, dann die Kräfteverhältnissen bewerten und sehen, was in Verhandlungen durchsetzbar ist. Er führte aus, dass das im Gegensatz stehe zu der Teilnahme der LINKEN an Hinterzimmerverhandlungen bei der Aufstellung der GRÜNEN-SPD-LINKE-Koalition in Bremen.

Doch statt diesen Entwurf weiter zu verteidigen (oder zumindest länger zu verteidigen, wie andere beipflichteten), wurde schnell ein zweiter, mit den Koalitionspartnern abgestimmter und abgeschwächter Entwurf öffentlich vorgestellt. Eine Argumentation dazu war, dass dieser eher Klagen vor dem Bundesverfassungsgericht standhalten könnte als der erste Entwurf.

Es ist festzustellen, dass die im zweiten Entwurf festgehaltenen Regeln ein Fortschritt im Vergleich zur Lage vor zwei Jahren darstellen, diese jedoch im Vergleich zum ersten Entwurf deutlich zahmer sind („atmender“ Deckel, Deckelgrenze liegt höher, Mietsenkungen sind schwerer durchsetzbar, Eigenbedarfskündigungen sind nicht ausgeschlossen).

Lucy betonte in der Debatte, dass es jetzt zentral ist, Gegendruck aufzubauen und die eigenen weitergehenden Forderungen zum Mietendeckel und die Enteignung von Deutsche Wohnen und Co. gemeinsam mit der mietenpolitischen Bewegung auf der Straße zu erkämpfen. Das ist auch das beste Rezept dafür, dass der Entwurf nicht weiter abgeschwächt wird in Verhandlungen mit SPD und Grünen.

Es bleibt festzuhalten: Alles was bisher erreicht wurde, wurde nicht durch geschickte Verhandlungen mit SPD und Grünen, sondern durch Druck der Bewegung erreicht. Die Haltung der Grünen in Berlin ist bezeichnenderweise, dass Mieterhöhungen beim Mietendeckel weiter möglich sein müssen. Ein wichtiger Termin für die Diskussion über Forderungen der mietenpolitischen Bewegung zum Mietendeckel und den Aufbau der mietenpolitischen Bewegung ist das geplante Bündnistreffen in Berlin am 3.9. und die Demo am 28.9.

Maßnahmen gegen den Klimawandel und die Haltung der Partei zur CO2 Besteuerung mit den Gästen aus der Bundestagsfraktion: Ralph Lenkert, Gösta Beutin und Jörg Cezanne

Die Debatte drehte sich vor allem um die Kontroverse, ob DIE LINKE einen eigenen Vorschlag zur CO2 Bepreisung einbringen sollte oder nicht. Dabei gab es die Einigkeit von Befürworter*innen und Gegner*innen, dass andere Maßnahmen (Umbau der Produktion, Kohleausstieg, kostenloser ÖPNV, Verlagerung auf die Schiene, Konzerne bestrafen, andere ordnungspolitische Maßnahmen etc) zentrale Antworten der LINKEN sind.

Die Diskussion drehte sich eher darum, wie DIE LINKE damit umgehen soll, dass bei Fridays for Future die Forderung nach CO2 Steuer populär ist und ob es eine soziale Variante der CO2 Steuer geben kann, die nicht alle gleichermaßen belastet.

Dazu stellte Jörg Cezanne aus der Bundestagsfraktion ein Konzept für eine ihm zu Folge sozial gerechte CO2-Bepreisung, genannt „Öko-Bonus-System“, vor.

Gewichtige Gegenargumente, die eingebracht wurden, waren:

– es ist schwer vermittelbar, dass Menschen aus der Arbeiter*innenklasse erst die CO2 Steuer zahlen sollen und dann Gelder zurück bekommen; die Frage ist auch, wer am Ende darüber entscheidet, ob und was zurück gezahlt wird

– in Finnland gibt es seit 30 Jahren eine CO2 Steuer ohne große Wirkung

– die Debatte um CO2 Bepreisung lenkt von zentralen Aufgaben (Produktion umstellen, Vergesellschaftung etc) ab und steht vor allem deshalb im Mittelpunkt der Debatte, weil die Industrie sich eine solche am ehesten leisten könnte (kostet zwar Geld, aber geht nicht an die Wurzel des Problems, sie können versuchen sich freizukaufen)

– eine Tonne CO2 ist nicht gleich eine Tonne CO2: die Tonne CO2 von einer Familie mit schlecht gedämmter Wohnung ist etwas anderes als eine Tonne CO2 einer Kreuzschifffahrt

– die Diskussion ist eine Wiederholung einer Debatte, die es bereits 1984-86 gab, die Gegenargumente, die der verstorbene Elmar Altvater dazu erarbeitete, sind noch heute aktuell; die wichtigere Debatte ist jene, wie die Gewerkschaften und die Arbeiter*innenklasse in die Klimastreiks am 20.09. einbezogen werden können und wie aus einer Jugendbewegung eine Klassenbewegung werden kann

– kann es eine CO2-Steuer nur für Unternehmen als Abgabesteuer geben?

Die Diskussion war kontrovers und auf hohem Niveau. Einige vertraten die Position, dass wir die CO2 Steuer nicht fordern, aber wenn sie kommt, Anträge zur Ausgestaltung stellen sollten.

Am Ende gab es ein Stimmungsbild darüber, ob DIE LINKE – wenn angesprochen auf die CO2-Steuer – in Richtung des Papiers von Jörg Cezanne argumentieren soll oder sich gegen die CO2 Steuer aussprechen soll. Thies und Lucy votierten für Letzteres, das Stimmungsbild ergab 50:50 Prozent für beide Positionen.

Aufruf zum Klimastreik am 20.09.

Der Parteivorstand diskutierte und beschloss einen Aufruf zur Mobilisierung zum Klimastreik am 20.09. Auf Antrag von Thies und Lucy wurden u.a. folgende Punkte ergänzt:

1. Wir unterstützen Fridays for Future und andere in der Forderung, dass der DGB und alle Gewerkschafter*innen an diesem Tag Streikaktionen aktiv durchführen. Mitglieder der LINKEN in Betrieben und Gewerkschaften unterstützen Aufrufe in diese Richtung.

2. System change not climate change

Wir kämpfen für jede sofortige Verbesserung und wissen zugleich, dass diese Verbesserungen im Kapitalismus nicht von Dauer sein werden. Dieses System basiert auf Profit und Konkurrenz. Wir wollen stattdessen eine sozialistische Gesellschaft, in der die Bedürfnisse von Mensch und Natur im Mittelpunkt stehen. Wie wir dahin gelangen, wird in der LINKEN und ihrem Jugend- und Studierendenverband offen und kontrovers diskutiert. Mach mit und misch dich ein – für eine lebenswerte Zukunft für uns alle.

3. DIE LINKE tritt für die Umstellung der Produktion auf ökologisch sinnvolle Mobilitätssysteme ein.

Nicht angenommen wurde leider: „Dazu ist die Enteignung und Vergesellschaftung der Autoindustrie bei Erhalt aller Jobs und Löhne Voraussetzung.“

Die Gegenargumentation zu diesem letzten Punkt war, dass wir das zwar allgemein fordern könnten, es aber angesichts des Bewusstseins von Kolleg*innen in der Autoindustrie nicht als Tagesforderung hilfreich sei.

Beschlussvorlage zu Vorhaben nach den Europawahlen

Es gab bereits bei der vorigen PV-Sitzung Diskussionen zur Analyse und Schlussfolgerungen aus den Europawahlen. Zur Analyse der Wahlen gab es keine Einigkeit zum Beispiel über die Frage, ob DIE LINKE offensivere Angebote für (angeblich) linke Mehrheiten machen sollte oder einen stärkeren Oppositionskurs fahren sollte.

Verständigt wurde sich jedoch auf ein Papier mit ein paar politischen Schlussfolgerungen zur Schärfung des sozialen und ökologischen Profils und für die praktische Arbeit zur Klimabewegung, Kampf gegen Rechts, Organizing, Mietenbewegung etc. Auch hier konnten Thies und Lucy an verschiedenen Stellen eine Linksverschiebung erreichen.

Abgelehnt wurde der Änderungsantrag von Lucy und Thies, dass die LINKE dringend eine breite Debatte über die zu große Orientierung der Partei auf Wahlkämpfe und parlamentarische Arbeit und den zu großen Einfluss der Parlamentsfraktionen auf die Partei beginnen sollte.

Weitere Themen wurden zudem unter Aktuelles angesprochen:

– die erfolgreiche unteilbardemo Dresden am 24.8. mit 40.000 Menschen

– die Intervention in der Straße von Hormus; Maas und die Groko gehen in die Richtung eines eigenständigen militarischen Weg

– die Brände in Brasilien

– der Jahrestag des Überfalls durch Nazideutschland auf Polen

– die Debatte über die Gründe der Erfolge der AfD im Osten

– die Debatte über die Hohenzollern- Entschädigung in Brandenburg

– das Gesetz von Spahn zur weiteren Einschränkung der Assistenz-gestützten privaten Lebensgestaltung von Behinderten.

Beschlossen wurde ein Antrag zur Verurteilung der Absetzung der gewählten Bürgermeister*innen der HDP und zahlreicher Festnahmen von Politiker*innen, Aktivist*innen und Journalist*innen in der Türkei

Antrag auf Vorziehen des Bundesparteitags

Dem PV lag ein Antrag aus Schleswig-Holstein vor, im ersten Quartal 2020 einen Bundesparteitag abzuhalten, um alle zentralen strittigen Fragen in der LINKEN zu diskutieren und zu entscheiden. Dies wurde mehrheitlich abgelehnt, mit der Begründung, dass erstens ein vorgezogener Parteitag im Falle von Neuwahlen sinnvoll sei, zweitens der reguläre Parteitag im Juni verlängert werden könnte, um über die Positionierung der Partei zu Klima zu diskutieren (wird seit langem u.a. von der Ökologischen Plattform eingefordert), drittens es nicht sinnvoll ist, alle strittigen Fragen (Haltung zu Russland, Grundeinkommen, Migration etc) mehrheitlich zu entscheiden.

Mitgliederbericht

Der Parteivorstand nahm außerdem den Mitgliederbericht im 2. Quartal und 1. Halbjahr 2019 zur Kenntnis. Ein Trend bei Austritten ist, dass vor allem jene austreten, die entweder seit kurzem oder seit langem dabei sind. Es wurden Anregungen zur Mitgliederbetreuung passiver Mitglieder besprochen und es gab eine längere Diskussion darum, was Gründe für Mitgliederverluste oder Inaktivität sind. Die Zielstellung ist, auf 100.000 Mitglieder bis 2028 zu wachsen.

Teilhabekonzept

Die Inklusionsbeauftragte der LINKE Margit Glasow stellte das Teilhabekonzept der Partei vor. Margit warb erneut dafür, dass Inklusion nicht nur Menschen mit Behinderungen einschließt, sondern als Chancengerechtigkeit für alle in der Gesellschaft verstanden wird. Es gibt zwar eine breite Debatte zu Inklusion, aber in der Realität im Kapitalismus eine Rückentwicklung und eine Betrachtungsweise der Menschen als Kostenfaktor. Grundlegend kann dies nur in einer sozialistischen Gesellschaft geändert werden. Aber wir als Partei müssen tagtäglich um Inklusion innerhalb unserer Partei streiten. Dabei gibt es oftmals eine Diskrepanz zwischen Anspruch und Realität, vor allem auf der Ebene der Kreisverbände. Das beschlossene Papier ist sicher in Kürze auf der Website der LINKEN zu finden.

Pflegekampagne

Diskutiert wurde eine Vorlage als Information und Vorbereitung zur weiteren Diskussion mit Bündnispartner*innen. Lucy sprach das Problem an, dass der rot-rot-grüne Senat in Berlin die Zulässigkeit des Berliner Volksentscheids für mehr Personal im Krankenhaus vor dem Landesverfassungsgericht juristisch klären lassen will. In anderen Bundesländern sind entsprechende Initiativen bereits juristisch blockiert worden.

Der Gang vors Landesverfassungsgericht Berlin und die Tatsache, dass DIE LINKE Berlin in der Öffentlichkeit keine alternative Position dazu eingenommen hat, wurde von Aktiven des Berliner Bündnisses als Affront wahrgenommen. Hinzu kommt das Problem, dass die juristische Begründung des Senats (das Land habe keine Gesetzgebungskompetenz, sondern der Bund, Kopplungsverbot etc) der Argumentation aller anderen Volksentscheide für mehr Personal im Krankenhaus, aber auch unserer eigenen juristischen Einschätzung zur Einführung des Mietendeckels auf Landesebene widerspricht und in den Rücken fällt. Eigentlich wäre es auch die Aufgabe der Landesregierungen, an denen die LINKE beteiligt ist, solche Gesetze auf Landesebene als Vorreiter zu beschließen. Leider findet sich ein solches Vorhaben noch nicht mal im Bremer Koalitionsvertrag.

Weitere besprochene Themen zur Pflegekampagne war die Idee, die Forderungen von Betriebs- und Personalräten nach einer umfänglichen Gehaltszulage für die Krankenpflege aufzugreifen und aktiv zu unterstützen, als zusätzliche Forderung der Kampagne.

Zudem wurde von einem Genossen auf die Bedeutung einer klaren Kante zum Thema

Pflegekammern verwiesen.

Mietenkampagne

Im November soll die Mietenkampagne intensiviert werden, mehr örtliche Bündnisse gegründet und mehr Konflikte vor Ort angezettelt werden. Die drei zentralen Forderungen sollen sein: 1. Runter mit der Miete (u.a. durch Forderung Mietendeckel aus Landes- und Bundesebene), 2. Immobilienkonzerne enteignen, 3. Schaffung von 250.000 Sozialwohnungen durch den Staat durch Bau und Ankauf.

Ziel ist, noch vor den Bundestagswahlen eine Großdemo von über 100.000 Menschen zu organisieren. DIE LINKE tritt dem bundesweiten Unterstützer*innenkreis „Aktionsbündnis Wohnen ist Menschenrecht!“ bei und beteiligt sich an örtlichen Bündnissen. Es wurde die Frage angesprochen, ob die Initiierung von Volksentscheiden zum Mietendeckel in Landesverbänden sinnvoll wäre.

Am Montag konnte von uns beiden nur Thies an den Debatten teilnehmen.

Am Montagmorgen, vor der Wahlauswertungsdebatte, wurde noch eine längere Diskussion darüber geführt, ob, wann und wie die LINKE ihre Forderung nach einer Mindestsicherung anheben soll. Dazu gibt es verschiedene Vorschläge, die zwischen 1120,- und 1200,- Euro schwanken. Die Diskussion wird fortgesetzt, es zeichnet sich eine Einigung auf eine Forderung von 1150,- Euro mit Steigerung auf 1200,- in kurzer Frist ab.

Bei der Wahlauswertungsdebatte herrschte vor allem Ratlosigkeit angesichts der dramatischen Verluste der LINKEN in Sachsen und Brandenburg. In einem ersten Kommentar zur Wahl erklärte Thies Gleiss auf seiner Facebookseite, dass die Haltung in Brandenburg, Opposition in der Regierung und in Sachsen, Regierung in der Opposition zu spielen, nicht aufgegangen sei. Viele rufen jetzt „So kann es nicht weitergehen!“. Das meinen wir auch. Wir meinen damit aber im Gegensatz zu einigen Reformer*innen im Schulterschluss mit Genoss*innen aus der Parteilinken nicht die x-te Personaldebatte über die Parteiführung, sondern eine Diskussion über einen inhaltlichen Kurswechsel. In dem Sinne schrieb Thies: „Für die LINKE in Ostdeutschland hilft nur ein radikaler Schnitt: Ein Schritt zurück zu den Anfängen, der unter der schönen Parole lief „Veränderung beginnt mit Opposition“. Das gilt – das sage ich mal für die nächste Wahl im Oktober voraus – auch für Thüringen. Veränderung beginnt mit Opposition heißt auch: Aufbau lebendiger Partei-Strukturen vor Ort; Integration in die jungen Bewegungen gegen den braunen Spuk von AfD und Konsorten; Mitarbeit bei der noch jüngeren Klimaprotestbewegung; Praktizierung eines konsequenten Internationalismus und Solidarität mit den Bedrängten weltweit als Alternative zum National-Sozialdemokratismus und zum Zynismus der EU-Frontex-Festung-Europa-Politik. Aufbau von Strukturen in Schulen, Universitäten und Betrieben. Das alles ist das Kontrastprogramm zum bisher allein vorherrschenden Parlamentarismus. Veränderung beginnt mit Opposition heißt, das Programm der LINKEN – das den schönen ostdeutschen Namen Erfurter Programm trägt – mit Leben zu füllen und einen modernen Antikapitalismus und frischen Ökosozialismus in der Tagespolitik umzusetzen.“

Die AKL arbeitet derzeit an einer Wahlanalyse.

Feedback zum Bericht wie immer gern an uns beide.

akl - Antikapitalistische Linke

—————————————————————————–

Grafikquelle        :        Karl-Liebknecht-Haus in Berlin. Parteizentrale der Partei DIE LINKE. Aufnahme am Vorabend der Wahlen zum Abgeordnetenhaus am 18. September 2011.

Abgelegt unter Berlin, Medien, P. DIE LINKE, Überregional | Keine Kommentare »

Die Linke nach den Wahlen

Erstellt von DL-Redaktion am 3. September 2019

Ein Burgfrieden bis Ende Oktober

File:Hahn Wahlkampfauftakt, August 2009 - by Die Linke Sachsen.jpg

Von Anna Lehmann und Martin Reeh

Nach dem desaströsen Wahlergebnis brechen die Flügelkämpfe wieder auf. Nach der Thüringen-Wahl könnte es richtig losgehen.

Anfangs, als die Fotografen in der Bundespressekonferenz ihre Aufnahmen machten, blickten alle noch betont freundlich. Später war dem linken Spitzenpersonal aus Sachsen und Brandenburg die Ratlosigkeit deutlich anzusehen. Sachsens Landeschefin Anja Feiks schaute in die Luft, Spitzenkandidat Rico Gebhardt ausdruckslos vor sich hin, die Brandenburger Spitzenkandidatin Kathrin Dannenberg wirkte übermüdet. In Sachsen und Brandenburg hat die Linke jeweils etwas über zehn Prozent erhalten, das schlechteste Ergebnis ihrer Geschichte.

„Das war kein schöner Abend“, sagte Parteichef Bernd Riexinger. Das Ergebnis sei nicht einfach zu analysieren: „Wir hatten Wählerwanderungen in verschiedenste Bereiche.“ Die Linke müsse im Osten „neue Wählerschichten gewinnen“, schon weil sie jetzt nur bei den über 70-Jährigen überdurchschnittlich abschneide. Der Vorstand habe am Montag „gründlich und solidarisch“ debattiert. Jetzt müsse die Partei nach vorne blicken, nach Thüringen, wo Ende Oktober gewählt wird: „Wir hoffen, dort vom Ministerpräsidentenbonus profitieren zu können.“

In der Linken brach nach dem Ergebnis der alte Richtungsstreit wieder aus: Noch-Fraktionschefin Sahra Wagenknecht, die ihren Rücktritt für den Herbst angekündigt hatte, schrieb auf Facebook: „Wenn wir als grün­liberale Lifestyle-Partei wahrgenommen werden, wenn Menschen das Gefühl bekommen, dass wir auf sie herabsehen, ist es nur normal, dass sie sich von uns abwenden.“

De Masi vergleicht Partei mit Titanic

Ihr Vize Fabio De Masi, der dem Wagenknecht-Lager zugerechnet wird, twitterte: „Als die ‚Titanic‘ den Eisberg rammte, wurde auf dem Oberdeck weiter getanzt, während im Maschinenraum und bei den einfachen Passagieren bereits das Wasser stieg. Am Ende sank das ganze Schiff. Kann auch für Parteiführungen lehrreich sein!“

Die Linke Weltpremiere Der junge Karl Marx Berlinale 2017.jpg

Auf zum großen Ball – „De Masi“ war  nicht mit eingeladen  ?

Auf Twitter löste er damit eine Debatte aus, an der sich auch andere Spitzenpolitiker der Linken beteiligten. Das Erstaunliche daran: Vertreter verschiedener Flügel forderten eine Neuaufstellung, wenn auch erst nach der Thüringen-Wahl Ende Oktober.

So schrieb der Berliner Staatssekretär Alexander Fischer: „Schräges Bild. Aber ich bin unbedingt dafür, dass nach der Thüringenwahl alles auf den Prüfstand kommt, die Strategie, das Personal (zum „Oberdeck gehört auch die Bundestagsfraktion).“ Die Fraktionsspitze muss im Herbst neu gewählt werden, die Parteispitze regulär erst im nächsten Sommer.

Quelle       :          TAZ      >>>>>         weiterlesen

Linken-Parteichef über die Wahlschlappe

„Eine schwierige Phase“

DIE LINKE Bundesparteitag 10-11 Mai 2014 -110.jpg

Das Interview führte Patricia Hecht

Wie kam es zu dem Misserfolg im Osten für die Linke? Bernd Riexinger will neue WählerInnen suchen und setzt trotz allem auf die Wahl in Thüringen.

taz: Herr Riexinger, die Linkspartei hat in Sachsen und Brandenburg die schlechtesten Ergebnisse ihrer Geschichte erzielt. Ist sie als Ostpartei Geschichte?

Bernd Riexinger: Wir werden uns nicht mit diesem Ergebnis abfinden, wir haben in Thüringen Chancen, den Ministerpräsidenten zu verteidigen. Aber wir müssen realisieren, dass wir dringend neue Wählergruppen dazugewinnen müssen.

Weil Sie viele im Osten an die AfD verloren haben?

Das Wahlergebnis zeigt leider, dass wir in alle Richtungen verloren haben. Wir haben in Brandenburg deutlich mehr an die Grünen und die SPD als an die AfD verloren, in Sachsen an die CDU, an die AfD und an die Grünen. Das Bild ist bunt.

Trotzdem hat die AfD Ergebnisse, von denen Sie nur träumen können.

Mit der Wahl der AfD wollten die Leute den etablierten Parteien einen mitgeben. Zudem hat die AfD für sie eine Funktion: Manche wollen tatsächlich weniger Ausländer oder einen autoritären, nationalistischen Staat.

Wo sehen Sie die Gründe für Ihr eigenes Scheitern?

Wir sind zum einen taktischem Wählen zum Opfer gefallen. Diejenigen, die die AfD als stärkste Partei verhindern wollten, haben CDU oder SPD gewählt.

Damit schieben Sie die Verantwortung weg von der Linkspartei hin zu den WählerInnen.

Quelle       :         TAZ           >>>>>          weiterlesen

————————————————————————

Grafikquellen       :

Oben         —         Dr. André Hahn bei Wahlkampfauftakt der sächsischen LINKEN

Author dielinke_sachsen

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on September 14, 2009 by the administrator or reviewer File Upload Bot (Magnus Manske), who confirmed that it was available on Flickr under the stated license on that date.

—————————-

2. von Oben     —      Zwei Welten auf einen Foto

Vertreter der Partei Die Linke bei der Weltpremiere von Der junge Karl Marx bei der Berlinale 2017: v.l.n.r. Oskar Lafontaine, Sahra Wagenknecht, Dietmar Bartsch, Katja Kipping, Petra Pau und Kristian Ronneburg

Unten     —       Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom: Bernd Riexinger

Autor     —       Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -110.jpg
  • Created: 2014-05-21 17:36:14

Abgelegt unter Brandenburg, P. DIE LINKE, Sachsen, Überregional | 1 Kommentar »

Die Aufsteher liegen flach

Erstellt von DL-Redaktion am 2. September 2019

Der vergeigte Aufbruch

Bunte Westen 03.jpg

Von Rainer Balcerowiak

Vor allem mangelte es aber an durchschaubaren demokratisch legitimierten Strukturen. Vielmehr gab es ein undurchsichtiges Geflecht aus Trägerverein, Vorstand und Arbeitsausschuss mit entsprechenden Grabenkämpfen. Diese führten im Dezember unter anderem zur Abschaltung der Webpräsenz auf Bundes- und Landesebene und erbitterten Streitereien um Geld. Zudem wurde offensichtlich, dass einige bei „Aufstehen“ aktive Funktionäre der Linken die Bewegung vor allem als Schwungmasse für ihre innerparteilichen Ambitionen nutzen wollten und keinerlei Interesse am Entstehen einer überparteilichen Basisbewegung hatten. Als Sahra Wagenknecht, die im Dezember 2018 bereits eine Art Burgfrieden im internen Streit vereinbart hatte, im März 2019 ihren Rückzug aus der „Aufstehen“-Führung verkündete, war das Ende der Bewegung faktisch besiegelt. Einige prominente Unterstützer zogen sich zurück, die meisten Ortsgruppen lösten sich auf. Wagenknecht meldet sich seitdem nur noch aus dem digitalen Off mit seltsam entrückt wirkenden Statements und Durchhalteappellen zu Wort.or einem Jahr, am 4. September 2018, verkündete Sahra Wagenknecht in Berlin, begleitet von großem Medieninteresse, den offiziellen Start der neuen Sammlungsbewegung „Aufstehen“. Für viele Menschen war dies ein Aufbruchssignal. Mit ursozialdemokratischen Forderungen nach mehr sozialer Gerechtigkeit sollte gesellschaftlicher Druck auf die drei bestehenden Parteien des „linken Lagers“ entwickelt werden, um diese zu entsprechenden Kurskorrekturen und zur Entwicklung einer gemeinsamen Machtperspektive für eine umfassende so­ziale Reformpolitik zu drängen. Gleichzeitig sollte „Aufstehen“ als linkspopulistische Bewegung ein Gegengewicht zum Vormarsch der Rechtspopulisten darstellen.

Eine wesentliche Triebkraft war der Flügelkampf innerhalb der Partei Die Linke, wo sich Wagenknecht und ihre Anhänger mit der unter anderen von der Vorsitzenden Katja Kipping repräsentierten „postmodernen“ Strömung, die sich vor allem an identitätspolitischen Themen der urbanen Mittelschichten orientiert, einen erbitterten Machtkampf lieferten. Besonders zugespitzt war diese Auseinandersetzung bei der Migrationspolitik, Wagenknecht lehnte die von Teilen der Partei vertretene Forderung nach „offenen Grenzen und Bleiberecht für alle“ strikt ab – und musste sich dafür als „Rassistin“ beschimpfen lassen.

Die neue Bewegung schien einen Nerv getroffen zu haben. Die Zahl der registrierten Unterstützer wuchs binnen kurzer Zeit auf mehr als 160.000, quer durch die Republik entstanden in kürzester zeit Orts- und Regionalgruppen, zeitweise waren es rund 200. Auch der Autor dieser Zeilen beteiligte sich in einer Berliner Bezirksgruppe. In repräsentativen Umfragen erklärten über 30 Prozent der Befragten, sich die Wahl einer „Aufstehen“-Partei vorstellen zu können.

Ein Jahr später ist „Aufstehen“ nahezu vollständig von der Bildfläche verschwunden. Die ausschlaggebenden Gründe können hier nur kurz skizziert werden. Statt die anfängliche Euphorie für eine identitätsstiftende, bundesweite Kampagne zu sozialen Kernthemen zu nutzen, verläpperten sich die meisten Ortsgruppen wochenlang in wenig beachteten „Friedensmanifestationen“, die den verblichenen Bewegungscharme des vergangenen Jahrhunderts versprühten und kaum geeignet waren, die anvisierten Zielgruppen zu erreichen. Kalt erwischt wurde „Aufstehen“ bereits wenige Wochen nach der Gründung von dem großen, moralisch geprägten Polithappening „Unteilbar“, zu dem man sich sehr widersprüchlich positionierte.

Quellbild anzeigen

Wir bleiben liegen

Vor allem mangelte es aber an durchschaubaren demokratisch legitimierten Strukturen. Vielmehr gab es ein undurchsichtiges Geflecht aus Trägerverein, Vorstand und Arbeitsausschuss mit entsprechenden Grabenkämpfen. Diese führten im Dezember unter anderem zur Abschaltung der Webpräsenz auf Bundes- und Landesebene und erbitterten Streitereien um Geld. Zudem wurde offensichtlich, dass einige bei „Aufstehen“ aktive Funktionäre der Linken die Bewegung vor allem als Schwungmasse für ihre innerparteilichen Ambitionen nutzen wollten und keinerlei Interesse am Entstehen einer überparteilichen Basisbewegung hatten. Als Sahra Wagenknecht, die im Dezember 2018 bereits eine Art Burgfrieden im internen Streit vereinbart hatte, im März 2019 ihren Rückzug aus der „Aufstehen“-Führung verkündete, war das Ende der Bewegung faktisch besiegelt. Einige prominente Unterstützer zogen sich zurück, die meisten Ortsgruppen lösten sich auf. Wagenknecht meldet sich seitdem nur noch aus dem digitalen Off mit seltsam entrückt wirkenden Statements und Durchhalteappellen zu Wort.

Quelle      :        TAZ        >>>>>          weiterlesen

——————————————————————-

Grafikquellen        :

Oben       —       „Bunte Westen“ protest in Hanover, 16th february 2019

Abgelegt unter P. DIE LINKE, Saarland, Schicksale, Überregional | 9 Kommentare »

Linke Wahlschlappe Osten

Erstellt von DL-Redaktion am 2. September 2019

Die Linke jetzt auch im Osten auf Westniveau

File:Hahn Wahlkampfauftakt, August 2009 - by Die Linke Sachsen.jpg

Das waren wohl Sätze mit XX

Von

Der große Verlierer bei den Landtagswahlen in Sachsen und Brandenburg ist die Linke. Die Genossen sind im Osten nur noch eine Kleinpartei unter vielen – und damit mittendrin in der Identitätskrise.

Es ist ein großer Tag für die Genossen. Mehr als 23 Prozent in Sachsen, in Brandenburg sind es sogar 28 Prozent. Die Zahlen untermauern eindrucksvoll das Selbstverständnis. Im Osten wählt man links, im Osten ist man Volkspartei. Es ist der 19. September 2004.

In den 15 Jahren seither hat sich viel getan. Die Partei von damals heißt nicht mehr PDS, sondern Linke. Und von einem Sonderstatus in den neuen Bundesländern, das ist spätestens seit diesem Sonntag klar, kann kaum mehr eine Rede sein.

Die Linke ist im Osten abgestürzt. Schon bei der Bundestagswahl 2017 holten die Linken hier nur noch 17,3 Prozent – weit weniger als bei den vorangegangenen Abstimmungen. In Brandenburg und Sachsen kommen sie jetzt nur noch auf gut 10 Prozent. Die Genossen erreichen inzwischen Westniveau. Istzustand: eine kleine Partei von vielen. Eine Katastrophe für die Linken.

„Beispielloses Desaster“

Entsprechend groß ist der Schock. Dietmar Bartsch, Fraktionschef im Bundestag, meldet sich am Wahlabend via Twitter zu Wort. Seine Partei erlebe „ein beispielloses Desaster“. Außenpolitiker Stefan Liebich nennt das Ergebnis „eine schallende Ohrfeige“. Und die Parteilinke Sevim Dagdelen sieht die Genossen gar in einer „existenziellen Krise“.

Tatsächlich geht es längst um die Identität der Partei. Als Rechtsnachfolgerin der SED war es der PDS nach der Wende gelungen, enttäuschte Ostdeutsche hinter sich zu versammeln. In den neuen Bundesländern war die Partei bestens organisiert, hier traten die Genossen als Kümmerer auf und boten zugleich eine Projektionsfläche für Protest – egal ob man gerade selbst regierte oder nicht. Die Linke, das war eben die Partei des Ostens.

Doch diese Bindungskräfte sind schwach geworden. Stattdessen rächt sich nun offenbar, dass die Linken in den vergangenen Jahren eine Frage nie ausdiskutiert haben: Was ist die Partei eigentlich?

Anlaufstelle für die Wut der Abgehängten? Linksliberale Kraft? Pragmatische Regierungspartei? Sammelbecken für radikale Aktivisten? In der Partei tummeln sich inzwischen derart viele Grüppchen und Plattformen mit teilweise stark unterschiedlichen Kursvorstellungen zu Europa, in der Außenpolitik, in Demokratiefragen, dass man leicht den Überblick verlieren kann.

Quelle       :     Spiegel-online        >>>>>        weiterlesen

——————————————————————-

Grafikquelle      :      Dr. André Hahn bei Wahlkampfauftakt der sächsischen LINKEN

Author dielinke_sachsen

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on September 14, 2009 by the administrator or reviewer File Upload Bot (Magnus Manske), who confirmed that it was available on Flickr under the stated license on that date.

Abgelegt unter Brandenburg, P. DIE LINKE, Sachsen, Überregional | Keine Kommentare »

Markus Mohr – „junge Welt“

Erstellt von DL-Redaktion am 1. September 2019

Die Widersprüche sind die Hoffnungen

Queller        :    Scharf – Links

Von Markus Mohr,

der linke Hamburger Journalist und Buchautor, seit fast zwei Jahrzehnten auch als freier Mitarbeiter der „jungen Welt“ tätig, arbeitet nicht weiter für diese Tageszeitung. Sie haben ihm sozusagen „gekündigt“, weil er es sich nicht nehmen lassen möchte, gelegentlich auch die DDR und jene, die sie über Gebühr lobpreisen, zu kritisieren. Hier der Wortlaut seiner Erklärung:

Mein Engagement als freier Beiträger für die Tageszeitung Junge Welt wurde beendet

Irgendwann in den 2000er Jahren habe ich angefangen Beiträge für die Tageszeitung Junge Welt zu schreiben. Der letzte stammt von Ende Januar dieses Jahres – ein Kurzabriss über die Geschichte des Berliner Extradienstes  aus den 1970er Jahren. Diesem Engagement ist nun von der Chefredaktion und Verlagsleitung  der Jungen Welt ein Ende gesetzt worden. Die letzte knappe Information, die mir der diensthabende Feuilleton-Redakteur Mitte März noch zukommen ließ, bestand in einer Falschbehauptung: Ich soll wegen eines Beitrages in der Zeitung der Roten Hilfe 1/2019 über einen von dem jW-Mitarbeiter Arnold Schölzel in den 1970er Jahren gegen linke DDR-Oppositionelle erfolgreich absolvierten Spitzeleinsatz die Zusammenarbeit mit der Jungen Welt abgebrochen haben. Dem habe ich widersprochen, und seitdem habe  ich von der Redaktion auch auf Angebote zu weiteren Beiträgen nichts mehr gehört. Ein Brief  an die Verlagsleitung und den Chefredakteur von Ende Juli mit der Bitte meinen Status für das Blatt zu klären, blieb ohne Antwort.

Die Linke zeichnet sich im Unterschied zur politischen Rechten auch darin aus, dass niemand sakrosankt ist, Kritik und Selbstkritik gehören zu einer fortschrittlichen, gar sozialistischen Bewegung dazu. Auch die Junge Welt muss damit leben, dass es Linke gibt, die Schölzel für diese von ihm auch heute noch gut geheißene Praxis seines Spitzelengagements für das MfS nicht feiern, sondern fundamental kritisieren. Seine vielfach dokumentierte Behauptung, die Intellektuellengruppe, deren Teil er war, hätte „17 Millionen“ verraten, ist nicht nur Ausdruck für einen brutalen Realitätsverlust, sondern auch ein Schlag ins das Gesicht eines kritischen Marxismus.

Nun darf man in der Jungen Welt Anfang Juli 2019 u.a. folgendes lesen: „Mit heftigen Angriffen auf die junge Welt soll verhindert werden, dass sich die verkaufte Auflage der Zeitung weiter positiv entwickelt. Darüber berichtete jW-Chefredakteur Stefan Huth, der auf die offensichtlichen Lügen im aktuellen Verfassungsschutzbericht hinwies.  (…) Aber auch aus vermeintlich linker Ecke kämen weiter Angriffe: (….) Die Rote Hilfe habe in ihrem Mitgliederheft einen Artikel über den langjährigen jW-Chefredakteur Arnold Schölzel gebracht, der »mit allen journalistischen Standards gebrochen« habe. In einem Beitrag des Verdi-Magazins ‚Menschen machen Medien‘ werde die Rhetorik des Verfassungsschutzberichts aufgenommen und junge Welt als »Kampfblatt« bezeichnet.“ (O.N., Kurs halten, in: jW vom 1.7.2019, S. 4)

Die „vermeintlich linke“ Rote Hilfe Seite an Seite mit dem wahrscheinlich nicht so linken Bundesamt für Verfassungsschutz gemeinsam vereint in „heftigen Angriffen“ gegen die Junge Welt ?  Und das womöglich auch noch im Zusammenhang einer „Rhetorik des Verfassungsschutzberichts“ ?

Da reibt man sich doch ein wenig die Augen. Die jW zieht den Kreis der Leute und Gruppen, auf die sie politisch konstruktiv zugeht, zuweilen sehr eng. Wenn nun auch noch die Rote Hilfe lediglich „vermeintlich links“ ist, wer soll dann eigentlich noch erreicht werden?

Es ist wohl so, dass die Junge Welt staatliche Repression gegen Linke und GenossInnen, also eben das, was von Arnold Schölzel auch heute noch gutgeheißen wird, als Ausweis von Bündnis- und Zukunftsfähigkeit begreift. Eine Kritik daran von links unten dahingegen nicht. Wenn das so ist, dann ist es richtig die jW allerdings tatsächlich als ein „Kampfblatt“ zu begreifen, und zwar für eine schlechtere und nicht für eine bessere Welt.

Gegen mich wurde nun eine stille Form  der kalten Kündigung praktiziert. Natürlich trifft mich das, auch eingedenk der ausgezeichneten Erfahrungen in der jahrelangen Zusammenarbeit insbesondere mit dem Genossen Christof Meueler. Gerne hätte ich die Junge Welt durch weitere Beiträge bereichert. Doch das ist nun vorbei. Mist.

Sowohl die Beendigung meines Engagements für die Zeitung  als auch das diesbezügliche Schweigen führen eine Entwicklung weiter, die als eine Selbstauflösung der Linken  benannt und beklagt werden soll. Ganz im hoffnungsfroh artikulierten Geist des Thomas Brasch wendet sich diese Erklärung  damit als ein praktizierter Widerspruch selbstverständlich an alle Kräfte, die zur Abschaffung der gegenwärtigen Zustände beitragen, die keine menschenwürdigen sind.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquelle        :         Scharf – Links       :       Bildmontage – HF

Abgelegt unter Berlin, Medien, Positionen, Überregional | Keine Kommentare »

Mietendeckel in Berlin

Erstellt von DL-Redaktion am 1. September 2019

Ran an die Miete

Datei:Berlin skyline 2009w.jpg

Von Erik Peter

Wer die soziale Spaltung der Großstädte aufhalten will, muss die Mieten deckeln. Rücksicht auf Renditeverluste ist unangebracht.

Der Kauf von Immobilien in Berlin und anderen Großstädten versprach bislang eine sichere Rendite. Der dänische Immobilienspekulant Jørn Tækker erwarb 2006 ein Kreuzberger Altbau-Ensemle für 3 Millionen Euro von der Stadt und will es nun für 20 Millionen Euro abstoßen, ohne je einen Cent in die Substanz investiert zu haben: ein leistungsloser Gewinn. Trotz des massiven Kapitalzuflusses in den Immobilienmarkt verbessert sich am Wohnungsangebot nichts. Im Gegenteil: Immer mehr überteuerte Wohnungen verkleinern das Angebot für die Mehrheit.

Der Wohnungskonzern Akelius vermietet jede frei werdende Wohnung nach der Sanierung für den doppelten bis dreifachen Preis. 20 Euro pro Quadratmeter im sozialen Brennpunkt; Schamgrenzen gibt es schon längst nicht mehr. Schönen Gruß an die Mietpreisbremse. Gleichzeitig werden immer mehr vormalige Mietwohnungen in Eigentum umgewandelt.

Mit dem Mietendeckel will der Berliner Senat nun dem Treiben ein Ende setzen. Wie Stadtentwicklungssenatorin Katrin Lompscher (Linke) am Freitag vorstellte, sollen ab Januar die Mieten für fünf Jahre nicht mehr steigen dürfen beziehungsweise nur bis zu definierten Höchstwerten. Je nach Baujahr liegen die Grenzen, die auch bei Wiedervermietungen gelten, zwischen 5,95 Euro und 9,80 Euro pro Quadratmeter. Wer mehr zahlt und wessen Miete 30 Prozent des Haushaltsnettoeinkommens übersteigt, darf eine Absenkung beantragen.

Katrin Lompscher 210909.jpg

Die Vorschläge sind weniger radikal als jene in einem zuvor bekannt gewordenen Arbeitspapier. In seiner verschärften Form hätte der Mietendeckel deutlich mehr HauptstädterInnen eine billigere Miete ermöglicht. Doch es folgte große öffentliche Empörung: Wertverlust! Enteignung! Kommunismus! Lange wurden die Interessengegensätze zwischen Kapitaleignern und Besitzlosen nicht mehr so deutlich.

Dabei geht jeder, der Immobilien kauft, eine Wette ein. Die unaufhaltsam steigenden Preise haben die Illusion genährt, dass Verlust oder weniger Rendite keine realistischen Optionen sind. Die Immobilienbranche hat zwei Dinge kollektiv ignoriert. Erstens sind Krisen dem Kapitalismus systemimmanent, Immobilienblasen können platzen. Zweitens haben demokratische Staaten das Recht, regulierend einzugreifen. Viel zu lange mussten Spekulanten dies nicht fürchten, weil der Staat dabei versagte, das Recht auf Wohnen zu schützen. Gefürchtet haben sich allein die Mieter.

Quelle       :       TAZ          >>>>>         weiterlesen

—————————————————————-

Grafikquellen      :

Oben      —          Die Berliner Innenstadt von der Siegessäule aus fotografiert mit Blick Richtung Osten: links der Reichstag, in der Mitte der Fernsehturm, rechts oben das Rote Rathaus und darunter das Brandenburger Tor.

Urheber Casp

Diese Datei ist unter den Creative-Commons-Lizenzen „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“, „2.5 generisch“, „2.0 generisch“ und „1.0 generisch“ lizenziert.

—————————-

Unten       —        Katrin Lompscher (Left Party), Senator for health, environment and consumer protection

Abgelegt unter Berlin, Positionen, Sozialpolitik, Überregional | Keine Kommentare »

Das letzte vom Lügenleser

Erstellt von DL-Redaktion am 30. August 2019

Hobby-Sarrazins und Freizeit-Poschardts
Tired of this fucking shit

Sarrazin book pres b4.jpg

Von Juri Sternburg

Meinungsfreiheit bedeutet nicht, dass alle immer und überall alles sagen dürfen und alle zuhören müssen. Und damit: Ciao!

Die Meinungsfreiheit ist ein hohes Gut. Sie bedeutet, dass „das subjektive Recht auf freie Rede sowie freie Äußerung“ gewährleistet ist. Die Meinungsfreiheit hat aber Grenzen. Etwa wenn es sich um strafrechtliche Aussagen handelt. Dennoch ist der Ausspruch „Ich dachte, hier herrscht Meinungsfreiheit?!“ (Spiegel-Leser können sich diesen Satz mit sächsischem Akzent vorstellen) sehr beliebt. Meist dann, wenn jemand das Gefühl hat, ungerecht behandelt zu werden.

Oft sind das Menschen, die auf Demonstrationen „Absaufen! Absaufen!“ rufen. Deshalb hier zur Erklärung: Meinungsfreiheit bedeutet nicht, dass alle immer und überall alles sagen dürfen und alle zuhören müssen. Dies hier ist zum Beispiel meine letzte Kolumne für die taz. Das wird einige freuen, andere vielleicht nicht. Hat aber nichts mit Meinungsfreiheit zu tun. Denn wenn ich will, kann ich meine Texte in Zukunft auf einem ominösen Internetblog veröffentlichen, bei Twitter posten oder mich beim Springer-Verlag bewerben (Gott bewahre!).

Entgegen der landläufigen Meinung von Hobby-Sarrazins und Freizeit-Poschardts gibt es auch keine Sprechverbote. Oder hat jemand schon mal einen SEK-Zugriff beobachtet, nachdem ein wütender Ü50er einen „Man darf ja nicht mal mehr Zigeunerschnitzel sagen“-Kommentar ins Internet geballert hat? Verlieren Leute ihre Jobs, wenn sie in Talkshows sitzen und einfach nur mal die Frage stellen wollen, ob man Menschen ersaufen lässt? Oder ist es nicht eher so, dass man mit solchen Fragen Talkshowmoderator, Bestseller-Autor und Chef einer Tageszeitung werden kann?

Porsche 356 B Carrera GTL Abarth (9307474801).jpg

Ein Eigenfoto ueigt Ulf Poschardt aber Porsche fährt er.

Im gesetzlichen Rahmen darf man hier alles Mögliche sagen. Die Frage ist nur, ob man diesen Menschen ein Podium geben sollte. Wer bei klarem Verstand ist, weigert sich natürlich.

Völkische Argumente

Quelle      :          TAZ        >>>>>          weiterlesen

—————————————————————–

Grafikquellen     :

Oben        —         Thilo Sarrazin, bei der Vorstellung seines Buches „Deutschland schafft sich ab

Abgelegt unter Feuilleton, Kultur, Positionen, Überregional | Keine Kommentare »

Erschreckend ideenlos

Erstellt von DL-Redaktion am 30. August 2019

Bioökonomie könnte die Zukunft sein,

Von Heike Holdinghausen

Bioökonomie könnte die Zukunft sein, wenn man es richtig macht. Doch was die Bundesregierung bisher plant, hat kein Konzept und vor allem kein Ziel.

olz statt Öl als Rohstoff für Kunststoff. Algen, die Kraftstoffe, Bakterien, die Medikamente produzieren. Das Konzept einer Industriegesellschaft, die ihre Rohstoffe überwiegend aus biologischen Prozessen bezieht – aus Pflanzen, Tieren, Bakterien, Pilzen –, berührt viele brennenden Probleme wie das Schwinden der Arten, das neue Waldsterben oder gentechnikfreie Nahrungsmittel. Eine biobasierte Wirtschaft kann Teil der Lösung dieser Probleme sein – oder sie immens verschärfen.

Zwar führt die Bioökonomie noch immer ein Nischendasein in einer Welt nach wie vor billigen Erdöls. Aber die chemische Industrie steht längst in den Startlöchern für eine Rohstoffwende. In biotechnologische Forschung investieren BASF, Bayer und Co viel Geld, wenn auch nicht unbedingt in Deutschland. Entsprechend ist es richtig, dass auch die Bundesregierung sich des Themas annimmt und ihre Politik auf diesem Feld in einer „Bioökonomiestrategie“ zusammenfasst.

Zwar liegt die Strategie bislang nur als Referentenentwurf vor; sie wird in den beteiligten Ministerien auf Fachebene diskutiert und sich wohl noch ändern. Trotzdem ist dieser Entwurf wichtig, denn darin versuchen die für Forschung und Landwirtschaft zuständigen Ministerien, Zukunft zu beschreiben. Und offenbaren, dass sie von ihr keinerlei Begriff haben. Die Strategie zeigt, dass zwei zentrale Ministerien unter einer „nachhaltigen Zukunft“ nicht mehr als eine Art „Weiter so wie bisher, nur irgendwie ohne Klimakrise und Artensterben“ verstehen. Angesichts des Handlungsdrucks ist das ein erschreckender Mangel. Dafür drei Beispiele:

Die Strategie erwähnt an verschiedenen Stellen, wie grundlegend wichtig Wissen über biologische Prozesse und Zusammenhänge für eine erfolgreiche und nachhaltige Bioökonomie sei. Wissenschaftlern müsse es möglich sein, „auch vollkommen neuartige Zukunftstechnologien oder Sprung­innovationen zu generieren“, dazu müssten sie auch den Freiraum haben, ungewohnte Pfade einzuschlagen. Das Wort „Gentechnik“ aber taucht an keiner Stelle explizit auf, obwohl es zwischen jeder Zeile schwebt. Folgerichtig fordert die Industrie, den Begriff aufzunehmen. Die Umwelt- und Entwicklungsverbände hingegen vermissen eine klare Positionierung gegen die Gentechnik in Agrar- und Forstwirtschaft.

Nun könnte man unterstellen, die Autoren des Entwurfs wollten nur einer brenzligen öffentlichen Diskussion aus dem Weg gehen und zu solch einem frühen Zeitpunkt niemandem auf die Füße treten. Wahrscheinlicher ist allerdings, dass sie keine gemeinsame Vorstellung von einer nachhaltigen Land- und Forstwirtschaft von morgen haben. Lässt sich das UN-Ziel, den Hunger auf der Welt zu beseitigen, am besten im Rahmen der heutigen Wirtschaftsordnung lösen? Wer dieser Meinung ist, setzt auf forschungsstarke, reiche Konzerne, die trockenresistente Pflanzen für arme Länder des Südens designen. Oder müssen sich die Macht- und Handelsstrukturen verändern, damit Bauern sich selbst versorgen können? In die Bioökonomiestrategie lässt sich beides hineinlesen – also nichts.

Datei:Hoher Baum Maichingen.JPG

Zweites Beispiel: Der Entwurf zählt solide die Herausforderungen auf, die die Bioökonomie durch einen verstärkten Druck auf die Flächen der Land- und Forstwirtschaft bedeutet. Schon heute ist vor allem die industrielle, effizienzgetriebene Landwirtschaft maßgebliche Ursache für das Sterben von Tieren und Pflanzen, für den Verlust der Biodiversität sowohl von Wildtieren und -pflanzen als auch von Nutztieren und -pflanzen.

Quelle        :        TAZ       >>>>>        weiterlesen

———————————————————————-

Grafikquellen       :

Oben       —          Erdölförderung vor der vietnamesischen Küste

Urheber Schwenn
Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Ernährungspolitik, Regierung, Überregional, Umwelt | Keine Kommentare »

Die Linke Saar wacht auf

Erstellt von DL-Redaktion am 29. August 2019

Oskar Lafontaine hält linke Sammlungsbewegung Aufstehen weiterhin für aktuell

Ja, Weihnachten kommt wieder einmal näher und wer die Hitze seiner Tage verschläft, wird im Winter weniger frieren, weil er das Holz vor seiner Tür noch nicht verbrannt hat!  

Von dpa/lrs

Ein Jahr nach ihrer Gründung ist die linke Sammlungsbewegung Aufstehen nach Ansicht des Linke-Politikers Oskar Lafontaine keineswegs tot.

„Es gibt sie noch“, sagte der frühere Linke-Chef, der als Mit-Initiator der Bewegung gilt, der Deutschen Presse-Agentur in Saarbrücken. Aufstehe“ habe rund 150 000 registrierte Mitglieder und „mehrere hundert Ortsgruppen“ quer durch Deutschland. „Aufstehen“ war am 4. September 2018 offiziell an den Start gegangen.

Damit ist die Schweigepflicht für Claudia Kohde-Kilsch aufgehoben ?

Bei der Gründung von Aufstehen sei das Ziel gewesen, im Bund wieder eine Mehrheit zu schaffen, die sich für bessere soziale Leistungen, höhere Löhne und Renten sowie eine friedliche Außenpolitik einsetze: „Dieses Ziel ist nach wie vor hochaktuell“, sagte Lafontaine. Die Bewegung werde „sofort wieder an Fahrt aufnehmen“, wenn es einen Anlass gebe, der „die dringende Notwendigkeit, eine andere Mehrheit im Bundestag zu erreichen, noch einmal deutlich vor Augen führt“.

Quelle        :       Saarbrücker-Zeitung        >>>>>         weiterlesen

Mehr lesen:

Sahra Wagenknecht

————————————————————————

Grafikquellen          :

Oben          —         Grafikquelle:   Rodena de, gem. AWDL – ohne inhaltliche Übernahme der Artikelinhalte – frei zur Nutzung bei Quellnennung)“

————————————–

Unten      —        zensursulahttp://www.flickr.com/photos/39646155@N02/3644033396/

  • CC BY 2.0Die Persönlichkeitsrechte der abgebildeten Person(en) beschränken bestimmte Weiterverwendungen des Bildes ohne dessen/deren vorherige Zustimmung.
  • File:Zensur.jpg
  • Erstellt: 20. Juni 2009

Abgelegt unter P. DIE LINKE, Positionen, Saarland, Überregional | Keine Kommentare »

Brandenburg wählt

Erstellt von DL-Redaktion am 29. August 2019

Natürlich wird es schlimm

Andreas Kalbitz 2016.jpg

Eine Kolumne von

Viele Brandenburger werden am Sonntag rechts wählen – manche sogar nur, um vermeintlich Linke zu ärgern. Denen wiederum könnte ein Trick helfen.

In Brandenburg und in Sachsen wird in wenigen Tagen gewählt, und natürlich wird es schlimm. Aus Sicht der liberalen Demokratie gesprochen. Den westdeutschen AfD-Spitzenkandidaten in Brandenburg, Andreas Kalbitz, halte ich persönlich zum Beispiel für einen Nazi, wenn man diesen Begriff synonym mit „deutsch-rechtsextreme Gesinnung“ verwendet, wie es heute umgangssprachlich getan wird. Mit dieser Einschätzung bin ich wahrlich nicht allein.

Sie beruht unter anderem darauf, dass Kalbitz das Drehbuch für einen Film geschrieben hat, der als „geschickte Hitler-Verherrlichung“ bezeichnet wird. Dass er zwei Jahrzehnte in rechtsextremen Zirkeln unterwegs war, etwa bei der inzwischen verbotenen HDJ. Dass er – übrigens anders als die meisten anderen AfD-Kandidaten – auf seine rechtsextreme Vergangenheit angesprochen, keine Silbe auf echte Distanzierung verschwendet. Wen kann man Nazi nennen, wenn nicht eine solche Person?

In Brandenburg wird eine große Zahl von Menschen also einen Nazi wählen, und das ist schlimm. Es wird aber in Prozentzahlen weniger schlimm als befürchtet, als man hätte vor einigen Monaten annehmen müssen (außer es geschieht noch etwas Gravierendes). Das glaube ich jedenfalls, und zu dieser zugegeben nicht hundertprozentig wasserdichten Einschätzung komme ich mithilfe sozialer Medien und der Verknüpfung von zwei Thesen.

Die grausige Floskel von einer „Spaltung der Gesellschaft“

Die erste These nenne ich „Kleistsches Prinzip“. Heinrich von Kleist hat um 1805 den Aufsatz „Über die allmähliche Verfertigung der Gedanken beim Reden“ geschrieben. Überträgt man das auf die heutige, chathafte Kommunikation in sozialen Medien, ergibt sich: Beim Kommentieren in sozialen Medien kann man Leute dabei beobachten, wie sie allmählich ihre Gedanken verfertigen – und zugleich ihre Gefühle verfestigen. Denn soziale Medien sind Gefühlsmaschinen.

Die grausige Floskel von einer „Spaltung der Gesellschaft“

Die erste These nenne ich „Kleistsches Prinzip“. Heinrich von Kleist hat um 1805 den Aufsatz „Über die allmähliche Verfertigung der Gedanken beim Reden“ geschrieben. Überträgt man das auf die heutige, chathafte Kommunikation in sozialen Medien, ergibt sich: Beim Kommentieren in sozialen Medien kann man Leute dabei beobachten, wie sie allmählich ihre Gedanken verfertigen – und zugleich ihre Gefühle verfestigen. Denn soziale Medien sind Gefühlsmaschinen.

Die zweite These beschreibt eine (nicht mehr ganz) neue Dimension der politischen Polarisierung. Die meisten gesellschaftlichen Akteure scheinen zu glauben, dass Polarisierung schlecht ist, gut erkennbar an der so inflationären wie grausigen Floskel „spalten die Gesellschaft“:

Wp10 20110115 IMG 9974.jpg

Was soll da noch kommen? Gartenzwerge? Nein, auch die spalten selbstredend längst die Gesellschaft. Dahinter steht eine bizarr unterkomplexe Vorstellung von Gesellschaft, die beruht auf der bizarr unterkomplexen Annahme, das Ziel sei ein ständiger Dauerkonsens in ungefähr allen Fragen. Das ist natürlich Unfug, in einer liberalen Demokratie muss es exakt einen Konsens geben, und der heißt: Liberale Demokratie, mit den Werten, die unveräußerlich dazugehören und im Grundgesetz nachlesbar sind, unter anderem Minderheitenschutz, Presse– und Meinungsfreiheit, Rechtsstaat, die Ungeilheit von Angriffskriegen. Über alles andere kann und muss man streiten.

Quelle        :         Spiegel-online           >>>>>        weiterlesen

——————————————————————

Grafikquellen      :

Oben      —         Andreas Kalbitz (MdL Brandenburg) 2016

Abgelegt unter Brandenburg, Feuilleton, Positionen, Überregional | Keine Kommentare »

Lauben zu Wohnungen

Erstellt von DL-Redaktion am 28. August 2019

Gegen die Enteignung von Kleingärten

Datei:Bonn-953, Karl-Legien-Straße.JPG

Von Nina Boschmann

taz-Redakteur Paul Wrusch vertrat vergangene Woche die These, dass Kleingärten zugunsten von Wohnungen enteignet werden sollen. Die frühere taz-Autorin Niña Boschmannn war eine von vielen LeserInnen, die in einem Brief dagegen protestierten. Hier schreibt sie nun eine Gegenthese.

Wohnen in Lauben statt Gärten enteignen. Morgens inmitten eines Vogelkonzerts aufwachen, das die Geräusche des beginnenden Berufsverkehrs übertönt. Der erste Blick geht ins Grüne. Der zweite auch. Ein paar Schritte führen – je nach Jahreszeit – nach draußen zu frischen Radieschen, Salat, Beeren, Gemüse, Äpfeln oder Kürbissen. Bienen und Schmetterlinge haben ihr Tagewerk schon auf einer kleinen Blumenwiese begonnen, ihr Surren kündigt die aufgehende Sonne an. Eine Nachbarin fragt freundlich über den Zaun, ob Zucchini benötigt werden, man habe zu viele.

Ein Blick ins Innere des Gebäudes. Wohnen auf einer Ebene. Alles ist überschaubar, ansprechend gestaltet, einfach, aber praktisch. Ebenso kind- wie altersgerecht. Nachher kommen die Enkel. Nie ist ihnen langweilig. Sie spielen mit Holz, Wasser und Steinen und mit den Kindern von nebenan. Sie sind dabei nicht in Gefahr. Die Wege der Umgebung sind für den Durchgangsverkehr gesperrt.

Wo ist ein solches Paradies zu finden? In vielen der Berliner Kleingärten, überwiegend außerhalb des S-Bahn-Rings, aber noch in der Stadt gelegen. Ein bedrohtes Idyll und angesichts der Bedingungen auf dem Berliner Wohnungsmarkt eine wichtige Vision für zukünftiges Leben in der Stadt.

Gärten als natürliche Feinde des Wohnungsbaus?

Die vor einer Woche an dieser Stelle veröffentlichte Polemik gegen die vermeintliche Privilegierung der spießigen Pächter der Berliner Kleingärten greift ebenso zu kurz wie die amtliche Betrachtung der Gärten als „Flächenreserve“, auf welche die Verwaltung bei Bedarf für den Bau von Infrastruktur zugreifen kann. Vielmehr gilt es zu begreifen: Die Eliminierung von Gärten findet seit Jahren statt, und es wäre im Interesse aller wohnungs- und umweltbewegten Menschen, sich dem entgegenzustellen.

Autor Paul Wrusch befürwortet, weitere 20 Prozent der Kleingärten in Berlin zum Zwecke des Wohnungsbaus zu enteignen, weil es sich um ein auslaufendes Modell handele, ineffizient im Hinblick auf die Produktion von Nahrungsmitteln, ohne Zusatznutzen angesichts existierender Parks und Grünflächen, eine Verschwendung knapper Ressourcen sozusagen. Gärten als natürliche Feinde des Wohnungsbaus? Eine solche Haltung ist bemerkenswert, geht sie doch weit über das hinaus, was die Berliner Verwaltung in ihren kühnsten Träumen wagt, den Bürgern zuzumuten.

Über Jahre wurde zwischen Verwaltung und Politik um die Erstellung eines mittelfristigen „Kleingartenentwicklungsplans“ bis 2030 gerungen. Der im Frühjahr vorgestellte Entwurf sieht vor, dass im kommenden Jahr 15 Anlagen („Kolonien“) komplett geräumt und rund 430 Gärten (von stadtweit 71.000) dem Erdboden gleichgemacht werden. Die Erfahrungen mit früheren Räumungen lassen nichts Gutes erwarten: Abgesehen vom Leid der Nutzer waren zu beobachten: jahrelange Brachen, erneute informelle Besiedelung, Mülldeponien, Verwahrlosung. Und kein erschwinglicher Wohnraum, nirgends.

Gleichzeitig werden die ohnehin restriktiven Regelungen des Bundeskleingartengesetzes von 1983 zunehmend noch restriktiver gehandhabt: Wo immer ein Kleingarten den Besitzer wechselt, wird genau ermittelt, welche Merkmale der dort existierenden Lauben das „dauerhafte Wohnen“ fördern könnten und die Pächter erhalten entsprechend strenge Auflagen: Anbauten müssen entfernt, Schornsteine versiegelt, Dachgauben und Terrassen zurückgebaut werden.

Wohnmodelle in Kleingärten sollten gefördert werden

Parallel zu diesem Prozess machen sich reputierte Architekten weltweit (im Sommer 2018 auch auf dem Bauhaus-Campus in Berlin) Gedanken über das moderne Wohnen in Kleinsthäusern (tiny houses), transportablen Gebäuden (mobile homes) und Ausbauhäusern (incremental housing) mit dem Ziel, Flächenverbrauch, Mobilitätsbedürfnisse und soziale Gesichtspunkte sowie die Ressourcen einkommensschwacher Schichten unter einen Hut zu bringen. Allein, es fehlt an Standorten, um derartige Modelle einem Praxistest zu unterziehen.

Wer in einer solchen Gemengelage pauschal das Ende der Kleingärten zugunsten des Wohnungsbaus beschwört, folgt nicht dem Gemeinwohl, sondern spielt benachteiligte Gruppen (hier: Pächter von Kleinparzellen versus Wohnungssuchende mit niedrigem Einkommen) gegeneinander aus.

 File:Schrebergarten.jpg

Die Gegenthese lautet daher, dass Wohnmodelle in Kleingärten nicht behindert, sondern gefördert und weiterentwickelt werden sollten.

Die aktuell noch 71.000 Kleingärten in der Hauptstadt leisten mit der intensiven gärtnerischen Nutzung und ihrer niedrigen und kontrollierten Flächenversiegelung einen erheblichen Beitrag zum Schutz des innerstädtischen Klimas, zur Erhaltung von Arten- und Sortenvielfalt und zur Verbreitung von grundlegendem Wissen über ökologischen Anbau. Es würde Jahrzehnte dauern, diese Vielfalt auf „Abstandsflächen“ zwischen Neubauten wieder herzustellen, sowohl in sozialer wie in ökologischer Hinsicht.

Quelle     :         TAZ         >>>>>        weiterlesen

——————————————————————–

Grafikquellen      :

Oben       —       Bonn, Karl-Legien-Straße, Kleingarten, Schrebergarten

Urheber Wolkenkratzer

Diese Datei ist lizenziert unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 4.0 international“.

————————-

Unten          —          Schrebergarten

Author Kryztoff
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Feuilleton, Mensch, Überregional, Umwelt | Keine Kommentare »

Linke-Saarbrücker Stadtrat

Erstellt von DL-Redaktion am 28. August 2019

erklärt Bündnis mit SPD und Grünen für beendet

SB-Rathaus.jpg

Werden jetzt die Lichter mit den Stiefeln ausgeworfen ?

Von Matthias Zimmermann

Wenige Stunden vorher hatte Mirco Bertucci, SPD-Fraktionsvorsitzender im Saarbrücker Stadtrat, den Wechsel via Pressemitteilung angekündigt: Seine bisherige Amtskollegin beim Koalitionspartner Linke, Claudia Kohde-Kilsch, wechselt zur SPD. Damit sind die Sozialdemokraten mit 18 Sitzen genau so stark im Rat der Landeshauptstadt vertreten wie die CDU.

Sommerfest der Linken 1.jpg

Von einem der Taschenspieler sind nur noch die Tricks übrig geblieben?

Doch die Freude darüber sollte nicht lange bei Bertucci währen. Denn schon kurze Zeit darauf gab Linken-Kreisvorsitzender Thomas Lutze das Aus des bisherigen Bündnisses aus SPD, Linke und Grünen an. Über den Internetdienst Facebook verbreitete er eine Pressemitteilung des Saarbrücker Kreisverbandes seiner Partei, worin die Linke der SPD die Schuld für den Bruch des Bündnisses gibt: „Nach zehn Jahren erfolgreicher Politik einer Koalition von SPD, Grünen und der Linken beendet die SPD ohne Not diese bewährte Zusammenarbeit“, wird darin Lutze zitiert. So habe die SPD die einstige Linke-Politikerin Kohde-Kilsch angeworben: „Wenn ein Koalitionspartner der Meinung ist, gewählte Politiker von Partnerparteien abwerben zu müssen, dann sind die Grundlagen einer vertrauensvollen Zusammenarbeit nicht mehr gegeben.“

Quelle          Saarbrücker-Zeitung        >>>>>         weiterlesen

—————————————————————-

Grafikquellen        :

Oben        —        Das Rathaus in Saarbrücken bei Nacht.

Abgelegt unter Kultur, P. DIE LINKE, Saarbrücken, Überregional | 11 Kommentare »

Der lange kalte Krieg

Erstellt von DL-Redaktion am 26. August 2019

„Ossis“ und „Wessis“

File:Bundesarchiv Bild 183-1990-1003-400, Berlin, deutsche Vereinigung, vor dem Reichstag.jpg

Von Uta Karstein und Thomas Schmidt-Lux

„Ossis“ und „Wessis“ sind zu einem großen Teil soziale Imaginationen.Faktisch existierende Uneindeutigkeiten werden so in der Debatte überdeckt.

an wird sie irgendwie nicht los: die Debatte über den Osten. Nach zwischenzeitlichem Abflauen hat sie angesichts der anstehenden Wahlen in Sachsen, Brandenburg und Thüringen wieder Hochkonjunktur. Jüngst attestierte Gunnar Hinck ihr an dieser Stelle den Charakter eines „geschlossenen Kreislaufs“, der immer weiterlaufe, um seine Existenz zu rechtfertigen, weil schlicht zu viele von der Ost-West-Dichotomie profitieren.

Schaut man hinter die Dichotomie, geht es oft um Relevantes: Chancenungleichheit, Einkommensunterschiede, Fragen nach Ursachen von und den Umgang mit Rechtsradikalität oder die möglicherweise erodierende Akzeptanz der Demokratie. All das gerät jedoch schnell aus dem Blick wenn es mal wieder um „Ossis“ und „Wessis“ und die Frage geht, ob und wie sie sich voneinander unterscheiden und wer woran gerade schuld sei.

Soziologisch betrachtet werden „Ossis“ und „Wessis“ dabei nach wie vor als etwas behandelt, was Benedict Anderson als Imagined Communities bezeichnete. Mit diesem Konzept wies Anderson darauf hin, dass jede Rede von einem Kollektiv als Akteur („die Deutschen“; „wir Franzosen“) zu einem Gutteil eine soziale Imagination darstellt. Die Idee von den Ostdeutschen als einem „Volk“, wie sie jüngst Jana Hensel vorgebracht hat, rekurriere daher nicht einfach auf eine natürlich vorhandene Formation, sondern produziere und reproduziere die Vorstellung davon permanent neu und lasse sie zu einer Realität werden, so Anderson. Faktisch existierende Uneindeutigkeiten – historische wie aktuelle – werden überdeckt.

Derart simplifizierend wird nicht mehr nur unter denjenigen diskutiert, die den Großteil ihres Lebens im geteilten Deutschland verbracht haben. Was sich in familienbiografischen Forschungen schon vor Jahren andeutete, ist offenbar eingetreten: Die Ost/West-Unterscheidung hat den Sprung in die Generation jener geschafft, die zur Wende jugendlich oder jünger waren. Diese jungen Ostdeutschen verhandeln dabei eigene Anliegen, machen sich aber darüber hinaus auch zum Anwalt ihrer (Groß-)Eltern und deren Schicksal. Was dabei herauskommt, ähnelt oft der Identitätspolitik, wie sie auch anderswo betrieben wird.

Jedem sein Zeichen – links fehlt die Banane !

Das erste gravierende Problem: Beobachtbare Unterschiede werden hoffnungslos vereinfacht. Natürlich gibt es Unterschiede, etwa was die Verteilung von Besitz oder gesellschaftlichen Positionen angeht. Natürlich wurde die kulturelle Wirkung dieser vierzig Jahre unterschätzt. Solche Unterschiede werden nun aber zu Identitäten aufgeblasen – auf beiden Seiten. Für die einen ist „der Osten“ schlichtweg rechts und demokratieunfähig, die anderen behaupten seine systematische Marginalisierung und fordern eine Ost-Quote.Welchen Unterschied würde es aber tatsächlich machen, wenn zwanzig Prozent in den Chefetagen aus dem Osten kämen? Ergäbe das per se bessere Unternehmen, Universitäten, Krankenhäuser oder Landesregierungen? Und bis wann müsste jemand im Osten gelebt haben, um die Herkunft geltend machen zu können? Erlischt die Ostherkunft nach Studium und Promotion in Frankfurt am Main?

Quelle        :       TAZ            >>>>>       weiterlesen

————————————————————–

Grafikquellen         :

Oben        —      Berlin, deutsche Vereinigung, vor dem Reichstag Info non-talk.svg

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-1990-1003-400 / Grimm, Peer / CC-BY-SA 3.0

—————————

Unten         —      Västtysklands och Östtysklands flaggor vajar på Montreals olympiastadion

Abgelegt unter Deutschland, Mensch, Positionen, Überregional | Keine Kommentare »

Berliner zu leistbaren Mieten

Erstellt von DL-Redaktion am 26. August 2019

Die Ziele stimmen – die Ergebnisse nicht

Von

Der Bestand der landeseigenen Wohnungsunternehmen wächst zu langsam. Klar auf Kurs ist der Senat dagegen bei der Neuausrichtung auf soziale Ziele.

Was leisten die sechs landeseigenen Wohnungsbaugesellschaften in Berlin für den Bestand und Ausbau von Mietwohnungen für Haushalte mit niedrigen Einkommen? Am heutigen Montag stellt Stadtentwicklungssenatorin Katrin Lompscher (Linke) ihren Bericht „Leistbare Mieten, Wohnungsneubau und soziale Wohnraumversorgung“ vor. Die Bilanz ist ernüchternd: Angesichts der politischen Vorgaben für dauerhaft niedrige Mieten sind die ehrgeizigen Ziele des Senats für den Wohnungsneubau kaum zu schaffen und bergen hohe wirtschaftliche Risiken für die städtischen Unternehmen.

Falls der Senat die sechs landeseigenen Wohnungsunternehmen nicht mit Bauland versorgt, sind die politischen Ziele zur massiven Vergrößerung des Bestandes kommunaler Wohnungen unerreichbar. Dessen Wachstum verläuft ohnehin schon viel langsamer als im Koalitionsvertrag von Rot-Rot-Grün erhofft: Ende vergangenen Jahres hatten die sechs Firmen zusammen gut 306.000 Wohnungen – in zwei Jahren sollen es 360.000 werden, was als unerreichbar gilt. Klar auf Kurs ist der Senat dagegen bei der Neuausrichtung der Unternehmen auf soziale Ziele. Dies geht aus dem Bericht „Leistbare Mieten, Wohnungsneubau und soziale Wohnraumversorgung“, das Senatorin Katrin Lompscher an diesem Montag vorstellen wird.

Die Senatorin selbst zieht „eine positive Bilanz“ in dem Bericht: Mehr als 60 Prozent der landeseigenen Wohnungen seien an Haushalte mit geringen Einkünften wiedervermietet worden. Es seien doppelt so viele Wohnungen wie im Vorjahr angekauft worden (3419) und 3279 neu gebaut worden. Gestartet sei der Bau von 5727 Wohnungen, 15 Prozent mehr als im Vorjahr. Insgesamt planen die sechs Firmen die Errichtung von 49.000 Wohnungen verteilt auf 390 Projekte.

Wirkung zeigt die politische Steuerung der sechs Firmen auf Sozialkurs: Die Mieten der 306.000 Wohnungen stiegen im Durchschnitt um nur 1,3 Prozent, das ist sogar weniger als in der „Kooperationsvereinbarung“ mit dem Senat als Obergrenze vereinbart (zwei Prozent). Und die Durchschnittsmiete in den Landesfirmen liegt mit 6,09 Euro je Quadratmeter unter dem Berliner Mietspiegel (6,49 Euro). Kräftiger langen die Firmen zu, wenn eine Wohnung frei und neu vermietet wird: 4,8 Prozent schlagen sie dann im Durchschnitt auf – und trotzdem bieten die Firmen auch diese Wohnungen deutlich (minus 30 Prozent) unterhalb der Marktmiete an: für 7,43 Euro je Quadratmeter.

Die Reserve von unterbelegten Wohnungen bleibt

Allerdings wird auch das wirtschaftliche Dilemma der sechs Firmen in dem Bericht deutlich: Die politischen Vorgaben sind beim Neubau nicht oder nur unter Schmerzen zu erreichen und werden vermutlich deshalb verfehlt: Die von Lompscher festgelegte „Obergrenze“ von 10 Euro je Quadratmeter Miete für Neubauten ohne Sozialbindung werden „leicht oder deutlich überschritten (um bis zu knapp 1,90 Euro je Quadratmeter)“. Dazu passt, dass Neubauten nicht zu Kosten von weniger als 12 Euro je Quadratmeter gebaut werden können, wie es in der Branche heißt. Deshalb ist unklar, wie die Firmen die politischen Vorgaben erfüllen sollen, ohne systematisch unwirtschaftliche Bauvorhaben anzuhäufen.

Katrin Lompscher (Martin Rulsch) 1.jpg

Vergeblich war das Bestreben, die gewaltige Reserve von unterbelegten Wohnungen zu heben: Rein rechnerisch könnte auf den Bau zehntausender Wohnungen verzichtet werden, wenn beispielsweise alleinstehende Senioren ihre großen „Familienwohnungen“ mit jungen Familien tauschen würden, die ein Kind erwarten und sich vergrößern müssen. Nur 146 Umzüge fanden statt, obwohl der Senat eine Online-Börse eigens dafür eingerichtet hatte.

Quelle       :        Tagesspiegel          >>>>>         weiterlesen

———————————————————————

Grafikquellen     :

Oben       —       El Gropiusstadt, distrito de Berlín diseñado por Walter Gropius

Abgelegt unter Berlin, Deutschland, Sozialpolitik, Überregional | Keine Kommentare »

Sachsentour mit Kipping

Erstellt von DL-Redaktion am 25. August 2019

Wenn man Zitronen reibt, darf man auch mal zuspitzen

DIE LINKE auf der Internationalen Grünen Woche 2012 (6764495511).jpg

Der Chefkoch in Aktion

Von Kersten Augustin und Paul Wrusch (Gespräch)

Die Linken-Chefin Katja Kipping kocht für die taz-WG in Dresden – Kippings Heimatort. Sie verrät ihre Lieblingsorte in Sachsen, welche Musik sie wann hört und woher die Wut vieler Sachsen kommt.

Dresden ist die letzte Station unserer Reise. Wir treffen uns in der taz-WG im Stadtteil Plauen. Pünktlich um 17 Uhr kommt Katja Kipping an. Wir haben sie zum Sachsen-Dinner in ihrer Heimatstadt eingeladen. Das Menü hat sie selbst vorgeschlagen: Griechischer Salat, Mohn-Zitronen-Pasta mit viel Parmesan, sächsische Eierkuchen nach dem Rezept ihrer Großmutter. Kipping hat uns eine Einkaufsliste geschickt. Nach einem kurzen Hallo legt sie gleich mit los. Sucht Brettchen und Messer in der ihr fremden Küche zusammen. „Wer will Zwiebeln schneiden?“ Ihr Pressesprecher opfert sich. Weitere Aufgaben werden verteilt. Direkt Weißweinschorle? „Erst mal Wasser bitte. Ich muss noch in den Flow kommen beim Kochen.“

taz am wochenende: Frau Kipping, warum haben Sie dieses Rezept ausgewählt?

Katja Kipping: Ich wollte etwas kochen, das ich gut kann. Die Zitronen-Mohn-Pasta kommt aus meinem Dresdner Freundeskreis. Mittlerweile hat es zwar alle irgendwie nach Berlin verschlagen, wir treffen uns aber regelmäßig zum Mädelsabend. Dass der Salat rot-rot-grün ist, ist eher Zufall. Mir schmeckt er, und er hat etwas heimeliges. Als ich klein war, gab es oft Tomate mit Ziegenkäse.

Und die Eierkuchen kommen von der Großmutter.

Ja, die war sehr sparsam, hat gegorene Milch statt Buttermilch verwendet. Ich nehme Buttermilch oder Kefir. Nach dem Abi war ich im Freiwilligendienst in Gatschina bei Sankt Petersburg. Dort gab es oft Bliny, die russische Variante. Auch sehr lecker.

Wie oft kommen Sie dazu, zu kochen?

Wenn es gut läuft, habe ich jedes zweite Wochenende frei. Dann kochen wir. Und wenn ich schreibe, ein Buch oder eine Flugschrift, dann mache ich Homeoffice und koche in der Mittagspause für mich, während nebenbei Serien laufen:. „Haus des Geldes“, „Good Girls“, „Big Bang Theory“…

Das Essen wirkt auf uns gerade nicht besonders sächsisch. Sie sind Vegetarierin, was isst man da in Sachsen?

Kartoffeln mit Kräuterquark und Leinöl? Ich esse ja Fisch, das ist eigentlich Tierrassismus. Als wir als Jugendliche beim Wahlkampf übers Land gefahren sind, haben die Genossen in den Kleinstädten uns gerne mit Bratwurst empfangen, aber viele von uns waren Vegetarier.

DIE LINKE Bundesparteitag 10. Mai 2014-53.jpg

Kipping hat auch beim Kochen kein Problem damit, Anweisungen zu geben. Manchmal klingt sie wie eine Fernsehköchin: „Bitte in sehr kleine Würfel, dann entfaltet sich das Aroma besser.“ Nach 30 Minuten zieht sie ihr langärmliges Shirt aus, wirft es aufs Sofa und widmet sich den Zitronen, die sie mit einem kleinen Löffel auspresst. Schnell bindet sie sich ein Küchenhandtuch vor die Hose.

Jetzt muss ich auch mal was fragen: Was haben Sie denn so erlebt auf Ihrer Tour durch Sachsen?

Wir waren beeindruckt von den jungen Aktiven und den alten Bürgerrechtlern, die in Plauen zusammen an einem Tisch sitzen.

Wenn du gegen Nazis bist in Plauen, das ist echt kein einfaches Leben. Ich war letztens zu Besuch dort, da kam ein Bürgerrechtler auf mich zu. Der wusste schon, was ihn in der Vergangenheit von uns getrennt hat – aber auch, warum er jetzt mit der Linken zusammenarbeitet.

Was uns auch aufgefallen ist: Wir waren sehr beeindruckt, wie schön saniert die Städte waren …

… die Marktplätze, klar, da hat sich viel getan.

Aber nur weil die Straßen schön sind, gibt es nicht unbedingt einen Bus, der darauf fährt.

Je idyllischer die Landschaft, umso schlechter die Stimmung, hat eine Genossin vor Kurzem gesagt. Man kann mit dem Abgehängtsein unterschiedlich umgehen. Ich war letztens in einem Dorf in Brandenburg, da wohnen keine 100 Einwohner. Einer hat da gerade in einer Trafostation die kleinste Galerie der Welt gebaut und lädt zu Vernissagen ein … Will mal jemand den Salat verkosten, die wirklich wichtigen Dinge hier!

Schmeckt sehr gut.

Und jetzt: Food-Fotografie. Kipping posiert mit dem fertigen Salat. „Machen wir mal Pause für Instagram und Twitter, räumen den Tisch ab und trinken Alkohol, oder?“, sagt sie und lässt sich dann die erste Weißweinschorle einschenken.

Wir haben für das Essen 15 Euro pro Person ausgegeben, inklusive Weißwein. Ist das viel?

Klar, für jemanden, der auf Hartz IV angewiesen ist, ist das knapp. Paprika ist teuer, Parmesan auch, der Mohn geht. Gut, ihr habt euch für Wein entschieden, der teuer ist. Ich habe mit Leuten zusammengewohnt, die waren auf Hartz IV angewiesen und haben trotzdem im Bioladen eingekauft, weil ihnen gesundes Essen wichtig war. Wir kämpfen ja dafür, dass sich jeder gutes Essen leisten kann. Teilen wir uns eigentlich rein in den Einkauf?

Der geht auf uns. Wie war das früher in Ihrer WG?

Da hatte jeder für seinen Alltag seines eingekauft, und wir konnten uns beim Essen der anderen bedienen. Oft gab es nur eine Butterdose im Kühlschrank. Und wenn die Butter alle war, hat irgendjemand neue gekauft. In meiner alten Studi-WG in Dresden waren wir zu fünft. Ich habe immer mit Leuten zusammengewohnt, bei denen ich wusste: Wenn ich Party mache, steht das am nächsten Tag nicht in der Presse.

Sie wohnen jetzt mit Ihrer Familie in Berlin, hatten bis vor Kurzem aber noch ein WG-Zimmer hier.

Ja, aber der Vermieter hat Ärger gemacht bei Untervermietung, so mussten wir die WG kündigen, als Mitbewohnerinnen mit ihrer Familie zusammenzogen. Als ich auszog, stand ich auf der Straße und habe auf meinem Handy „Those were the days, my friend“ abgespielt.

Sie haben mal gesagt: Am liebsten würden Sie Ihren Lebensmittelpunkt in Dresden haben.

Ja. Wenn ich auf den Elbwiesen bin oder mit dem Fahrrad durch Dresden fahre, denke ich: So was hat Berlin nicht. Aber hier gibt es auch Pro­ble­me, zum Beispiel einige Schulleitungen, die Pegida nahestehen.

Es scheint auch noch Menschen zu geben – welche mit einen Rührlöffel arbeiten können und wollen ?

Aber eine Studie hat gerade gezeigt, dass das Bildungssystem in Sachsen das beste in Deutschland ist.

Die kam von der Initiative Neue Soziale Marktwirtschaft, dem Zentralorgan des Kapitals … Wenn man Zitronen reibt, darf man auch mal zuspitzen.

Dann spitzen Sie doch mal zu: Wie sind die Sachsen?

Ganz einfach: So verschieden wie die Bayern.

Aber es gibt auch Vorurteile, die stimmen.

Wenn Dresdner jemanden treffen, der nicht aus ihrer Stadt kommt, dann fragen die nicht offen: „Wie findest du Dresden?“, sondern: „Schön in Dresden, ne?“ In einem Theaterstück von Volker Lösch sagt der Bürgerchor über Dresden: „Selbst die Ruinen sind hier schöner.“ Das trifft den Stolz der Dresdne­r*in­nen auf ihre Stadt.

So schauts aus in Silwingen ?

Der sächsische Dialekt gilt aber als nicht so schön.

Da machen sich ja gerne alle drüber lustig. Letzten Montag wurde ich gleich auf den neuen „Tatort“ aus Dresden angesprochen: „Die Schauspieler machen einen auf sächsisch, können aber nicht mal den Dialekt.“

Haben Sie sich den sächsischen Dia­lekt abtrainiert?

Nein, nur so klassische Aussprache­fehler.

„So, wollen wir jetzt schon Salat essen? Oder zusammen mit dem Hauptgang?“, fragt Kipping. Uneinigkeit in der Küche. „Wir können ein Los ziehen oder gute Argumente austauschen.“ Die Politikerin ist stets um Ausgleich bemüht. Ergebnis, leichte Mehrheit für: jetzt essen. Kipping verteilt Salat in tiefe Teller und Schüsseln.

Wollen wir Musik hören? Roland Kaiser mit „Schachmatt“, dazu haben Sie früher auf Wahlkampftour durch Sachsen auf dem VW-Bulli getanzt.

Wir haben eher Rosenstolz gehört. Aber wollen wir nicht lieber Keimzeit hören?

Warum Keimzeit?

Ich war ein Fan. Als Jugendliche bin ich mal mit einer Freundin getrampt, mit dem Diktiergerät der Schülerzeitung im Gepäck, um mit der Band zu sprechen.

Sie waren früher viel mit dem Bulli in Sachsen unterwegs. Wo ist es am schönsten?

Ich mag besonders Oybin und Jonsdorf, bei Zittau. Da war ich als Kind sehr oft wandern. Und dort, wo früher Kohleabbau war, sind heute tolle Seen.

Als Jugendliche waren Sie im Umweltzentrum „Brennnessel“ aktiv. Hätten Sie auch bei den Grünen landen können?

Nein, wer damals links war, der ist zur PDS gegangen. Die führende Kraft für eine ökologische Verkehrspolitik in Dresden war und ist meine Partei.

Sie stiegen schnell auf, wurden mit 21 jüngste Landtagsabgeordnete in Sachsen und wurden häufig als Jeanne d’Arc der Linken bezeichnet, als „jung und schön und klug“.

Und heute nur noch klug? Die Artikel von damals sagen weniger über mich als über das Bild von Frauen in der Politik. Das würde heute kaum mehr funktionieren, da hat es einen Fortschritt gegeben. Auch wenn der Hass gegen Frauen auch ein Teil des Erfolgs der Rechten ist.

Fast zwei Stunden sitzen wir in der Küche in Dresden-Plauen. Zeit für eine Raucherpause. Kipping raucht nur vor und nach Talkshows, „ein Ritual“, sagt sie, und in Gesellschaft zum Wein. Sie kommt mit runter, lässt sich eine Zigarette drehen. Zurück in der Küche stürmt sie sofort wieder an den Herd, sucht Töpfe für die Nudeln, eine Pfanne für die Soße, kämpft mit dem Herd. Kipping brät die Zwiebeln an und gibt Mohn und Zitronenschale dazu, dann kommt Sojasahne darauf. „Oh, die Sauce ist ganz schön suppig.“ Jetzt muss sie zum ersten Mal improvisieren. „Habt ihr noch Frischkäse im Kühlschrank. Bei euch ist niemand Veganer, oder?“

Was sollen wir jetzt hören? Doch mal Roland Kaiser?

Quelle         :           TAZ       >>>>>        weiterlesen

——————————————————————-

Grafikquellen      :

Oben       —     Unter dem Motto »Was is(s)t gesund?« präsentiert sich die Bundestagsfraktion vom 20. bis 29. Januar auf der weltgrößten Messe für Ernährung und Landwirtschaft am Berliner Funkturm.

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-53.jpg
  • Created: 2014-05-10 14:40:39

 

—————————-

3.) von Oben    —      Der Rechte Flügel ? Blogsport  / Ein ganzes Leben wie Göttin und Gott in Frankreich  – andere Arbeiten lassen !

—————————————

Unten       —      Fischbüfett

Abgelegt unter Einfach lecker - günstig, P. DIE LINKE, Sachsen, Überregional | Keine Kommentare »

Flächentarif muss her

Erstellt von DL-Redaktion am 25. August 2019

Ver.di Tarifkommissionen
Karstadt-Kaufhof entwickeln Strategiepapier

Datei:Erster-mai-20060-sponti.jpg

Quelle       :      Scharf  —  Links

Von Herbert Schedlbauer

Die Fusion von Karstadt und Kaufhof trifft jetzt die Beschäftigten beim Kaufhof besonders hart. Nach dem Personalabbau schwingt der Konzern die Keule der Tarifflucht und droht mit 11prozentiger Lohnkürzung. Um dagegen Widerstand und Positionen zu entwickeln, trafen sich letzte Woche die Tarifkommissionen des neuen Handelsriesen.

Vereinbart wurde, wie dem Kahlschlag bei Karstadt Warenhaus, Galeria Kaufhof sowie von Karstadt Sports und Karstadt Feinkost begegnet werden soll. Gemeinsam mit der Vereinten Dienstleistungsgewerkschaft (ver.di) wurde ein Konzept erarbeitet, wie mit dem neuen Warenhauskonzern Verhandlungen über einen möglichen Sanierungstarifvertrag aufzunehmen sind.

Wichtigste ver.di Forderung ist dabei, dass der Handelskonzern verbindlich wieder zum Flächentarifvertrag zurückkehren muss. Die Gewerkschaft und die Beschäftigten befürchten sonst eine weitere Tarifflucht. Die betrieblichen Interessenvertreter wollen in einem Sanierungstarifvertrag eine vertragliche Rückkehr auf das Niveau des Flächentarifvertrags und die Übernahme der Tariferhöhungen geregelt haben. Vor Abschluss eines zeitlich begrenzten Sanierungstarifvertrags müsse deshalb festgelegt werden, wie die volle Anpassung an das Niveau des Flächentarifvertrags vor Vertragsende sichergestellt wird.

Als weitere Bedingung will ver.di eine gemeinsame tarifliche Lösung, die für alle Beschäftigten von Kaufhof und Karstadt sowie Karstadt Sports und Feinkost gilt. Ein Eingriff in die aktuellen Vergütungen und Entgelte, allen voran bei Kaufhof, wird abgelehnt. Eine dauerhafte Absenkung nach Ablauf eines Sanierungstarifvertrags oder einen „Warenhaus-Tarifvertrag“ kommt laut Orhan Akman, ver.di Bundesfachgruppenleiter im Einzelhandel, nicht in Frage.

Die ver.di Mitglieder der Tarifkommissionen verlangen „für alle vier Unternehmenssparten ein Konzept unter Beteiligung der Beschäftigten“. Die Gewerkschaftsvertreter wollen eine Mindestbesetzungsquote beim Personal pro Quadratmeter Verkaufsfläche und einen Stopp der Fremdvermietungen in den Warenhauspalästen. Nach Meinung mehrerer Kaufhof Betriebsräte müsse die ganze Auseinandersetzung gemeinsam mit ver.di aus den Betrieben heraus an die Kunden getragen werden. „Schon lange kritisieren diese die knappe Personalbesetzung in den Abteilungen. Wer in einem Warenhaus einkauft, will auch eine entsprechende Beratung haben“ ist von dort zu hören.

René Benko und die Manager des neuen Handelsriesen Karstadt-Kaufhof drohen offen mit der Absenkung der Löhne und Gehälter. Geht es nach ihnen, soll nach Ablauf eines Sanierungstarifvertrages ein Haustarifvertrag folgen. Wenn es zu keiner Einigung mit ver.di über einen „Billigtarifvertrag“ kommt, will der Österreicher einen rechtlichen Zusammenschluss von Karstadt und Kaufhof durchsetzen. Dann wiederum würde der alte Karstadt Sanierungsvertrag gelten. Dies bedeutet automatisch elf Prozent weniger Gehalt für das Personal von Kaufhof.

Schon in den letzten Jahren haben die Beschäftigten auf Tariferhöhungen sowie auf große Teile des Weihnachts- und Urlaubsgeldes verzichtet. In der Hoffnung, damit Arbeitsplätze zu erhalten um Karstadt und Kaufhof zu sanieren. Wie viel von diesem Verzicht in Wirklichkeit die Aktionäre und Eigner kassiert haben, bleibt ein Geheimnis in dieser Gesellschaftsordnung.

Der Griff nach dem Kaufhof durch Benko im Herbst 2018 vernichtete nach dessen Übernahme bereits rund 2600 Vollzeitarbeitsplätze. Anfang August trennte sich Kaufhof auch von zwei Logistikstandorten in Erfurt und Frechen. In Hannover, Stuttgart, Würzburg und Berlin wurden zusätzlich vier Regionallager geschlossen. Laut ver.di sind davon 1100 Stellen betroffen.

Erstveröffentlicht in UZ, 23.8.19

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————–

Grafikquelle        :

Revolutionäre 1. Mai Demonstration 2006, Oranienstraße in Berlin-Kreuzberg, nicht angemeldete Spontandemonstration
Datum published 2. May 2006
Quelle http://www.montagsdemo.net/wiki/index.php/Bild:Maidemo06_04.jpg
Urheber Admin

 

w:de:Creative Commons
Namensnennung Weitergabe unter gleichen Bedingungen
Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 2.0 Deutschland“ lizenziert.

Abgelegt unter Arbeitspolitik, Deutschland, Gewerkschaften, Überregional | Keine Kommentare »

Neue Agenda 2010

Erstellt von DL-Redaktion am 25. August 2019

Ein Gespenst kehrt zurück

File:Gerhard Schroeder 2005.jpg

Der Genosse aller Bosse – darauf folgte Merkel welche das Gras immer kuz hielt.

Eine Kolumne von

Die Rezession droht – deshalb sollen die Menschen mal wieder flexibler werden und verzichten. Sagen Konzernbosse. Dabei hat genau so etwas zur akuten Krise von Konjunktur und Demokratien beigetragen.

In den Firmen schwinden die Aufträge, die Kundschaft schaltet auf Vorsicht. Erstmals seit Langem geht in Deutschland wieder die Angst vor einer Rezession um. Da war es nur eine Frage der Zeit, bis der erste nervöse Großchef mal wieder danach ruft, dass jetzt die Mitarbeiter flexibler werden sollen – man müsse schließlich auf die Kosten gucken.

So wie es der Vorstandschef der Chemiefirma BASF diese Woche nahe gelegt hat, als er gleich mal eine neue Agenda 2010 erbat. Motto: Regierung, hilf!

Nun kann so etwas anno 2019 natürlich Satire sein. War es aber offenbar nicht. Sondern Ernst.

Da kriselt Deutschlands Industrie teils aus eigener Blödheit, was das schlechte Tricksen und Vertändeln von Mobilitätstrends angeht, teils weil die Finanzkrise nachwirkt und Populisten lieber Handelsstreits und neue Grenzen wollen. Und was soll helfen? Dass Herr Meier und Frau Müller mehr Flexibilität zeigen und in heroisch-asketischer Eigenverantwortung auf dies und das verzichten. Was zu Agenda-Zeiten in etwa so penetrant gefordert wurde wie heute der Verzicht von Tante Erna aufs Fliegen nach Malle, weil das angeblich das Weltklima rettet.

In Zeiten des Trump- und Brexit-Abschwungs eine neue deutschelnde Agenda 2010 zu fordern, klingt dabei nicht nur widersinnig, es birgt womöglich sogar das Potenzial größerer Katastrophen. Wenn die politischen Schocks der vergangenen Jahre etwas lehren, dann ja, dass die Menschen womöglich doch nicht so flexibel sein wollen und können, wie es die Globalisierung will – und stattdessen wieder mehr Sicherheit bräuchten.

Politik ist nicht dazu da, um den Konzernen Gewinne zu sichern

Wir verstehen ja durchaus, dass ein Vorstandsvorsitzender gucken muss, wie er fehlende Einnahmen in der Not auffängt, damit die Bilanz nicht blöd aussieht. Und in der Verzweiflung die Belegschaft um, sagen wir, mehr Flexibilität bittet. Wobei der BASF-Chef im Interview nicht gesagt hat, was er sich darunter genau vorstellt. Nur hilft das ja nicht gegen die akuten Ursachen fehlender Einnahmen. Zumal Politik auch nicht da ist, um Gewinnfortzahlung im Rezessionsfall zu gewähren.

Wenn Briten, Italiener oder Amerikaner gerade Aufträge bei der deutschen Industrie kappen und Unternehmen mit größeren Investitionen zögern, hat das ja nichts damit zu tun, dass in Deutschland die Beschäftigten seit ein paar Monaten, huch, zu teuer sind. Gemessen am Umsatz der Wirtschaft sind die Lohnkosten selbst in den Aufschwungjahren so gut wie nicht gestiegen und liegen heute nach wie vor deutlich niedriger als 2003. Die Wirtschaft macht per Saldo Gewinn – historisch.

Schroemuentekunz.jpg

TATORT BERLIN“ MIT GERD  S. UND FRANZ M. IN DEN HAUPTROLLEN.
Nebenrollen: Martin Schulz, Andrea Nahles, Malu D., C. Lindner, special Guests: Peter Hartz und Kevin —   WÄRST DU DOCH IN GODESBERG GEBLIEBEN!

Und die Deutschen sind am Arbeitsmarkt auch nicht plötzlich fürchterlich unflexibel geworden – nach zehn Jahren, in denen Monat für Monat mehr Arbeitsplätze geschaffen und besetzt wurden, als es bei dem Wirtschaftswachstum überhaupt zu erwarten war. Es gibt enorm viel Zeitarbeit, Teilzeit und Billigjobs. Flexibler geht’s kaum.

Wenn etwas aus Betriebssicht nicht glatt läuft, dann liegt das eher daran, dass Fachkräfte fehlen, und die entstehen nicht plötzlich, weil Herr Müller, sagen wir: umsonst Überstunden macht. Oder weil es wieder einfacher würde, Zeitarbeitsjobber billig auszunutzen. Im Gegenteil: die wollen auch einen sicheren Job.

Quelle      :          Spiegel-online         >>>>>         weiterlesen

————————————————————————–

Grafikquellen       :

Oben      —          Bundeskanzler de:Gerhard Schröder bei einem Wahlkampfauftritt 2005 in Frankfurt am Main, hinter Schröder: de:Heidemarie Wieczorek-Zeul

Source Fotografiert am 17. September 2005
Author Christoph F. Siekermann

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

————————————————

Unten      —          Franz Müntefering (l.) und Gerhard Schröder (r.) bei der Abschlusskundgebung im Bundestagswahlkampf 2005 in Frankfurt am Main

Abgelegt unter Deutschland, HARTZ IV, P.SPD, Überregional | Keine Kommentare »

Von den Facebook-Linken

Erstellt von DL-Redaktion am 23. August 2019

Ein skandalöser Vorgang bei den Facebook-Linken

File:Facebook en aula2.jpg

Quelle      :      Scharf  —  Links

Eine Polemik von Günter Meisinger

ODER – Von projezierenden Trollen, studentischen „Arbeiterführern“, Marxisten gegen Marx, Trotzkisten ohne Trotzki und alle zusammen zu Füßen des Propheten Mohammed.

Ah! I am crushed. Selbsternannte jugendliche Führer des Proletariats warfen mich aus einer angeblich trotzkistischen Facebook Gruppe („Trotzkismus in Deutschland“) hinaus, nachdem sie mich in stalinistischer Manier als Rechten „entlarvten“. Ich brauche eine Selbsthilfegruppe! Oder die?

Schon mein erster harmloser Beitrag in der Gruppe sorgte für böses Blut. Hatte ich doch darin „die enorme Wichtigkeit des persönlichen Verhaltens“ angemahnt. Darin vertrat ich die Ansicht, dass nach der epochalen Niederlage 1989 Linke nur dann wieder Menschen gewinnen können, wenn sie ehrlicher, vertrauenswürdiger, authentischer, hilfsbereiter und freundlicher als andere wahrgenommen werden. Und dass dies wichtiger sei als jahrzehntelange Streitigkeiten um das vermeintlich richtige Programm. Dies erntete viele Lacher und Heiterkeitsstürme, aber keine Likes (bei 716 Mitgliedern). Ich wurde über die unendliche Wichtigkeit des „richtigen“ Programms sowie des richtigen Organisationsaufbaues belehrt, als Lösung aller Probleme. Darunter von Leuten die ihre eigene SAV/CWI-Spaltung nicht verhindern konnten, oder solchen, deren amerikanische. Schwesterorganisation ISO sich gerade aufgelöst hatte. Komisch nur, dass jeder eine andere Meinung darüber hat, was das richtige Programm ist und manche Kleinsekten die es zu haben glauben, nun seit Jahrzehnten auf den Zustrom der Massen warten. Niemand verstand die ganze Dimension dessen was ich meinte (wenn sich nämlich jemand persönlich übel verhält, kann das seine gesamte politische Arbeit zunichte machen einschließlich der seiner ganzen Gruppe) und manche vereinfachten dies zu „naja, wer nur nette Leute sucht kann irgendwohin gehen, aber braucht keine Partei“. Dies gab einen Vorgeschmack darauf mit welchen Geistesgrößen ich es zu tun hatte. Leute die es im Gegensatz zu Linken früherer Zeiten (die Intellektuellen, Schriftsteller und bekannten Künstler der siebziger Jahre sind alle weg) nicht vermögen, Dinge in ihrer Gesamtheit und Entwicklungsrichtung (also sozusagen dialektisch) zu betrachten, sondern nur noch wenige Schlagwörter und einige Schubladen im Kopf hatten, auf die dann abgehoben wurde, auch wenn das nichts mit dem Thema zu tun hatte.. So hatte ich meinen Artikel mit einem Zitat von Che Guevara (dem ich keinesfalls unkritisch gegenüberstehe) über das notwendige „exemplarische Verhalten der Revolutionäre“ und der Frage, was dies für unseren Alltag hier und heute bedeuten könne, eröffnet. Ohne darauf einzugehen, wollten dann einige eine allgemeine Debatte über Che führen, der eine weil er ihn als Stalinist sah, der andere weil er ein „moralisierender Kleinbürger“ sei. Nur die Frage, was er gegen das beispielhafte Verhalten von Revolutionären einzuwenden habe, konnte mir Michael Bonvalot (meines Wissens von der pro-islamischen österreichischen „Linkswende“) nicht beantworten. Aus gutem Grund, wie sich später herausstellte, denn wer sich gerne übel und Verleumderisch verhält, kann eine solche Debatte nicht gebrauchen. Jedenfalls wurde ich fleißig von jugendlichen und studentischen Anführern „proletarischer“von  Kleinsekten belehrt, was mich an das Buch „Rückkehr aus Reims“ erinnerte, dessen französicher Autor Eribon (in jüngeren Jahren selbst trotzkistisch organisiert) an viele solcher Studenten erinnerte, die ihre Verachtung für die Arbeiterklasse während ihrer Studienzeit ultralinks kostümierten („verbürgerlichte Arbeiter“) und nach ihrer Studentenzeit als die offen rechten neue Bosse der Arbeiter zurückkehrten. Als ich dies dann zur Diskussion stellte, gab es neue Empörung, und ein Junge der zwei Rechtschreibfehler in einem Halbsatz machte, nannte mich „den Labersack aus der Arbeiterklasse“, womit er ja offen seine Klassenverachtung zeigte. – Ein Sonderfall war die „4.Internationale“ um Manuel Kellner, der zwar fast als einziger zu argumentieren versuchte, aber immer heftig abstritt, daß die Vereinigung der damaligen Mandelisten mit Stalinisten und Maoisten sowas wie eine internationale Strategie war. In Deutschland habe damals nur die KPD/ML auf Diskussions- &Vereinigungsangebot reagiert. Das kann schon sein, aber daß dies in mehreren Ländern immer nur dieselbe CP/ML gewesen sein soll, die reagierte, kommt mir noch immer komisch vor; zumindest in Italien wären da sicher auch andere zur Diskussion in Frage gekommen. Aber lassen wir das; sein Kollege Christoph Jünke jedenfalls, von dem ich aufgrund seiner Bücher erwartet hätte, auf Kritik eingehen zu können, versteckte sich wie so viele hinter der Verteilung kindischer Lacher („Smileys“) anstatt es mal mit einer Begründung zu versuchen.

Jedenfalls schienen langsam einige, denen nie irgendwelche Argumente gegen mich einfielen, auf Rache zu sinnen. Ein Mo Slak, der bisher gar nicht in der Diskussion vorkam, hatte sich zwischenzeitlich über mein Profil hergemacht und ein Posting gefunden das ich von einer rechten Website übernommen hatte. Darin ging es um mehrere Vorfälle durch sexuell belästigende Migranten im Düsseldorfer Schwimmbad, wo das Magazin von „Marx 21“ (das sind die, die ihre Kongresse mit Moslembrüdern, Salafisten, Mazyek und Linke mordenden grauen Wölfe besetzen) „herausfand“, dass an den Massenauseinandersetzungen „kein einzelner“ Ausländer(!) beteiligt gewesen sei. Klar, wie immer die Müllers und Meiers. Deswegen hielt ja auch ein anderer Jungmann dieser Facebookgruppe die Veranstaltung einer Berliner PDL-Frau über kriminelle arabische Clans für „völlig rassistisch“ und die Moderatorin wird seither von M21-Leuten bedroht; soweit geht das schon. Jedenfalls glaubte jetzt jemand, die Sensation aufgedeckt zu haben, dass sich mit meiner Person ein rechter Rassist in den Club eingeschlichen habe. Klar, und weil ich ja so rechts & rassistisch bin, habe ich mein ganzes Leben (seit 50 Jahren in der Kommunistischen Bewegung) für Nichtdeutsche gekreuzigt, Jahrzehntelang antirassistische Artikel in Tageszeitungen und Kulturmagazinen veröffentlicht, einem Türken das Leben gerettet, einen großen deutsch-türkischen Freundschaftsverein mitgegründet, Flüchtlingsarbeit gemacht u.v.m. Die tausenden von Leuten die mich persönlich kennen, der große Schweizer Unionsverlag, der mir einst für „meine Kompetenz in orientalischer Literatur“ dankte sowie der weltberühmte schwarzamerikanische Schriftsteller James Baldwin, einst neben seinem Freund Martin Luther King der Sprecher der amerikanischen Bürgerrechtsbewegung, der mit mir befreundet war- sie alle waren wohl zu dumm zu bemerken, mit was für einem Faschisten sie es zu tun hatten. Aber ein Mo Slak hat mich jetzt enttarnt. Touche! Ich bin zerstört! Ja, die kleinen (oder großen) realitätsfremden Idioten glauben das wohl wirklich. Ein anderer der sicher im Leben nicht einen Bruchteil meiner politischen . &antirassistischen Arbeit leistete, nannte mich „Ekelerregend“ (nun, so sah ER aus); wieder ein anderer warf mir Selbstbeweihräucherung vor, obwohl ich zum erstenmal im Leben öffentlich meine Verdienste aufzählte, da ich mich nicht widerstandslos verleumden lasse. (Damals als Baldwin mich einlud und mir die Tickets schicken wollte, war ich so bescheiden die abzulehnen, und sagte ich käme sobald ich die selbst zahlen könne, doch bald darauf verstarb er. Jeder warf mir damals diese „dumme Bescheidenheit“ vor.) Also warum nehme ich manchmal anti-islamische Postings von rechten Websites? Ganz einfach: weil auf linken Websites hierzulande die Wahrheit über den faschistischen Islam und seine Gesandten nicht zu finden ist (meine Jahrzehntelange tausendfache Erfahrung mit diesem Kulturkreis -die noch immer allen meinen Anschuldigern abging- erlaubt mir, Wahrheit und Fakenews zu unterscheiden.) In Frankreich könnte ich da auch auf linke Websites zurückgreifen. Das ist alles. Zum Rechten werde ich dadurch noch lange nicht. Aber Leute ohne Argumente können halt nur verleumden und die, die was zu sagen haben, aus ihren Gruppen exkommunizieren, wie einst Stalin.

Die Pseudo-Linken als neue Zweiwortstammler

In den 19-siebziger Jahren habe ich mal die damaligen rechten und Neonazis als Zweiwortstammler bezeichnet, weil deren Wortschatz nicht über „scheiß Kommunist“ hinausging. Heututage sind es erschreckend große Teile aller Sorten Linker, die einem bei noch so berechtigter Islamkritik nur noch „antimuslimischer Rassist“ entgegen stottern können ohne zu wirklich inhaltlicher Auseinandersetzung fähig zu sein (siehe „Marx 21“). Kurz, viele Linke sind heutzutage deutlich dümmer wie damals, während die Rechten intelligenter geworden sind. Eine gefährliche Entwicklung, die bereits dazu führte, dass ein Martin Sellner von den rechten „Idenditären“ (der Philosophie studierte) seinem linken Kontrahenten im österreichischen Fernsehen eindeutig überlegen war. Dies wäre früher, wo es immer hieß „der Geist steht links“, undenkbar gewesen. Auch gelang es den Idenditären alle Linken vorzuführen und lächerlich zu machen, indem Mitglieder dieser Gruppe unerkannt auf einer linken Demo mitliefen und dabei das Transparent hochhielten „Asyl für 1,3 Milliarden Afrikaner!“ Das fanden alle gut, auf der Rednertribüne wurde es gelobt. Keinem kam es in den Sinn, dass ein Land von unserer Größe nicht ganz Afrika, fast 1/5 der Erdbevölkerung aufnehmen, versorgen und finanzieren kann.

File:Walenstadt. Paxmal. Linke Wand. Bilder 5 und 6 - 001.JPG

Wandgemälde aus dem Palazzo Protzo in Silwingen/Saarland ?

Als ich übrigens auf die geharnischte Islamkritik von Karl Marx verwies, der schon 1854 „den islamischen Mob“ aus Deutschland hinauswerfen wollte, sagte mir der orthodoxe Marxist Mo Slak zu meiner Überraschung, da habe Marx eben Unsinn geschrieben! Ich bin sicher, dass er das nicht gesagt hätte, wenn ich eine andere Religion angegriffen hätte. Aber ausgerechnet für den faschistischen Islam haben diese „Linken“(?) alle ihr Herz entdeckt.  Jedenfalls würden Marx oder Trotzki diesen Gestörten doch schreiend davonlaufen.

Erschreckende menschliche Degeneration

In diesem angeblich trotzkistischen (also antistalinistischen) Club wimmelte es in Wirklichleit nur so von Stalinisten, Islamisten und sonstigen antidemokratischen Dummköpfen. Böse und haßerfüllt fielen alle Diskursunfähigen über meine schwerkranke Person her. Selbst als ich mitteilte, dass jede Aufregung mich töten könne, fanden mache dies in ihrer Unfähigkeit zur Empathie noch zum lachen komisch. Die Leute die beanspruchen, eine bessere Welt aubauen zu wollen, sind weit zurück hinter „bürgerlichen Humanisten“. Wie Leute mit solchem Verhalten jemals zum Sozialismus gelangen wollen, bleibt deren Geheimnis. Aber nochmal zu den Inhalten: Da zerbrechen und spalten sich bereits die letzten Kleingruppen, wie ich es vor einigen Wochen voraussagte (ohne von deren internen Querelen zu wissen!) und der lernunfähige Rest macht so weiter. Die noch etwas größere Linkspartei fällt bei der letzetn Wahl auf 5% herunter und kommt nicht auf die Idee, dass dies an ihrem Programmpunkt „offene Grenzen für alle die kommen wollen“ liegt. Da müssen halt alle weiter wie die Lemminge in den Untergang rennen. So stehen wir vor dem unmittelbaren HISTORISCHEN Ende aller Linken, aus dem es keine Wiederauferstehung geben wird.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————

Grafikquellen         :

Oben      —        Facebook en el aula

Author Veluben

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

———————–

Unten     —      Paxmal in Schrina-Hochrugg (um 1940). Die Mosaiken der linken Wand.

Source Own work
Author Shesmax

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Gewerkschaften, Kultur, P. DIE LINKE, Überregional | Keine Kommentare »

T. Sarrazin und H.-G. Maaßen

Erstellt von DL-Redaktion am 23. August 2019

Was haben beide gemeinsam? 

Sarrazin book pres b4.jpg

Er steht ihm gut – dieser Oberlippenbart !

Eine Kolumne von Volker Heise

Den einen will die SPD nicht mehr, den anderen die CDU. Doch da hören die Gemeinsamkeiten nicht auf.

Eine der großen politischen Fragen der Gegenwart lautet: ist Thilo Sarrazin der Hans-Georg Maaßen der SPD oder ist umgekehrt Hans-Georg Maaßen der Thilo Sarrazin der CDU? Geht man der zeitlichen Abfolge nach – wer war zuerst da -, ist die Antwort eindeutig, dann liegt Sarrazin vorne. Auf der anderen Seite scheinen beide die Weisheit mit Löffeln gefressen zu haben, und wenn es nicht die Weisheit war, hat Mama sie mit Arroganz gefüttert. Wo sie sind, fühlen sie Deutschland stehen, und wenn Deutschland ganz woanders herumlungert, muss es sich irren.

Maaßen hat die Nase vorne

Geht man von der Medienresonanz aus, hat allerdings Maaßen die Nase vorne. Schon vor Monaten habe ich ja gewettet, dass er ein politisches Ziel hatte, als er mit den Worten, die Sozialdemokraten würden Linksextreme beherbergen, seinen Rauswurf provozierte. Linksextreme Sozialdemokraten kommen sonst ja nur bei den verstorbenen Anhängern von Franz Josef Strauß vor, zu deren Sorte auch Maaßen gehören mag, es gibt durchaus Untote in der Politik, aber in erster Linie wollte er sich wohl a) der Öffentlichkeit als Opfer von Angela Merkel präsentieren, um damit b) Rückenwind zu bekommen beim Erreichen seines eigentlichen Ziels: Innenminister der ersten CDU-AfD-Regierung zu werden, ich tippe mal auf Sachsen als dem erhofften Ort der Erfüllung.

Hans-Georg Maaßen 02.jpg

Und der Wisch-Mopp flattert ihm voraus.

Tatsächlich aber sind sowohl Maaßen als auch Sarrazin Prototypen des politischen Beamten, bei Sarrazin mit einer kleinen Unterbrechung als Wirtschaftssenator in Berlin, wo er das gute Porzellan der Stadt versilberte. Schicksal der politischen Beamten ist es, dass sie immer in der zweiten Reihe stehen, hinter den Ministern, von denen sie in der Regel das Gefühl haben, dass sie, die Politiker, unter ihnen, den Fachleuten, regieren.

Schließlich haben sie sich ein Leben lang in ein Spezialgebiet wie „Innere Sicherheit“ eingearbeitet, während der aktuelle Innenminister gestern noch Entwicklungspolitiker gewesen sein mag und morgen über eine Affäre stolpern kann. Diese Beamten haben aber auch das Problem, dass sie den Wald vor lauter Spezialwissen nicht sehen und ihr Fachgebiet für die ganze Welt halten.

Getarnte Demagogen

Quelle         :         FR         >>>>>         weiterlesen

—————————————————————-

Grafikquellen        :

Oben      —     Thilo Sarrazin, bei der Vorstellung seines Buches „Deutschland schafft sich ab

Abgelegt unter Feuilleton, P.CDU / CSU, P.SPD, Überregional | Keine Kommentare »

Nach dem Totschlag-Urteil

Erstellt von DL-Redaktion am 23. August 2019

Keine Ruhe für Chemnitz

Von Konrad Litschko

Trotz dünner Beweislage wird der Angeklagte zu neuneinhalb Jahren Haft verurteilt. Die Verteidiger kritisieren die sächsische Justiz scharf.

Am Mittag unternimmt Alaa S. einen letzten Versuch. Er bricht sein Schweigen. „Ich kann nur hoffen, dass hier die Wahrheit ans Licht gebracht wird“, sagt der junge Syrer in den letzten Worten vor dem Urteil. „Ich hoffe auf ein gerechtes Urteil.“ Er wolle nicht „das zweite Opfer des eigentlichen Täters sein müssen“. Das erste Opfer, das sei Daniel H. gewesen. Das zweite Opfer aber, das drohe nun er zu werden.

Alaa S. hatte es schon vor den Ermittlern beteuert, bevor er seitdem schwieg: Er sei unschuldig, der falsche Angeklagte. Auch am Donnerstag kommt der 24-Jährige selbstbewusst ins Gericht; hellbeiges Jackett, weißes Hemd, die Haare sorgsam gegelt, der Bart gestutzt. Er wirkt angespannt, aber Alaa S. versteckt sein Gesicht nicht vor den Kameras, er tat es nie in diesem Prozess. Auch das soll wohl das Bild vermitteln: Hier steht ein Unschuldiger.

Aber das Chemnitzer Landgericht kommt an diesem Nachmittag zu einem anderen Schluss: Alaa S. sei sehr wohl schuldig, mit einem Komplizen Ende August 2018 in Chemnitz den 35-jährigen Daniel H. erstochen zu haben. Einem weiteren Mann, Dimitri M., habe er mit dem Messer in den Rücken gestochen. Ein gemeinschaftlicher Totschlag und eine gefährliche Körperverletzung – neuneinhalb Jahre Haft. „Es gibt keinen Zweifel an der Schuld des Angeklagten“, sagt Richterin Simone Herberger.

Das, was hier vor Gericht verhandelt wurde, war Auslöser für Vorgänge, die vor fast genau einem Jahr über Wochen die ganze Republik aufwühlten. In der Nacht auf den 26. August klang in Chemnitz das Stadtfest aus – am Ende lag ein Mensch tot auf dem Bürgersteig: Daniel H., 35 Jahre, Tischler, gebürtiger Chemnitzer. Getötet mit fünf Messerstichen. Die Tatverdächtigen: zwei Geflüchtete. Einer von ihnen ist Alaa S.

Richterbund verwahrt sich gegen Einflussnahme

Was nun in Chemnitz einsetzte, war eine beispiellose Welle an rechten Demonstrationen. Neonazis aus der ganzen Republik reisten an, die AfD auch. Hitlergrüße wurden gezeigt, Migranten wurden attackiert, auch ein jüdisches und persisches Restaurant. Ein Ausnahmezustand, der eine Debatte entfachte, die Verfassungsschutzchef Hans-Georg Maaßen sein Amt kostete und für schärfere Abschiebegesetze sorgte.

Seit März nun wurde vor dem Landgericht über die Tat verhandelt, mit der alles begann. Aus Sicherheitsgründen wurde nicht in Chemnitz verhandelt, sondern in Dresden, in einem Hochsicherheitssaal am Stadtrand – die Verteidiger wollten überhaupt nicht in Sachsen verhandeln. Noch vor Prozessbeginn sagte die Chemnitzer SPD-Bürgermeisterin Barbara Ludwig der taz, sie hoffe auf eine Verurteilung, damit die Angehörigen „Ruhe finden“. Ein Freispruch wäre „schwierig“ für Chemnitz. Der Richterbund verwahrte sich gegen eine Einflussnahme auf die Justiz. Die Verteidiger wiederum forderten gleich zu Prozessstart, die Richter müssten offenlegen, ob sie nicht selbst rechtes Gedankengut teilten – man wisse ja nie in Sachsen. Die Anträge scheiterten. Aber all das legte offen, wie viel Druck auf diesem Verfahren lastete.

Aus Sicht des Gerichts war Daniel H. in der August-Nacht mit Freunden unterwegs, dann traf er gegen 3 Uhr auf den Iraker Farhad R. Der sei vorher schon als aggressiv aufgefallen, nun soll er Daniel H. nach einer „Karte“ gefragt haben, offenbar um damit Kokain zu schnupfen. H. habe ihn abgewiesen, es kam zum Handgemenge. Nun sei auch Alaa S. aus einem nahe gelegenen Döner-Imbiss herausgestürmt, ist Richterin Herberger überzeugt. Er habe kurz mit Farhad R. gesprochen, dann sei er mit einem Messer auf den Chemnitzer losgegangen. Ein Stich traf dessen Herz, einer die Lunge. Daniel H. starb noch vor Ort.

Das Problem nur: Farhad R. ist bis heute flüchtig. Und gegen Alaa S. blieb die Beweislage bis zum Schluss dünn. DNA-Spuren von ihm am Tatmesser oder der Kleidung von Daniel H. gab es nicht. Im Grunde fußte die Anklage auf den Aussagen eines Verkäufers aus dem Döner-Imbiss, der gesehen haben will, wie Alaa S. Stichbewegungen gegen Daniel H. ausführte. Vor Gericht äußerte sich der Mann indes nicht mehr so deutlich, sprach nun von Schlagbewegungen. Auch andere Zeugen berichteten nur, dass Alaa S. im Getümmel dabei gewesen sei. Aber Messerstiche von ihm? Das konnte niemand so direkt sagen.

Die Anklage ergehe sich in „Missinterpretationen“

Quelle          :         TAZ       >>>>>           weiterlesen

———————————————————————–

Grafikquellen        :

Oben      —          Karl Marx monument („Nischel“)

Abgelegt unter Gerichtsurteile, Mensch, Sachsen, Überregional | 1 Kommentar »

Sachsen einmal ganz anders

Erstellt von DL-Redaktion am 22. August 2019

Der eigene Weg

Von Sabine Seifert

Nebelschütz, sagt der Dorf­-Bürgermeister, war früher ganz besonders hässlich. Wie es eine Gemeinde geschafft hat, zum Vorzeigeort zu werden.

Es ist Hochsommer, und kein Nebel wird heute den kleinen Ort in der Hügellandschaft zwischen den Feldern verschwinden lassen. Weiß-orange gestrichen, strahlt die barocke Kirche am Hang in der Morgensonne, vergoldete Kruzifixe auf steinernen Säulen stehen an der Dorfstraße.

Nebelschütz (Njebjelčicy) in der Oberlausitz, Sachsen, zwischen Kamenz und Bautzen gelegen, ist sorbisches Siedlungsgebiet und schwer katholisch. In den fast 30 Jahren seit der Wende hat der Ort der Abwanderung und dem wirtschaftlichen Niedergang getrotzt. Hier gibt es solidarische Landwirtschaft, Ökokonto, Hofladen, eine Sozialwerkstatt, einen ökologischen Baustoffhof, drei Biobauern.

Ein Modell- oder Museumsdorf ist Nebelschütz aber auch wieder nicht. Kein Ort, in den am Wochenende die Städter einfallen, keine hippen Cafés, keine Wochenendhäuser, sondern stille Provinz, wo die Pilger auf dem sächsischen Teil des Jakobsweg in der Wanderherberge absteigen.

Wer hier eine Wohnung mieten oder Land erwerben will, kommt auf eine Warteliste. Wer hier mobil telefonieren will, verflucht das Funkloch. Die ehemalige Gastwirtschaft des Ortes ist eine Pension und öffnet ihren Festsaal nur für gebuchte Festivitäten. Es ist verdammt ruhig in Nebelschütz. Seit den neunziger Jahren leben wieder zwei Storchenpaare im Ort.

Keine Idylle, aber ein Dorf mit Zukunft

Nebelschütz ist keine Idylle, aber ein Ort mit Zukunft. Schon früh hat die Gemeinde den Ankauf von Grund- und Flurstücken betrieben. Veranstaltet Pflanzentauschbörsen, treibt den ökologischen Umbau des Dorfes voran. Was hat Nebelschütz, was andere Dörfer nicht haben? Gibt es ein Erfolgkonzept? „Man braucht nicht unbedingt viel Geld“, sagt Thomas Zschornak, Bürgermeister des Orts. „Man muss kreativ sein.“ Vieles sei bei ihm „Bauchgefühl“ gewesen. Wichtig ist ihm: „Wir hatten Beratung.“

Zschornak trägt großen Anteil daran, dass die Gemeinde Nebelschütz heute wieder ein „enkeltauglicher“ Ort ist, wie er es nennt. „Wir waren zu DDR-Zeiten wirklich ein hässliches Dorf“, sagt er. „Die Lebensqualität war katastrophal: Es gab nicht eine gute Straße, keine Wasserleitung, überall Baustellen.“ Rundherum LPGs.

Daraus sind heute Agrargroßbetriebe geworden. Auf etwa 1:10 schätzt Zschornak das Verhältnis von ökologischer und industrieller Landwirtschaft. Das soll sich ändern, die Gemeinde verpachtet gezielt Land an Biobauern. Ihre Höfe befinden sich nicht in Nebelschütz selbst, sondern in einem Nachbardorf, das zur Gemeinde gehört. Die besteht insgesamt aus fünf Dörfern, 1.200 Menschen leben hier. In Nebelschütz selbst sind es 420.

„Das Wichtigste ist, Eigenverantwortung zu übernehmen“, sagt Zschornak. Das Wort fällt oft im Gespräch. „Und man braucht Zeit. Das muss von unten wachsen. Deswegen kommt der Strukturwandel jetzt für viele zu schnell.“ In Nebelschütz wächst es von unten seit 1990, seither ist Zschornak hier nämlich Bürgermeister. Heute ist der Diplomverwaltungswirt 55 Jahre alt, mittelgroß, die grauen Haare trägt er kurz. Noch zu DDR-Zeiten gründete Zschornak eine Bürgerinitiative, die sich gegen die Berieselung der Felder mit Gülle und gegen Massentierhaltung aussprach. Mit Protesten gegen eine Mülldeponie ging es – erfolgreich – nach der Wende weiter.

„Ich musste mich immer einmischen“, sagt Zschornak. Zunächst mischte er mit im Neuen Forum Bautzen, damals im März 1990. Bei den ersten freien Wahlen in der Noch-DDR kandidierte er als Gemeinderat und wurde daraufhin prompt zum Bürgermeister gewählt. Nun ist er in seiner fünften Amtszeit, drei Jahre bleiben noch, danach will er nicht mehr antreten.

Thomas Zschornak ist CDU-Mitglied, auch das seit fast 30 Jahren. „Damals war ich von der CDU überzeugt“, sagt er. Es klingt, als wäre er heute nicht mehr so ganz überzeugt. „Der Staat entfernt sich mehr und mehr von den Bürgern und den Dörfern“, sagt er. Zschornak hat seine Aktivitäten vom Kreistag auf den Serbskij Sejm verlagert, das sorbische Parlament, das sich im November 2018 in Nebelschütz gegründet hat. Dessen 24 Abgeordnete hoffen auf mehr öffentliche Wahrnehmung, Mitsprache und Autonomie zum Beispiel im Bildungswesen. Und manche träumen von einer Minderheitenpartei, die, ähnlich wie die dänische in Schleswig-Holstein, von der Aufhebung der Fünf-Prozent-Klausel profitieren könnte.

Auch Zschornak switcht, wenn er in Nebelschütz unterwegs ist, selbstverständlich zwischen dem Deutschen und dem Sorbischen hin und her, einer westslawischen Sprache, die noch etwa 20.000 Menschen aktiv beherrschen. Die Kindertagesstätte ist deutsch-sorbisch, das Projekt einer freien Schule ist in Planung. Doch nur eine alte Nebelschützerin trägt noch Tracht, erzählt Zschornak.

Ein „steinreicher“ Ort

Die Besucherin aus Berlin holt der Bürgermeister im fünf Kilometer entfernten Kamenz am Bahnhof ab. Noch bevor es in den Ort geht, biegt Zschornaks Wagen zum Miltitzer Steinbruch ab – hier wurde bis zum Jahr 2000 Granit abgebaut. Nach der Schließung erwarb die Gemeinde den Steinbruch, die Grube lief im Lauf der Zeit mit Wasser voll, inzwischen ist der See 19 Meter tief. „Wir sind steinreich“, scherzt Zschornak und zeigt auf kleine und große Skulpturen aus Granit, Holz und Metall, die den See und seine Umgebung säumen.

Quelle        :       TAZ        >>>>>         weiterlesen

—————————————————————

Grafikquellen       :

Oben        —          Nebelschütz, Luftaufnahme (2017)

Unten       —   Nebelschütz – Hauptstraße und Pfarrkirche

Abgelegt unter Kultur, Sachsen, Überregional, Umwelt | Keine Kommentare »

Linke: Basis ist Boss?

Erstellt von DL-Redaktion am 18. August 2019

Die selben Esel ziehen den gleichen Wagen ?

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–142.jpg

Mit unbeweglich stehengebliebenen?

Von Bastian Reichardt

Politiker aus verschiedenen Landesverbänden der Linken werben mit einer Kampagne für einen Mitgliederentscheid über die nächsten Parteivorsitzenden .

Es ist wieder August. Ein Jahr nach der von Sahra Wagenknecht und Oskar Lafontaine angestoßenen Bewegung »aufstehen« füllt sich das politische Sommerloch bei den Linken wieder mit einer basisdemokratisch angepinselten Initiative. Mit der Kampagne „Wir sind Die Linke“ wollen 18 Erstunterzeichner aus verschiedenen Landesverbänden der Partei eine Mitgliederwahl der Parteivorsitzenden herbeiführen. Die als „Vertrauenspersonen“ der Kampagne ausgewiesenen Politiker Dana Moriße (NRW) und Detlef Bimboes (Berlin) sowie viele andere der Erstunterzeichner engagierten sich bis zuletzt noch in der sogenannten „Sammlungsbewegung“ um Wagenknecht.

Dass ausgerechnet dieser Teil der Partei nun eine Debatte um den Umgang mit Personalien führen möchte, hat ein gewisses Geschmäckle. Nicht wenige Mitglieder der Linken vermuteten hinter den Absichten des „aufstehen“-Flügels eine Attacke gegen die Parteivorsitzenden. Die Bewegung „aufstehen“ wurde so als Schlacht im Kampf Wagenknecht gegen Kipping interpretiert. Nun hat Sahra Wagenknecht ihren Rückzug vom Fraktionsvorsitz angekündigt. Im nächsten Jahr wird turnusmäßig der neue Parteivorstand der Linken gewählt. Die Satzung der Partei sieht zwar eine Amtszeitbegrenzung vor, aber dabei handelt es sich lediglich um eine Soll-Bestimmung: Kein Mitglied der Partei soll dasselbe Amt länger als acht Jahre ausüben. Katja Kipping und Bernd Riexinger sind seit 2012 an der Spitze der Partei. Damit trifft diese Regelung auf die jetzigen Vorsitzenden zu. Ob sie aber noch einmal kandidieren, haben beide bisher offengelassen und ist deshalb möglich. Man mag sich des Eindrucks nicht erwehren, dass die neue Kampagne zur Urwahl denselben Zweck verfolgt wie auch schon „aufstehen“.

Kippings Engagement für ein neoliberales Bündnis der Linken mit Grünen und SPD ist mehr als kritisch zu sehen, aber für den derzeitigen Stand der Linken lässt sich auch festhalten: Statt die internen Personaldebatten immer wieder in die Öffentlichkeit zu tragen, muss sich Die Linke eher um ein neues klassenkämpferisches Profil bemühen. Welche Rolle dabei die innerparteiliche Demokratie spielt, ist durchaus offen. Zu den Grundprinzipien der Demokratie gehört zwar, dass jede Stimme das gleiche Gewicht hat. Jedoch ist dies nicht durch eine einfache Urwahl herbeizuführen. Eine Debatte darüber zu führen, ob eine Urwahl der Parteivorsitzenden zu einer Demokratisierung der Partei führt, kann kein Fehler sein. Unter optimalen Bedingungen ist die Wahl der Vorsitzenden durch alle Mitglieder ein Ausdruck gelebter Demokratie. Fest steht aber auch: Optimale Bedingungen herrschen in der Linken nicht. Eine Urwahl zum jetzigen Zeitpunkt würde zu keiner Demokratisierung beitragen.

Quelle      :     Der Freitag        >>>>>          weiterlesen

—————————————————————————-

Grafikquelle       :       Bundesparteitag Die Linke 2018 in Leipzig

Abgelegt unter Berlin, P. DIE LINKE, Überregional | Keine Kommentare »

SPD braucht Querdenker

Erstellt von DL-Redaktion am 18. August 2019

Das fehlende Branding der SPD

Wir brauchten nur ein wenig graben ! Scholz fanden wir nicht !

Von Ulrike Herrmann

Die Sozialdemokratie kann nur überleben, wenn sie das Unmögliche versucht: Sie muss zur Bewegung werden und einen radikalen Neuanfang wagen.

Die SPD ist rettungslos verloren, denn sie ist keine Marke mehr. So zynisch es ist: Auch Parteien funktionieren letztlich wie Bier oder Waschmittel. Es zählt das Image, wenn man Erfolg beim Kunden haben will. Die SPD hat jedoch ihren Markenkern ruiniert. Über die Ursachen ließe sich endlos streiten, aber Umfragen ergeben, dass die meisten Bürger nicht mehr wissen, wofür die SPD steht.

Da die SPD kein Profil besitzt, ist sie überflüssig, zumindest aus der Sicht der Wähler. Auch die nächsten Vorsitzenden werden keine Rettung sein, da alle denkbaren Kandidaten den gleichen Makel teilen: Sie sind nicht neu oder sie sind unbekannt. Das gilt auch für Olaf Scholz.

Die SPD bräuchte aber einen radikalen Neuanfang, um ihr Image aufzupolieren. Sie müsste glaubhaft verkörpern, dass alle Niederlagen und alle politischen Fehlentscheidungen hinter ihr liegen und dass sich die Zukunft nur mit ihr lohnt.

Diese Operation Neuanfang ist nicht leicht, wenn man in der Regierung sitzt, weswegen viele Sozialdemokraten gern in die Opposition wechseln würden. Doch das ist keine Option. Jede Neuwahl würde nur zutage fördern, was sich schon in den Umfragen zeigt: Die SPD würde fast bis zur Bedeutungslosigkeit schrumpfen.

Die Sehnsucht nach einer anderen SPD

Die SPD muss den Neuanfang inszenieren, während sie an der Regierung ist. Diese durchaus widersprüchliche Operation kann funktionieren, wie Emmanuel Macron in Frankreich vorgeführt hat. Die Umstände waren kompliziert und Macron war eher neoliberal. Trotzdem könnte seine Strategie ein Vorbild für die SPD sein: ­Macron war zunächst Wirtschaftsminister unter dem sozialistischen Präsidenten Hollande, der aber keinerlei Chance hatte, wiedergewählt zu werden. Also trat Macron rechtzeitig zurück und gründete seine Bewegung „En Marche“.

File:Bundesarchiv Bild 183-1990-1026-013, Potsdam, SPD-Wahlveranstaltung, Oskar Lafontaine, Manfred Stolpe.jpg

Den anderen die Narrenkappen überziehen und dann laufen, laufen. Weg vor der Verantwortung für welche man gewählt wurde.

So widersprüchlich es klingt: Die SPD kann nur von einem Dissidenten gerettet werden. Kevin Kühnert will diese Rolle nicht ausfüllen, aber das Interesse an seiner Person zeigt, wie groß die Sehnsucht nach einer „anderen“ SPD ist.

Quelle      :        TAZ       >>>>>        weiterlesen

—————————————————————

Grafikquellen      :

Oben      —       Brandt vid SPD:s partikongress i Münster 1988.

——————————

Unten         —        Potsdam, SPD-Wahlveranstaltung, Oskar Lafontaine, Manfred Stolpe

Fotografo
Schindler, Karl-Heinz
Questo file è licenziato in base ai termini della licenza Creative Commons Attribuzione-Condividi allo stesso modo 3.0 Germania.
Flag of Germany.svg
Attribuzione: Bundesarchiv, Bild 183-1990-1026-013 / CC-BY-SA 3.0

Abgelegt unter P.SPD, Positionen, Regierung, Überregional | Keine Kommentare »

netzpolitik.org

Erstellt von DL-Redaktion am 17. August 2019

Warum wir weiterhin darüber aufklären,
wen Maaßens Anhängerschaft retweetet

netzwerk

Quelle          :        Netzpolitik ORG.

An diesem Beitrag haben mehrere Redakteurinnen / Redakteure von netzpolitik.org maßgeblich mitgeschrieben.

Unser Bericht zur Datenanalyse von Hans-Georg Maaßens Anhängerschaft auf Twitter hat bei manchen Menschen Kritik ausgelöst. Deswegen erklären wir, warum wir zum Artikel stehen, warum solche Recherchen in Zeiten des Rechtsrucks wichtig sind und warum wir uns nicht von Klageandrohungen und Shitstorms einschüchtern lassen.

Seit Veröffentlichung des Artikels zum Twitterverhalten der Followerschaft von Hans-Georg Maaßen gibt es anhaltende Kritik. Sie kommt vielfach aus Milieus der AfD und auch von einigen der Menschen, die laut Datenanalyse zu den 100 Accounts gehören, die von Maaßen-Followern am meisten retweetet werden sowie aus deren eigener Followerschaft. Auf diese Kritik wollen wir hier nochmals eingehen. Im Wesentlichen besteht sie aus zwei Punkten:

Zum einen wird uns vorgeworfen, wir würden alle Accounts in einen Topf werfen und sie alle als rechtsradikal bezeichnen. Das stimmt nicht. Die Grafiken ergeben sich aus den offengelegten mathematischen Berechnungen der Daten. Auch die Formeln, die für die mathematischen Berechnungen angewandt wurden, haben wir offengelegt: Nähe und Distanz in der Darstellung der Cluster ergeben sich daraus, welche Accounts zusammen mit welchem anderen Account retweetet werden. Dies ist eine rein numerische Darstellung. Im Text werden zwar einige Accounts explizit als rechtsradikal und/oder rassistisch bezeichnet, es sind solche bei denen es daran keinen Zweifel gibt.

In Bezug auf die übrigen Accounts wird eine derartige Behauptung aber nicht aufgestellt oder ein solcher Eindruck vermittelt. Im Gegenteil: Der Text stellt klar, dass wir beispielsweise den Account von @rolandtichy, der die Liste der meisten Retweets sogar anführt, nicht als rechtsradikal einstufen. Gleiches gilt neben weiteren selbstverständlich für die Accounts von @hallaschka_HH, @alicologne, @MarcFelixSerrao, @kachelmann, @drumheadberlin, @PhilipPlickert, @Arnd_Diringer oder @neythomas, die in den Grafiken auch irgendwo Erwähnung finden. Die Aussage, alle 100 namentlich in den Grafiken erwähnten Accounts seien rechtsradikal, wird im Text nicht getroffen und sollte auch nicht impliziert werden.

Untersuchung, wo sich die Anhängerschaft von Maaßen auf Twitter verortet

Zum anderen wird die Datenanalyse selbst kritisiert. Ist es überhaupt aussagekräftig, welche Accounts die Follower von Hans-Georg Maaßen sonst noch retweeten? Schließlich müssten die 25 meistretweeteten Accounts selbst gar nicht mit dem Profil von Hans-Georg Maaßen interagiert haben, um in seiner Nachbarschaft zu landen – es reicht, die gleichen Fans zu haben. Wir halten die Methodik für geeignet, um einen ersten Eindruck zu bekommen, wo sich die Anhängerschaft von Maaßen auf Twitter verortet.

Natürlich bedeutet nicht jeder Retweet Zustimmung, es kann sich in Einzelfällen auch um kritische Auseinandersetzung handeln. In kommunikationswissenschaftlichen Untersuchungen wird dennoch häufig auf dieses Kriterium zurückgegriffen, denn in der großen Anzahl bedeuten Retweets eben doch Nähe.

Dass die eigenen Tweets von vielen weiterverbreitet werden, die auch offen rechtsradikale und rassistische Accounts retweeten, ist vielleicht kein Zufall. Man kann daraus keine pauschalen Schlüsse ableiten, aber im schlimmsten Fall verweist es auf gemeinsame Ansichten, Narrative, Gegner und Schnittmengen. Diese Nachbarschaft im Netzwerk des einflussreichen Ex-Geheimdienstchefs ist nach unserer Auffassung aber von öffentlicher Relevanz, gerade weil dieser nach seiner behördlichen Karriere nun eine politische Karriere anstrebt.

Für uns ist jedenfalls klar: Über Interpretationen lässt sich streiten, aber wer verhindern möchte, dass wir Schnittmengen in der Followerschaft von Hans-Georg Maaßen benennen, hat ein Problem mit der Pressefreiheit.

Shitstorm und Klageandrohungen um Berichterstattung zu beeinflussen

Wir haben uns in der Vergangenheit oft mit den digitalen Netzwerken der neuen Rechten beschäftigt: Wir haben einen AfD-nahen Scheinriesen-Account aufgedeckt und inoffizielle Unterstützernetzwerke dieser Partei. Wir haben die Hintergründe der Twitterstrategie der AfD beleuchtet und dabei fragwürdige Methoden entdeckt. Die journalistische Auseinandersetzung mit den digitalen Strategien der neuen Rechten ist gerade in Zeiten wichtig, in denen die Demokratie von diesen Kräften stark attackiert wird.

Hans-Georg Maaßen 02.jpg

Wir stehen zu unserem Bericht über die Datenanalyse. Deswegen lassen wir uns weder von Klageandrohungen noch von Shitstorms einschüchtern, die mit persönlichen Angriffen, Beleidigungen und Verleumdungen eine Änderung unserer Berichterstattung einfordern. Beides stellt einen Angriff auf die Pressefreiheit dar.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.

——————————————————————–

Grafikquellen         :

Oben     —        Netzwerk (Symbolbild) Gemeinfrei-ähnlich freigegeben durch unsplash.com Alina Grubnyak

————————————

Unten     —     Hans-Georg Maaßen, Präsident des Bundesamtes für Verfassungsschutz.

Abgelegt unter P.AfD, P.CDU / CSU, Politik und Netz, Überregional | Keine Kommentare »

Partei ohne Erzählung:

Erstellt von DL-Redaktion am 16. August 2019

Die Existenzkrise der SPD

2017-10-11 Simin Arian im Wikipedia-Büro Hannover mit Gerhard Schröder und Claus-Peter-Enders.jpg

Clown ohne Maske – wer seht stärker für den Untergang?

von Felix Butzlaff und Robert Pausch

Man kann dieser Tage den Eindruck bekommen, dass die Sozialdemokraten davon überzeugt sind, ihren dramatischen Niedergang strikt formal und bürokratisch aufhalten zu können: Da wird mit Blick auf den wieder einmal neu zu bestimmenden Parteivorsitz voller Eifer über Doppelspitzen und Einzelbewerber diskutiert, über vorgezogene Parteitage und was diese wohl kosten werden, über Online-Abstimmungen, Regionalkonferenzen und Halbzeitbilanzen. Die Krise der Partei ist historisch – und vielen Mitgliedern ist dies durchaus bewusst –, die Reaktionen aber sind auf fast schon beängstigende Weise normal: keine Richtungsdebatten, kein Grundsatzstreit, nicht einmal ein Wutausbruch. Es herrscht, vornehm gesprochen, eine „narrative Leere“ in der Partei. Die Sozialdemokraten wissen ganz offensichtlich nicht mehr, was sie wollen, und auch nicht mehr, was sie wollen sollen.

Einst verstand es gerade die Sozialdemokratie wie kaum eine andere politische Kraft, ihr Handeln in einen großen Sinnzusammenhang zu stellen. Heute ist sie sprachlos geworden. Ganz offensichtlich hat sie das verloren, was sie einst ausmachte, ihre große Erzählung.

Doch was ist davon heute überhaupt noch zu halten? Ist das Reden von einer politischen Erzählung heute nicht nur noch bloße Nostalgie aus einer Zeit organisierbarer Kollektive, fest geordneter Milieus, mithin aus der Massengesellschaft des 20. Jahrhunderts, die sich im Zuge der Individualisierung längst in Luft aufgelöst hat? Weit gefehlt! Schon in den 1950er Jahren stellte Hannah Arendt fest, dass eine kollektive Politik ohne Erzählung faktisch unmöglich sei. Nur wer eine zukünftige, eine bessere Gesellschaft ausmale und erzähle, sei in der Lage, einen politischen Wandel zu organisieren und als demokratische Alternative Legitimation zu erfahren.

Erzählungen sind aus dieser Perspektive das schöpferische Potential von Politik. Sie eröffnen Möglichkeitsräume und sammeln Mehrheiten. Sie erst strukturieren die politische Wahrnehmung, bieten Leitlinien und Orientierungspunkte und fügen die unverbundenen Pinselstriche des Alltagshandelns zusammen zu einem größeren Bild und einer langfristigen Perspektive. Was aber, lautet dann die entscheidende Frage, macht eine erfolgreiche politische Erzählung letztlich aus?

Erfolgreiche große Erzählungen sind durch drei Charakteristika gekennzeichnet.

Erstens wirken sie sinn- und identitätsstiftend. Menschen drücken mit ihrer Hilfe aus, wer sie sind, woher sie kommen und wohin sie gehen – Erzählungen haben also verschiedene Zeitstrukturen. Menschen und Gemeinschaften erzählen sich ihre Vergangenheit, erklären damit ihre Gegenwart und betonen, was sich wie verändern und was weshalb bleiben soll. Damit sind Erzählungen Diagnose einer aktuellen Lebenslage und zugleich Motivation und Handlungsperspektive für die Zukunft.

Ein zweites Merkmal großer Erzählungen ist, was durchaus überraschen mag, Vielstimmigkeit und Unschärfe. Sie bieten damit den Rahmen für eine Vielfalt an Erzählenden und Erzählsträngen, sind flexibel und anpassungsfähig – sowohl über gesellschaftliche Gruppen als auch über die Zeit hinweg. Denn Erzählungen spiegeln Zeitgefühle und Zeitdiagnosen wider, müssen also permanent verändert und aktualisiert werden.

Drittens muss eine große Erzählung, trotz oder gerade wegen ihrer Unschärfe, kohärent sein. Sie muss einen inneren Z