KRITISCHE INTERNET-ZEITUNG


Archiv für die 'Überregional' Kategorie

kontertext: Online-Zeitung

Erstellt von DL-Redaktion am 22. Januar 2020

Online-Zeitungen – die grosse Versuchung

Datei:Zehlendorf Teltower Damm Kiosk.jpg

Quelle        :       INFOsperber CH.

Von Rudolf Walther

Der Wechsel auf online hat Folgen: weniger Journalisten, weniger Qualität, weniger Lesezeit.

Die Stimmung in der Zeitungsbranche ist etwa so schlecht wie die Meldungen über ihre finanzielle Lage. Der Einbruch der Einnahmen aus Anzeigen dauert an, und die Zahl der Abo-Kündigungen («Abo-kalypse») steigt. Die Antworten darauf sind überall ähnlich: Kürzung des Zeitungsumfangs, inhaltliche Ausdünnung von der Banalisierung bis zur strikten Boulevardisierung («Basler Zeitung», «Tages-Anzeiger», «Frankfurter Rundschau»), Verkleinerung der Redaktionen, Kürzung der Etats für Pauschalisten und «freie» Journalisten, Kooperationsverhältnisse mit anderen Zeitungen, d.h. kostensparendes Nachdrucken. Bevor die Zeitungen ganz eingehen, schwinden Vielfalt und Originalität, kurz: die Qualität.

Je weniger diese gleichsam homöopathisch dosierten Sanierungsmassnahmen wirksam werden, desto mehr werden radikalere Lösungen empfohlen. Der Abschied von der von vornherein hybriden Gratiskultur im Online-Sektor (die unterstellt, Qualitätsjournalismus sei kostenlos) ist längst überfällig. Die Chancen und Risiken von Bezahlschranken (Pay Walls) sind allerdings fast unberechenbar, und die Ergebnisse, soweit sie ehrlich dokumentiert und nicht nur mit wenig aussagekräftigen Klickzahlen frisiert werden, bleiben gelinde gesagt durchzogen bis enttäuschend.

Als letzte Station vor dem Aus empfehlen Berater und Sanierer die Amputation, d.h. den ganzen oder teilweisen Verzicht auf Printausgaben. Am Beispiel des vollzogenen Verzichts auf die Printausgabe beim «Guardian» und beim «Independent» und der für 2022 ins Auge gefassten Einstellung der Printausgabe bei der «tageszeitung» (taz) werden die tatsächlichen bzw. zu erwartenden Folgen sichtbar.

Beispiel «Guardian» und «Independent»

Der 1821 gegründete «Manchester Guardian» erscheint seit dem Umzug nach London als «Guardian» und wurde jahrzehntelang vom Scott-Trust (benannt nach dem schwerreichen langjährigen Chefredakteur P.C. Scott) über Wasser gehalten. Trotz des Erfolgs herausragender Reportagen, etwa über die Folter im Irak, die Geschäftspraktiken von «Cambridge Analytica» oder die Snowden-Papiere, blieb das Blatt immer defizitär – am Schluss mit über 50 Millionen Pfund pro Jahr. Mit der neuen Chefredakteurin Katharina Viner wagte die das angesehene Blatt tragende Stiftung 2017 einen radikalen Kurswechsel – die Ergänzung der Printausgabe mit einer teuren Investition in die digitale Ausgabe. Dafür wurden etwa 100 IT-Fachleute eingestellt. Die digitale Ausgabe ist frei zugänglich, und die Auflage der Print-Ausgabe liegt heute bei rund 140’000 Exemplaren (2005 waren es noch 400’000 Exemplare). Der digitale «Guardian» hat heute mit seinen England-, Australien- und USA-Ausgaben täglich 160 Millionen «Leser», wenn man die Mitglieder der ziemlich unübersichtlichen «Klick-Community» 1:1 in Leser umrechnet. Diese Community spendet freiwillig für die Nutzung, sofern die Nutzer nicht zu den 200’000 Premium-App- Abonnenten mit rund 7 Pfund pro Monat gehören.

2018 erwirtschaftete der «Guardian» erstmals nach Jahrzehnten 800’000 Pfund Gewinn, nachdem unter dem Vorgänger vom Katharina Viner noch 80 Millionen Pfund für eine eigene Druckerei versenkt worden waren. Der Erfolg der Strategie Viners, die von sich sagt, «ich bin ein Allesfresser, wenn es um Informationen und Nachrichten geht», wurde bezahlt mit einer Banalisierung und Boulevardisierung der Print- und der Digitalausgabe.

Eine empirisch einwandfreie Studie zur Umstellung des «Independent» von der Print- auf eine digitale Ausgabe ergab, dass Printleser die Zeitung etwa fünfmal länger lesen als Nutzer der Netzausgabe – nämlich 37 statt 7 Minuten. Neben diesen Aufmerksamkeits- bzw. Wahrnehmungsverlusten fallen auch die Kollateralschäden bei der Umstellung ins Gewicht. Beim «Guardian» entfielen durch die Teilumstellung die Stellen von 330 Angestellten und von 120 Redaktionsmitgliedern. Beim «Independent» wurde die Redaktion von 200 Mitgliedern auf 110 fast halbiert. Zwiespältig ist die finanziell erfolgreiche Umstellung des «Independent», weil sie auf dem Wachstum des digitalen Anzeigengeschäfts beruht sowie Lohnsenkungen für die Restbelegschaft. Mit publizistischer Qualitätssicherung hat beides – das Anzeigengeschäft und die Lohnkürzungen – nichts zu tun.

Die «taz» vor der Entscheidung

Im Umfeld der Veranstaltungen zum 40-jährigen Bestehen der «taz» wurde bekannt, dass für 2022 über die Einstellung der Printausgabe nachgedacht wird. Die Zeitung wird von der seit 1992 bestehenden Genossenschaft mit heute knapp 20’000 Mitgliedern getragen. Die Anteile von 500 bis 100’000 Euro gewähren ein vom Zeichnungsbetrag unabhängiges, egalitäres Stimmrecht. Diese Konstruktion macht das Blatt doppelt unabhängig – von den Geldgebern und vom schwankenden und schwindenden Anzeigenmarkt. Dies erklärt auch, warum die Zeitung heute so etwas wie ein Solitär bildet in der Branche.

Der langjährige Geschäftsführer Karl-Heinz Ruch verabschiedete sich in den Ruhestand mit der Prognose: «Das Zeitalter der gedruckten Zeitung ist zu Ende, der Journalismus lebt weiter im Netz». Es fragt sich natürlich, welche Art von Journalismus auf welchem Niveau weiterlebt. Auch die «taz», die wie der «Guardian» keine Bezahlschranke kennt, setzt auf freiwillige Spenden von Nutzern der Online-Ausgabe. Dadurch soll nach nicht überprüfbaren Angaben monatlich eine fünfstellige Summe zusammenkommen. Es gibt keine akuten Gründe, die Print-Ausgabe einzustellen. Nach vielen Krisen schreibt die taz mit einer Auflage von 50’000 Exemplaren, davon 27’000 Abonnenten, seit 2008 schwarze Zahlen.

Damit ist die taz die mit Abstand kleinste der wenigen überregionalen Zeitungen in der BRD. Um den Status eines landesweit wahrgenommenen Blattes zu erhalten und zu stärken, könnte der Ausbau der digitalen Ausgabe auf Kosten der Print-Ausgabe, die 2022 eingestellt würde, ein rationales Kalkül sein. Über die Frage, wie realistisch dieses ist, lässt sich jedoch nur spekulieren. Ein Hauch von Druck, auf die Printausgabe zu verzichten, kommt von zwei anderen Seiten – von den Vertriebskosten und vom Durchschnittsalter der Abonnenten.

Die hohen und tendenziell steigenden Vertriebskosten und die Unwägbarkeiten der Vertriebssysteme, deren Träger unrentable Regionen lieber heute als morgen «vergessen» lassen würden, sowie der unabsehbaren Kosten und Zumutungen der Postzustellung könnten die Geschäftsführung in Zukunft zu einem radikalen Schnitt zwingen. Dasselbe gilt für die Abonnenten der Printausgabe. Deren Durchschnittsalter liegt bei 57 Jahren, während die Besucher der Website im Durchschnitt nur 35 Jahre alt sind. Die Frage, ob man die Zeitung lieber im Netz, auf dem Smartphone oder Tablet oder auf Papier lese, ist keine nach Lesegewohnheiten, sondern nach dem Alter. Und sie könnte zum Sargnagel für die Printausgabe der «taz» werden.


 Themenbezogene Interessen (-bindung) der Autorin/des Autors

Rudolf Walther: Historiker, freier Journalist für deutsche und Schweizer Zeitungen und Zeitschriften, wohnhaft in Bad Soden a.T. in der Nähe von Frankfurt.

Unter «kontertext» schreibt eine externe Gruppe Autorinnen und Autoren über Medien und Politik. Sie greift Beiträge aus Medien auf und widerspricht aus politischen, journalistischen, inhaltlichen oder sprachlichen Gründen. Zur Gruppe gehören u.a. Bernhard Bonjour, Rudolf Bussmann (Redaktion, Koordination), Silvia Henke, Mathias Knauer, Guy Krneta, Alfred Schlienger, Felix Schneider, Linda Stibler, Martina Süess, Ariane Tanner, Rudolf Walther, Christoph Wegmann, Matthias Zehnder.


© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.


Grafikquell         —      Berlin Zehlendorf. Der Kiosk wurde 1955 von Kurt Kurfiss erbaut. Er steht Ecke Potsdamer Straße neben dem Taxenstand.

Urheber Clemensfranz      /   Quelle     —    Eigenes Werl


Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Kultur, Medien, Politik und Netz, Überregional | Keine Kommentare »

Atomgegnerin gewinnt

Erstellt von DL-Redaktion am 22. Januar 2020

Atomkraftgegnerin gewinnt Verfassungsbeschwerde um Schmerzensgeldklage

Quelle        :         Scharf  —  Links

Von Eichhörnchen

Die in Lüneburg lebende Atomkraftgegnerin Cécile Lecomte hat eine Verfassungsbeschwerde, bei der es um eine Klage um Schmerzensgeld nach einer Freiheitsentziehungsmaßnahme geht, gewonnen.

Cécile Lecomte war im April 2016 nach einer Kletteraktion gegen einen Urantransport von Hamburg nach Narbonne (Frankreich) in Buhholz in der Nordheide in Gewahrsam genommen worden. Das Amtsgericht und das Oberlandesgericht erklärten die Ingewahrsamnahme für rechtswidrig.

Cécile Lecomte verklagte daraufhin die Polizeidirektion Lüneburg auf Schmerzensgeld.

Das Landgericht Lüneburg lehnte die Prozesskostenhilfe ab, mit der Begründung, die Polizei habe bereits 100 Euro Schmerzensgeld gezahlt, die Klägerin habe keinen Anspruch auf ein höheres Schmerzensgeld, die Klage habe keine Aussicht auf Erfolg. Das OLG Celle Celle folgte der Entscheidung des Landgerichtes. Cécile Lecomte reichte daraufhin Klage vor dem Bundesverfassungsgericht ein.

Das Gericht hob nun die Entscheidung aus Lüneburg auf.

„ich freue mich über die Entscheidung, das ist immerhin die dritte Verfassungsbeschwerde, die ich gewinne! Nun kann mit der neuen Entscheidung das Verfahren vor dem Landgericht weiter gehen“ erläutert Lecomte.

„Vor dem Landgericht herrscht bei Amtsanhaftungsklagen Anwaltszwang. Wer kein Geld hat, kann nur klagen wenn Prozesskostenhilfe bewilligt wird. Das Landgericht lehnte diese aber ab. Das Bundesverfassungsgericht sieht darin eine Verletzung des Anspruchs auf Rechtsschutzgleichheit (Grundrecht aus Artikel 3 Absatz 1 in Verbindung mit Artikel 20 Absatz 3 des Grundgesetzes)“ so Lecomte weiter.

Das Bundesverfassungsgericht begründet seine Entscheidung damit, dass die Schmerzensgeldklage durchaus Aussicht auf Erfolg hat.

“ […]erkennbar ist jedoch nicht, dass angesichts unbestrittener erschwerender Umstände völlig außerhalb eines denkbaren Rahmens sei, ein höheres Schmerzensgeld als 100,00 Euro zu verlangen. Damit hat das Landgericht die Frage nach der Höhe des angemessenen Schmerzensgeldes in das Nebenverfahren vorverlagert und der Beschwerdeführerin die Chance genommen, ihre Auffassung in der mündlichen Verhandlung und in einer zweiten Instanz weiter und nun anwaltlich unterstützt zu vertreten. “ so das Bundesverfassungsgericht in seiner Entscheidung, Az. 1 BvR 2666/18

In einem Blogbeitrag gibt Cécile Lecomte ihre Erfahrung anderen Betroffenen weiter und erläutert, wie Aktivist*innen Schmerzensgeld nach rechtswidrigem polizeilichem Gewahrsam erkämpfen können.

„Schmerzensgeld macht das Geschehen nicht wieder gut. Das System, das Menschenverachtung und Umweltzerstörung möglich macht, bekämpfe ich nach wie vor.  Die Sache mit dem Schmerzensgeld ist lediglich ein kleineres Übel im System. Damit finanziert die Polizei aber immerhin – unfreiwillig – die nächsten Aktionen!“ so Lecomte

Weitere Informationen

– Entscheidung vom Bundesverfassungsgericht Az. 1 BvR 2666/18

– Blogbeitrag von Cécile Lecomte zu Schmerzensgeld:

– Gerichtliche Entscheidung zum rechtswidrigen Gewahrsam in Buchholz

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle         :   Scharf – Links      /  Bildmontage HF

Abgelegt unter APO, Niedersachsen, Überregional, Umwelt | Keine Kommentare »

AKL – Bundesmitgliedervers.

Erstellt von DL-Redaktion am 21. Januar 2020

Nein zur Privatisierung der Berliner S-Bahn:

Flag of Die Linke.svg

Quelle       :     AKL

Resolution der AKL-Bundesmitgliederversammlung, Berlin, 12.01.2020

Diese Ausschreibung muss sofort gestoppt werden!

Die Bundesmitgliederversammlung der Antikapitalistischen Linken (AKL) lehnt die Ausschreibung von S-Bahn-Betrieb und -Instandhaltung unter  Rot-Rot-Grün in Berlin kategorisch ab und fordert ihren sofortigen Stopp. Die S-Bahn wurde in den letzten Jahrzehnten auf Verschleiß gefahren. Personalabbau, die Schließung von Werkstätten und die Verlängerung von Wartungsintervallen haben die S-Bahn in die Krise geführt. Die S-Bahn wurde kaputtgespart, um die Profite der Deutschen Bahn AG zu erhöhen. Nun soll der Kurs des Wettbewerbs mit noch mehr Wettbewerb bekämpft werden, indem zwei Drittel des S-Bahn-Betriebs (Nord-Süd-Strecken und Ost-West-Strecken) für jeweils 15 Jahre und die Beschaffung und Instandhaltung neuer Züge in einer öffentlich-privaten Partnerschaft  (ÖPP) für 30 Jahre ausgeschrieben werden. Zugbetreiber auf unterschiedlichen Strecken führen jedoch nicht zu mehr Effizienz, sondern vergrößern Chaos und Verwaltungsaufwand und bedeuten einen Rückfall ins 19. Jahrhundert der Länder- und Lokalbahnen.

Im schlimmsten Fall führt das zur Teilprivatisierung verschiedener Strecken und der Instandhaltung. Es droht damit eine Aufsplittung des integrierten S-Bahn-Betriebs: zu Lasten der Kolleg*innen und der Fahrgäste. Maßgeblich vorangetrieben wird der Prozess vom grünen Verkehrssenat unter Regine Günther. DIE LINKE konnte die von den Grünen befürwortete zwingende Aufsplittung der Strecken zwar verhindern, die Zerschlagung des Netzes ist jedoch weiterhin möglich. Rot-Rot-Grün unterstützt Fremdanbieter sogar bei ihrer Bewerbung: Auf Landeskosten soll für sie eine neue große Werkstatt für Instandhaltung gebaut werden. Mal wieder werden Verluste sozialisiert und Gewinne privatisiert: Für einen zwei- bis dreistelligen Millionenbetrag werden hier öffentliche Gelder für Parallelstrukturen verschleudert, die für wichtige Ausbauprojekte fehlen. Auch in Zeiten der größten weltweiten Klimaschutzbewegung setzt eine Teilprivatisierung des S-Bahn-Betriebs die S-Bahn auf das völlig falsche Gleis.

Wir fordern DIE LINKE im Senat auf, sich öffentlich gegen die Ausschreibung zu stellen und zu erklären, dass es mit der LINKEN keine Privatisierung des S-Bahn-Betriebs geben wird. Wenn Grüne und SPD blockieren, muss DIE LINKE die Koalition in Frage stellen. Ziel muss eine integrierte S-Bahn in öffentlichem Eigentum sein, die nicht privatrechtlich geführt wird, sondern einer demokratischen Leitung und Kontrolle durch Vertreter*innen der Belegschaft, Gewerkschaft, Fahrgast- und Umweltverbände und den betroffenen Regierungen (Bund, Berlin und Brandenburg) unterstellt ist. Die ausgelagerten Teile der S-Bahn (u.a. Reinigung, Ausbildung, Personaldienstleitungen) müssen wieder in den Mutterbetrieb integriert werden.

Die AKL bekräftigt darüber hinaus die Forderung nach Nulltarif im öffentlichen Personennahverkehr und den massiven Ausbau des Streckennetzes. Für diese Forderungen kämpfen wir innerhalb der LINKEN, der Gewerkschaften und der Klimabewegung.

akl - Antikapitalistische Linke


Grafikquellen       :

Oben     —           Flag of Die Linke, political party in Germany

  • Public DomainThis image contains content which may be subject to trademark laws.view terms
  • File:Flag of Die Linke.svg
  • Created: ‎04‎ ‎July‎ ‎2018  


Unten       —        Berlin –  Alexanderplatz

  • Public Domainview terms
  • File:Berlin SBahn Alex west.jpg
  • Created: ‎01‎ ‎April‎ ‎2006

Abgelegt unter Berlin, P. DIE LINKE, Sozialpolitik, Überregional | 2 Kommentare »

Vorlage für Parteivorstand

Erstellt von DL-Redaktion am 19. Januar 2020

Anmerkungen zur Vorlage für Parteivorstand
Das LINKE Konzept für einen demokratischen Sozialstaat

Flag of Die Linke

Quelle          :         AKL

von Thies Gleiss

Die LINKE hat auf einer Gremiensitzung am 11. Januar einen Text mit dem Titel „Das LINKE Konzept für einen demokratischen Sozialstaat der Zukunft“ angenommen. Der Wortlaut findet sich hier:

Lucy Redler und ich haben diesen Text abgelehnt. Thies Gleiss hatte zur Sitzung einen schriftlichen Beitrag zur Kritik vorgelegt.

Auf vielfachen Wunsch soll er hier veröffentlicht werden.

Ich lehne diesen Text ab. Das wurde bei der ersten Debatte im Parteivorstand über die Rudimente eines solchen Textes ja schon deutlich. Wir haben im Erfurter Programm und in diversen Wahlprogrammen mehrfach unseren Katalog von sozialpolitischen Forderungen vorgetragen. Niemand identifiziert die LINKE mit anderen sozialpolitischen Inhalten.

Was in der steten öffentlichen Debatte ist, sind nicht diese Forderungen, die nicht schöner oder unansehnlicher werden, wenn sie um weitere ergänzt oder um einige gekürzt werden, sondern wie das Grundkonzept, das hinter solchen Forderungen steht, politisch durchgesetzt werden kann und welches gesellschaftliches Prinzip das bestehende ablösen soll.

Wir sollten deshalb unter dem Titel „Konzept…“ eine solche strategische Positionsbestimmung vornehmen. Das wäre gleichermaßen Bestätigung und Ergänzung unserer bisherigen Forderungen und Positionen.

Der Begriff „Sozialstaat“ ist kein linker Begriff, sondern ein sozialdemokratischer und auf Klassenzusammenarbeit ausgerichteter Begriff, wenngleich die einzelnen konkreten Inhalte einer staatlichen Sozialpolitik von den Linken natürlich aufgegriffen, verteidigt und erweitert werden. Die sozialen Bewegungen, wenn sie nicht nur sozialdemokratische Ideologie reproduzieren, benutzen „Sozialstaat“ auch nur als Anklage an diejenigen, die mit Spar- und Anti-Reformpolitik soziale Rechte und Errungenschaften beschneiden wollen und in der Regel gegen ihre eigenen moralischen Bekundungen verstoßen.

Ein linker Begriff wäre – wenn nicht das bewährte Wort „Sozialismus“ benutzt werden soll oder kann – die Idee einer „Solidarischen Gesellschaft“ als Alternative zu der unsolidarischen Klassengesellschaft des Kapitalismus. Diesen Begriff zu verwenden wurde auf der PV-Sitzung ja auch vorgeschlagen, von mir und auch von Daniela Trochowski.

Ein weiterer linker Begriff wäre ein Kanon von sozialen Rechten, für deren weltweite Einlösung gesellschaftliche Kämpfe und Bewegungen erforderlich sind.

Der Text eiert in dieser Frage gleich zu Beginn los, um dann auf Seite 2 in den Zeilen 26-27 vollends von einem „neutralen Staat“ auszugehen, der von links zu gestalten und zu benutzen sei. Dieses uralte Bild von Staat als Fahrrad, mit dem in beliebige Richtungen gefahren werden kann, ist ja auch von Harald Wolf schon mal kritisiert worden, vor ihm und ebenfalls auf dem Hintergrund realer Regierungserfahrung durch die linken GRÜNEN.

Das taucht dann immer wieder auf: Zeile 60ff; Zeile 80ff, Zeile 89ff;

Das Konzept einer Solidarischen Gesellschaft muss von uns im Gegensatz zu dieser etatistischen Orientierung als ein Projekt der Selbstermächtigung und der Wiederaneignung erklärt werden. Wir wollen die Warenproduktion und die Regulierung über den Markt immer weiter zurückdrängen zugunsten einer demokratisch geplanten Gebrauchswerteproduktion. Deshalb ist für uns der Privatbesitz an Produktionsmitteln als dominierendes gesellschaftliches Prinzip nicht hinnehmbar. Wir wollen Markt und Privatbesitz in allen das Leben der Menschen und die Natur maßgeblich beeinflussenden Sektoren immer mehr abschaffen. Das wird nicht ohne Konflikte und Kämpfe gehen, für die wir die Stärkung der politischen Rechte und Kampfmöglichkeiten der Arbeiter*innenklasse und ihrer Organisationen systematisch ausbauen wollen. Wir kämpfen für Wiederaneignung von Würde, Zeit, Zukunft und Wohlstand für die Menschen, denen all das vom Kapitalismus genommen wird – nicht als Unfall oder Krise, sondern als Normalzustand dieser Wirtschaftsordnung.

Gerade die drohende Klimakatastrophe zeigt, dass dabei sehr schnell und sehr radikal in die herrschende Eigentumsordnung eingegriffen werden muss. Es ist Tagespolitik und nicht ein von den kleinen Reformen getrenntes, weit entferntes Endziel.

Eine solche solidarische Gesellschaft kann sicher nicht durch die bestehenden nationalstaatlichen Grenzen beschränkt werden. Sie ist konkret, internationalistisch und nicht auf Versöhnung mit den bestehenden Verhältnissen, sondern auf deren weltweite Überwindung orientiert.

Zu den vielen konkreten Forderungen in dem Papier ist nicht viel zu sagen, außer, dass sie nicht entsprechend einer solchen Kampforientierung geordnet werden.

– Wir wollen die Lohnquote erhöhen. Das ist der zentrale Inhalt unserer Forderungen nach besseren Löhnen, Transferzahlungen und Renten. Das ist die zentrale Achse der Wiederaneignung von Einkommen.

– Wir wollen die Zeit, in der das Kapital die Arbeitskraft ausbeuten kann, reduzieren. Wir sind deshalb für radikale Arbeitszeitverkürzungen für alle und zwar täglich, wöchentlich, jährlich und bei der Lebensarbeitszeit. Das ist für uns die zentrale Achse der Wiederaneignung von Zeit, die wir für Sorgearbeit, Bildung und gesellschaftspolitische und kulturelle Teilhabe zur Verfügung haben wollen.

– Wir wollen umfängliche demokratische Rechte, insbesondere ohne Überwachung und für politische und gewerkschaftliche Selbstbestimmung, Das ist für uns die zentrale Achse der Wiederaneignung von Würde.

– Wir wollen eine weltweite solidarische und gewaltfreie Politik, ohne Rüstung, Armeen und Kriege. Das ist für uns die zentrale Achse der Wiederaneignung von Zukunft für uns und unsere Kinder.

Der bestehende Staat, selbst wenn er wieder sozialer werden würde, was aus guten Gründen der realen kapitalistischen Entwicklungsgeschichte nicht freiwillig geschehen wird, ist ein Klassenstaat. Wir wollen ihn überwinden zugunsten einer sich selbst organisierenden und demokratischen Gesellschaft.

Das müsste als Essenz eines Papiers zur Zukunft des Sozialstaats erkennbar sein. Der vorliegende Entwurf bemüht sich noch nicht einmal darum, sondern erzeugt Illusionen.

Der reale Stand der Klassenkämpfe und der Zeitpunkt des Jahreswechsels wären ein guter Rahmen für eine dementsprechende Weiterentwicklung der Positionen der LINKEN.

01.01.2020  Thies Gleiss

akl - Antikapitalistische Linke


Grafikquelle       :            Flag of Die Linke

  • Public DomainThis image contains content which may be subject to trademark laws.view terms
  • File:Flag of Die Linke.svg
  • Created: ‎04‎ ‎July‎ ‎2018   


Abgelegt unter Berlin, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Auto heute – Bahn morgen ?

Erstellt von DL-Redaktion am 17. Januar 2020

Das Auto ist als Verkehrsmittel ungeschlagen

Datei:DBpza rdgost.jpg

Von Svenja Bergt

ürzlich vor dem Sitz eines mittelständischen Unternehmens im Berliner Zentrum: Drei Mitarbeiter:innen gehen zu ihrem mutmaßlichen Dienst-BMW, sie unterhalten sich über einen bevorstehenden Termin in München und die Frage, ob sie es pünktlich bis 18 Uhr schaffen werden. Es ist kurz vor 12 Uhr mittags, ein Wochentag. In einer halben Stunde würde der ICE ab Berlin Hauptbahnhof fahren – um 17.01 wären sie in München.

Es ist unwahrscheinlich, dass diese Information für die drei einen Unterschied gemacht hätte. Denn selbst wenn sie mit dem Auto im Stau stehen und erst mit Verspätung in München ankommen – alles andere wäre genau nach ihren Vorstellungen gelaufen. Im Auto ist es genauso kalt oder warm, so verraucht oder nach Wunderbaum riechend, so podcastbeschallt oder weihnachtsmusikverdudelt, wie sie es sich wünschten. Sie können genau dann Rast machen, wenn ihnen nach etwas zu essen ist, und wären nicht davon abhängig, ob die Mikrowelle im Bordbistro heute Lust auf Dienst hat. Und sie können sich über private und geschäftliche Dinge unterhalten, ohne Angst davor zu haben, dass fremde Ohren mithören und Firmeninterna nicht mehr ganz so intern sind.

Es gibt wunderbare Forschung rund um die Frage, warum öffentlicher Personennahverkehr nur so mittelbeliebt ist. Eines der zentralen Probleme aus Sicht des einzelnen Passagiers: die anderen Passagiere. Sie stinken und pöbeln und schmatzen, sie hören zu laut Musik und dazu die falsche, sie nehmen zu viel Raum ein, und wenn sie aussteigen wollen, drücken sie vorne mit dem aus Diebstahlschutzgründen auf den Bauch geschnallten Rucksack und schlagen sich parallel dazu eine Schneise mit dem Regenschirm.

Die anderen Passagiere, das ist etwas, das man nur gelindert bekommt, mit intelligentem Innendesign der Fahrzeuge. Eine Choreografie aus Sitzen, Trennwänden, Gängen und Haltestangen, die natürliche Abstandsfaktoren einbaut und das größtmögliche Gefühl eines eigenen, sicheren Bereichs vermittelt. Aber die Vorstände solcher Unternehmen interessiert das nicht primär, sie wollen lieber proppenvolle Busse und Züge und bevorzugen selbst den Dienst-Mercedes. Ja ist doch so.

Das Auto ist als Verkehrsmittel ungeschlagen. Aus individuell-egoistischer Sicht ist es das Bequemste, was derzeit möglich ist. Es gibt Menschen, die lagern einen Teil ihres Haushalts in den Kofferraum aus, immer das, was gerade keinen Platz in der Wohnung findet. Andere haben ständig die Sporttasche dabei, wieder andere einen fertig gepackten Koffer. Es könnte schließlich sein, dass es spontan nach Sevilla geht oder nach Paris. Oder zumindest nach Würzburg.

Citroën Jumpy 2007 silver vr TCE.jpg

Das Auto ist, bei allem Postmaterialismus, immer noch ein Freiheitsversprechen. Das zeigt schon das wachsende Segment von Wohnwagen und ausgebauten VW-Bussen. Wer das nicht glaubt, geht auf eine einschlägige Reisemesse. Oder auf Instagram, wo die Busse mit Meerblick im Sonnenuntergangslicht inszeniert werden. Das Auto ist die Antwort der industrialisierten Welt auf den selbst verursachten Dichtestress.

Diese ungeschlagene Position des Autos zu verstehen ist nicht gerade angenehm. Besonders nicht für Menschen, die davon ausgehen, dass überzeugte Autofahrer:innen mit einer Jahreskarte für die Bahn oder mit einem guten E-Bike schon umzustimmen sind. Aber es ist wichtig, die Spitzenposition anzuerkennen, wenn es darum geht, die dringend notwendige Verkehrswende anzugehen.

Quelle        :        TAZ          >>>>>        weiterlesen


Grafikquellen           :

Oben       —      

BeschreibungDBpza rdgost.jpg
Urheber RsVe     —  Quelle    :    Eigenes Werk

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.


Unten       —        Citroën Jumpy 2007

Abgelegt unter Energiepolitik, Positionen, Überregional, Umwelt | 1 Kommentar »

Vom Rath-aus-Ravensburg

Erstellt von DL-Redaktion am 17. Januar 2020

Ein Mittel zur Steigerung des politischen Verstand

Ein Beitrag von Stefan Weinert, D – 88212 Ravensburg


Sehr geehrte Dame, sehr geehrter Herr,

Sie haben sich für POLLITTICCUM entschieden, wozu wir Sie herzlich beglückwünschen. Bitte nehmen Sie – wenn nicht anders verordnet – täglich eine Tablette vor dem Frühstück. Dieses Medikament  unterstützt und fördert Ihre Machtpotenz und lässt Sie mehr und mehr zum Politprofi werden. Allerdings hat POLLITTICCUM nur unterstützende Wirkung, weshalb Sie unbedingt Folgendes beachten sollten:
1. Geben Sie Fakten und Informationen nur in der Art und Weise heraus, dass Sie damit zwar Ihre politischen/wirtschaftlichen Zwecke erreichen, der Bürger (m/w) letztlich aber nicht wirklich umfänglich informiert ist (keine Integrität der Informationen).
2. Kommunizieren Sie Sachverhalt so, dass diese vom Bürger nicht nachprüfbar sind. Das geschieht am besten, in dem Sie stattdessen Wunschbilder propagieren, in denen Wahrheit und Phantasie geschickt vermischt werden.
3. Einem Erfolgszwang aufgrund Ihrer „Versprechungen“ entgehen Sie am besten damit, in dem Sie sich für den Fall „dass“, leicht eingängige Parolen  notieren, die von Ihnen ablenken. POLLITTICCUM hilft Ihnen, bei Ihren Täuschungsmanövern, nicht auch noch der Selbsttäuschung zu erliegen (klinisch getestet).
4. Denken Sie daran, dass unsere Demokratie immer mit Macht und Wahlerfolg gekoppelt ist. Wenn sie also wider die Vernunft handeln müssen, um zwar kurzfristigen Erfolg zu haben, sich aber gleichzeitig über die lang wirkenden Schäden bewusst sind, dann stellen Sie sich nachträglich ganz rational immer als „das kleinere Übel“ gegenüber den Konkurrenten dar.
5. Zwar hat die Demokratie die „Grafen und Fürsten“ abgeschafft, doch „tickt“ der Bürger immer noch im alten Denken. Er will den Politiker als das persönliche Ideal, und nicht als Objekt der Kritik. Demnach müssen Sie mit allen speziellen psychologischen Mitteln eine Regression auf die voraufklärerische fraglose Autorität herstellen.
6. Machen Sie sich unbedingt die unserer Gesellschaft innewohnende Ideale verbal und schriftlich fixiert zu Nutze – aber identifizieren Sie sich keinesfalls tiefgehend mit ihnen.
7. Seien Sie immer ein Positivist. Überzeichnen Sie das (Loben über den“Klee“), was sich gerade aktuell als die beste Lösung eines bestimmten Problems anbietet. Kommt es dann zu Veränderungen der Verhältnisse, die einer Revision Ihrer vorherigen Meinung bedürfen, dann verweisen Sie auf die nun „objektiv sich veränderten Verhältnisse.“ Damit entgehen Sie Ihrer eigenen Desavouierung und stellen im Gegenteil Ihre vorherigen Kritiker bloß.
In Summa: Es ist nicht Ihre Aufgabe, sich mit den Inhalten der eigenen Politik auf Gedeih und Verderb zu  identifizieren, sondern möglichst effektvoll
die eigene Person in jeder Lage retten zu können.
Achtung. Dieses Medikament und den  Beipackzettel vor dem Bürger (m/w) fern halten!
Ihr Stef-Art-Team
Empfohlene Literatur: „Die Unfähigkeit zu trauern“ – Alexander und Margarete Mitscherlich
Grafikquelle        :    Privat   —    Stefan Weinert

Abgelegt unter APO, Baden-Württemberg, Feuilleton, Überregional | Keine Kommentare »

Arbeitsplan der AKL

Erstellt von DL-Redaktion am 16. Januar 2020

Arbeitsplan der AKL für das erste Halbjahr 2020

Parteitages der Partei DIE LINKE 2019, Bonn.2.jpg

Quelle        :      AKL

Dieser Arbeitsplan wurde von der Bundesmitgliederversammlung am 12.01.2020 in Berlin beschlossen.

1. Die Vertreter*innen der AKL im Parteivorstand beantragen bei der Sitzung des Vorstands am 25./26.1. erstens die Durchführung einer großen Aktiven-Konferenz für Beschäftigte im Krankenhaus und der Altenpflege im zweiten Halbjahr und zweitens die Beteiligung an der Mobilisierung zu den Protesten gegen die Gesundheitsministerkonferenz am 17. Juni in Berlin.

2. AKL-Mitglieder mischen sich in die Strategiedebatte ein. Wesentliche Themen für uns sind:

  • die Demokratisierung der Partei durch drei konkrete Vorschläge zur Einführung eines Facharbeiter*innenlohns für Mandatsträger*innen, einer Neuregelung zur stärkeren Trennung von Amt und Mandat sowie der Herstellung des Primats der Partei über die Fraktionen in Bund und Ländern;
  • die Verhinderung einer Neuauflage der Regierungs-Debatte auf Bundes-, aber auch auf Länderebene und stattdessen unsere Vorstellung einer Veränderung durch Opposition und verbindende Klassenpolitik;
  • ein konzeptioneller Vorschlag für eine Kampagne zur Unterstützung der Kolleg*innen und ihrer Forderungen in der Tarifrunde Nahverkehr. Dazu soll begleitend offensiv die Forderung nach Nulltarif im ÖPNV propagiert werden. Dabei muss betont und erklärt werden, dass ein solcher Nulltarif nicht auf Kosten von Löhnen, Arbeitsbedingungen und Arbeitsplätzen im ÖPNV gehen darf, sondern steuerfinanziert umsetzbar ist. Ggf. müssen die Gewerbesteuern und Steuern auf Gewinne und Vermögen drastisch erhöht werden;
  • Vergesellschaftung und Konversion von Klimakillern (Energiekonzerne, Autoindustrie) bei Einkommensgarantie für alle Beschäftigten, zudem werden wir uns hierbei ebenso für eine radikale Verkürzung der Arbeitszeit bei vollem Lohn- und Personalausgleich als Vorbedingung für einen sozial-ökologischen Umbruch einsetzen;
  • die AKL erarbeitet weitere konkrete Vorschläge zu den Kampagnen zu Mieten und Pflege;
  • die Themen internationale Solidarität und Antimilitarismus sollen stärker in den Fokus der Politik gerückt werden; des Weiteren werden wir uns an den Protesten gegen Defender 2020 beteiligen.

Wir setzen uns dafür ein, dass linke Gewerkschafter*innen, Bewegungsaktive und Vertreter*innen unserer Strömung angemessen auf den Podien der Strategiekonferenz im 29.2./1.3.2020 in Kassel berücksichtigt werden.

3. Wir setzen uns zum Ziel, in 2020 einen attraktiven politischen Ratschlag der AKL durchzuführen, an dem viele Menschen aus Partei und Bewegungen teilnehmen. Wir wollen den Ratschlag nutzen, um unser politisches Programm und unsere Strategie zu vertiefen sowie die Beziehungen zu Bewegungen auszubauen.

4. Wir nehmen die Tarifrunde der Kolleg*innen in der Metall- und Elektroindustrie im Frühjahr zum Anlass, die Forderungen und Aktionen der Kolleg*innen zu unterstützen und offensiv die Konversion und Vergesellschaftung der Autoindustrie bei Einkommensgarantie für alle Beschäftigten sowie eine radikale Verkürzung der Arbeitszeit bei vollem Lohn- und Personalausgleich zu fordern.

Wir unterstützen die Kolleg*innen in der Tarifrunde Bund und Kommunen und treten für höhere Löhne und Arbeitszeitverkürzung bei vollem Lohn- und Personalausgleich ein. Die von ver.di propagierte Alternative „mehr Lohn oder kürzer arbeiten“ weisen wir zurück und regen dazu an, dass Parteimitglieder in den Gewerkschaften zu dieser Frage eine kritische Debatte anstoßen.

2020 wird vom Wirtschaftsabschwung und möglicherweise einer einsetzenden Rezession gekennzeichnet sein. Schon in den letzten Monaten gab es viele Ankündigungen von Arbeitsplatzabbau, Betriebsverlagerungen und -schließungen. Wir sind solidarisch mit allen betroffenen Belegschaften und fordern den Erhalt aller Arbeitsplätze. Unternehmen, die massenhaft Arbeitsplätze vernichten oder Betriebsteile bzw. ganze Werke schließen gehören enteignet und in öffentliches Eigentum unter demokratischer Kontrolle und Verwaltung überführt. Das wäre auch die Grundlage die Produktion umweltfreundlich und auf sinnvolle Produkte umzustellen, ohne dass dabei Arbeitsplätze verloren gehen.

5. Wir entwickeln eine Broschüre der AKL zu Klima, Verkehr und Sozialismus, die wir zum Bundesparteitag veröffentlichen, um sie in der LINKEN, der Klimabewegung und der Tarifrunde Nahverkehr einzusetzen. Grundlage für die Broschüre sind einige Artikel aus unserem vierten Bulletin „aufmüpfig“ und weitere zu erstellende Texte.

6. Wir intensivieren den Austausch mit der Bewegungslinken und KPF zum Neuaufbau der Parteilinken und loten Gemeinsamkeiten und Differenzen aus. Der Bundessprecher*innenrat wird beauftragt, den Austausch vor Strategiekonferenz, Bundesparteitag und um den Ratschlag der AKL herum zu organisieren.

7. Der nächste AKL-Länderrat am 03.05.2020 diskutiert Vorschläge für Antragsvorhaben, die der auf demselben Länderrat neu gewählte Bundessprecher*innenrat ausarbeitet, ggf. mit Anträgen anderer Parteilinker abstimmt, im Länderrat rückkoppelt und zum Parteitag einreicht.

8. Die AKL setzt sich zum Ziel, erneut mit zwei Bundessprecher*innen und ggf. weiteren Genoss*innen im neu gewählten Parteivorstand vertreten zu sein.

akl - Antikapitalistische Linke


Grafikquelle        :         Parteitag der Linkspartei in Bonn. 2. Tagung des 6. Parteitages der Partei DIE LINKE, 22. und 23. Februar 2019, Bonn.

Abgelegt unter Berlin, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Der Brand im Krefelder Zoo

Erstellt von DL-Redaktion am 16. Januar 2020

Brand im Krefelder Affentropenhaus:
Weshalb die Lüge in der Pressekonferenz?

Krefelder Zoo Eingang.jpg

Quelle       :      Scharf        —     Links

Von Edith Bartelmus-Scholich

Am vergangenen Sonntag konnte ich mich persönlich davon überzeugen, wie die Leitung des Krefelder Zoos mit kritischen Fragen zu dem verheerenden Brand in der Silvesternacht umgeht. Ein Grüppchen Linker unter ihnen der  Vorsitzende der Linksfraktion im Krefelder Rat, Basri Cakir, verteilte an Passanten vor dem Zoo ein Flugblatt mit Fragen zum Brandgeschehen.  Es ging dabei u.a. um die fehlenden Brandmelde- und Brandschutzeinrichtungen und darum, ob andere Tiere im Krefelder Zoo ausreichend gegen einen Brand geschützt seien. Auch wurde auf die Möglichkeit als Bürgerin oder Bürger im Stadtrat Fragen dazu an die Verwaltung zu stellen, aufmerksam gemacht.

Kurz nach Beginn des Verteilens gesellte sich die Polizei zu den Linken.  Beschäftigte des Zoos hatten sie gerufen und wünschten sich, dass die Verteilaktion unterbunden werden sollte. Da es dafür aber keine rechtliche Handhabe gab, sprachen die Polizeibeamten keinen Platzverweis aus und untersagten auch nicht die Verteilung des Flugblatts, sondern beließen es bei der Aufnahme der Personalien und einer freundlichen Mahnung nicht aufdringlich zu verteilen.

Kritische Fragen gefallen der  Zooleitung offenbar nicht

Das muss wohl auch schon auf der Pressekonferenz von Zooleitung, Stadt, Feuerwehr und Polizei nach dem durch eine Himmelslaterne verursachten Brand im Affentropenhaus des Krefelder Zoos am 1.1. um 12.00 Uhr so gewesen sein. Auf die konkrete Frage eines Journalisten, ob denn Tiere hätten erlöst werden müssen, antwortete der Zoodirektor, dass dies nicht der Fall gewesen war. (1) Alle anderen Vertreter im Podium der Pressekonferenz  wussten wohl was wirklich der Fall  war, sahen aber keinen Anlass ihrerseits  die Wahrheit zu sagen.

Heute wurde die Zooleitung von dieser Unwahrheit eingeholt. Die Polizei erstattete gestern ihrem Dienstherrn, dem Innenminister des Landes NRW, wahrheitsgemäß Bericht: Etwa zwei Stunden nach dem die Feuerwehr den Brand um 4.40 Uhr für gelöscht erklärt hatte, habe eine Tierärztin zwei schwerverletzte Menschenaffen, je einen weiblichen Gorilla und Orang-Utan einschläfern müssen. Bei einem männlichen Gorilla, dem Silberrücken Massa, habe das Medikament nicht gewirkt und daraufhin sei der Gorilla von einem Polizisten mit mehreren Schüssen aus einer Maschinenpistole getötet worden.

Ein genauer Blick in die Live-Aufzeichnung der Pressekonferenz am 1.1. um 12.00 Uhr wirft noch weitere Fragen auf (1). Die Feuerwehrleitung erklärt sehr beflissen in Richtung Zooleitung, dass die fehlenden Brandmelder dieser nicht angelastet werden können, weil sie im Baujahr 1975 nicht vorgeschrieben waren. Außerdem seien Brandmeldeeinrichtungen in einem Affentropenhaus aufgrund des hohen Staubaufkommens nicht praktikabel wurde sinngemäß erklärt. Irritierend ist hier allerdings, dass es solche Anlagen in anderen Zoos in Deutschland durchaus gibt.

Im Nachhinein gewinne ich den Eindruck als ob schon im Rahmen der Pressekonferenz ein Mitverantwortlicher für die Katastrophe von einem anderen Mitverantwortlichen entlastet werden sollte – und das gegenseitig.

Auch die Feuerwehr muss sich einigen Fragen stellen

Zunächst ist zu klären, ob der Feuerwehr Pläne des Affentropenhauses vorlagen. Diese hätten nämlich Aufschluss darüber gegeben, dass das Gebäude zu großen Teilen aus einem massiven, mehrgeschossigen Betonkern bestand, der durch Versorgungsgänge zugänglich gewesen wäre. Der sogenannte Vollbrand konnte so gar nicht das ganze Haus erfassen, was bereits dadurch bewiesen ist, dass zwei Schimpansen das Feuer leicht verletzt in einem Gang des Betonkerns überlebt haben.

Wie vollkommen falsch die Feuerwehr das Gebäude eingeschätzt hatte, zeigt sich schon daran, dass sie rasch erklärte, in dem Haus hätte kein Tier überlebt. Entgegen dieser Einschätzung wurden am nächsten Morgen nicht nur zunächst die drei schwerverletzten, sondern gegen 8.00 Uhr auch zwei leicht verletzte Tiere gefunden.  Es bleibt deshalb zu klären, ob, falls Menschen in Schutzkleidung das Haus über die Versorgungsgänge im Betonkern betreten hätten um auch von innen zu löschen, nicht mehr Affen hätten gerettet werden können. Die Entscheidungen der Feuerwehr nur von außen zu löschen, aber mit Schusswaffen bewaffnete Polizisten zum Schutz vor eventuell ausbrechenden Tieren anzufordern, erfordert dringend eine detaillierte Untersuchung. Wissen wollen nicht nur Tierschützer, ob die Feuerwehr einen Brand in einem Gebäude in dem sich „nur“ Affen aufhalten etwa grundsätzlich von außen löscht.

Die Stadt als Mitverantwortliche

74,9% der Anteile des Zoos sind in städtischer Hand, 25,1%  halten die Zoofreunde. OB Meyer war damit nicht nur auf der Pressekonferenz um als Stadtoberhaupt sein Mitgefühl auszusprechen. Fragen, welche Mitverantwortung denn die Stadt trägt ob als Hauptanteilseigner oder über ihre Ämter auch als Aufsichtsbehörde, zum Beispiel bei der fatalen Entscheidung das durch Hagelschlag beschädigte Glasdach durch ein leicht entflammbares Kunststoffdach zu ersetzen, werden noch kaum diskutiert. Auch gibt es keine Debatte darüber, ob denn die Finanzausstattung des Zoos durch die Stadt vielleicht unzureichend war und so Missstände befördert hat. Weiter sollte endlich die städtische Entscheidung gegen Feuerwerksverbotszonen revidiert werden. Diese Debatten und die passenden Schlussfolgerungen sind nötig, wenn Katastrophen wie der Brand des Affenhauses sich nicht wiederholen sollen.

Noch bevor diese Sachverhalte aber bewertet werden, sollte OB Meyer den Krefelderinnen und Krefeldern erklären, wieso er es zugelassen hat, dass in seiner Gegenwart, die Öffentlichkeit in der genannten Pressekonferenz durch eine bewusste Lüge getäuscht wurde. Fake News von offizieller Seite untergraben das Vertrauen der Bürgerinnen und Bürger in ihre Institutionen.


Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen         :

Oben          —       Bildbeschreibung: Eingang Zoo, Krefeld Quelle: selbst fotografiert Datum: 18.06.2006 Fotograf/Zeichner: DER UNFASSBARE


2.) von Oben      —       Das Gehege der Schimpansen im Krefelder Affentropenhaus (2010)


Unten        —            Scharf –  Links   —   Bildmontage  HF

Abgelegt unter Innere Sicherheit, Nordrhein-Westfalen, Positionen, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 15. Januar 2020

Bericht vom Jahresauftakt der LINKEN in Berlin 10.-12.Januar 2020


Quelle        :    AKL

Von Lucy Redler und Thies Gleiss

(Mitglieder des Bundessprecher*innenrates der AKL im Parteivorstand der LINKEN)

Die LINKE Bundespartei trifft sich traditionell am zweiten Wochenende des Jahres zu einem kombinierten Jahresauftakt. Er besteht aus einem geselligen Empfang am Freitagabend mit Speis und Trank, Musik, Kulturbeiträgen und einem Gastvortrag; einem gemeinsamen Treffen des Parteivorstandes mit den Vorsitzenden der Landesverbände und Fraktionen der Partei (die sogenannte „Gremiensitzung“) am Samstag zur Diskussion einer aktuellen politischen Initiative und schließlich die sonntäglichen Gedenkveranstaltungen aus Anlass des Jahrestages der Ermordung von Rosa Luxemburg und Karl Liebknecht, mit Kranzniederlegung an der Gedenkstätte für die Sozialist*innen und – wer es noch will und schafft – Teilnahme an der Luxemburg-Liebknecht-Demonstration.

Im Mittelpunkt des Empfanges am Freitagabend im selbstverwalteten Zentrum für Geflüchteten- und Stadtteilarbeit „Refugio“ stand ein Vortrag von Ulrich Schneider, der seit zwanzig Jahren Hauptgeschäftsführer des Deutschen Paritätischen Wohlfahrtsverbandes und seit längerem guter Freund der LINKEN ist. Sein Verband ist ein Dachverband von hunderten von Einrichtungen der Sozialarbeit, die jeden Tag konkret mit den Kosten der freiheitlich demokratischen Grundordnung des deutschen Kapitalismus zu tun haben. Sie sprechen nicht von großen Zielen, sondern praktizieren Sozialarbeit und „Umverteilung“ heißt für sie, mehr Geld für die alltägliche Unterstützung derjenigen zu mobilisieren, die kein Geld haben oder denen es durch Politik und Strukturen der Realpolitik weggenommen wurde.  Aber Ulrich Schneider gelingt es immer, die großen politischen Linien der herrschenden Sozialpolitik herauszuarbeiten, die eben nicht – wie es immer wieder, sogar aus den Reihen der LINKEN zu hören ist – ein Unfall oder Versehen sind, sondern gezielt Machtpolitik darstellen, die die bestehende Eigentums- und Besitzordnung nicht angreifen und verändern, sondern verfestigen sollen.
Seinen radikalen Forderungen für mehr Geld für die Bedürftigen, armutsfesten Löhnen und Renten stimmen jede LINKE und jeder LINKER natürlich zu. Es erstaunte aber doch ein wenig, dass Ulrich Schneider das Jahr 2019 bilanzierte und einen Ausblick auf 2020 gab, ohne ein einziges Mal die gegenüber Löhnen, Renten und Wohnungen nicht minder bedeutende soziale Krise zu erwähnen, die sich aus den ökologischen und klimatischen Folgen der kapitalistischen Produktionsweise ergibt. Diese Klimakrise ist gleichermaßen eine soziale Krise, die genau wie die anderen Krisen in erster Linie von der ärmeren Mehrheit der Gesellschaft bezahlt werden soll. Wenigstens ein kleiner Beitrag zur laufenden Debatte über CO2-Bepreisung und die Folgen für die unteren Einkommensschichten wäre doch möglich gewesen.

Am Samstag wurde thematisch passend ein Text mit dem Titel „Das LINKE Konzept für einen demokratischen Sozialstaat der Zukunft“ diskutiert und per Meinungsbild gebilligt – die „Gremiensitzung“ ist bekanntlich kein beschlussfassendes Organ der LINKEN.
Die Debatte über diesen Text ( leitete der Sozialwissenschaftler und Kenner gewerkschaftlicher und betrieblicher Probleme aus Jena, Klaus Dörre, als Gastreferent ein. Im Großen und Ganzen begrüßte Klaus Dörre das Konzept der LINKEN, das letztlich weitgehend eine Zusammenstellung bestehender Forderungen und Positionen aus Grundsatz- und diversen Wahlprogrammen war. Er kritisierte aber, dass es zu statisch sei, und nicht nach dem Woher und Wohin sozialer Forderungen frage.

Das Prinzip „Klassenkampf“ taucht in dem Text nicht auf und deshalb auch nicht die Frage nach konkreten Bündnissen und politischen Strategien zur Umsetzung dieses Programms. Thies Gleiss hatte als einer der wenigen PV-Mitglieder zu dem Entwurf für dieses Konzept schriftlich Stellung bezogen und die bei Klaus Dörre anklingende Kritik verallgemeinert.
Er kündigte seine Ablehnung des Textes an, dem sich Lucy Redler anschloss.
„Sozialstaat“ ist in der Summe kein linker Begriff, auch wenn die einzelnen konkreten Positionen daraus von Linken natürlich erkämpft, verteidigt und verbessert werden müssen. Auch in der Debatte der „Gremiensitzung“ wurde darauf verwiesen, dass der Ursprung von „Sozialstaat“ schon bei Bismarck Ende des 19. Jahrhunderts lag, der damit ausdrücklich dem „Sozialismus“ und der, damals ja noch etwas radikaleren, SPD „den Wind aus den Segeln nehmen sollte“.  Für Linke sind die Ziele „solidarische Gesellschaft“ oder „soziale Rechte“ viel klarer, wenn nicht gleich das gesamte gesellschaftlicher Alternativkonzept „Sozialismus“ erwähnt werden soll. Der vorliegende Text forderte ein, man solle “dem Sozialstaat seine Glaubwüdigkeit zurück geben.” Der Staat ist jedoch kein neutraler Staat, den man einfach von links mit anderem Inhalt füllen kann. Teilweise wurde in der Debatte fortschrittliche Gesetze und der Staat als solcher verwechselt. Lucy Redler betonte in der Debatte, dass das Papier trotz vieler richtiger Forderungen nicht den Geist einer Systemalternative atme, sondern des freundlichen Umbaus ohne Antwort darauf, welche Kräfte das durchsetzen sollen und auf welche Forderungen wir die Auseinandersetzungen zuspitzen wollen. Es wurde nicht nur von ihr die Frage gestellt, ob DIE LINKE damit anschlussfähig an Diskurse unter linkeren SPDler*innen werden soll mit der Option auf r2g.

Den Kritiken von Lucy Redler und Thies Gleiss wurde entgegengehalten, der notwendige Klassenkampf zur Erreichung der einzelnen Ziele würde schon deutlich werden, wenn die Dinge verkündet werden. Das erscheint uns aber doch sehr optimistisch, auf das Wort zu vertrauen, statt auf Kämpfe, die – so zeigt die reale Geschichte immer wieder – in ihrer konkreten Dynamik ja immer wieder andere und auch radikalere Forderungen hervorbringt.
Das „Sozialstaatspapier“ so das Fazit von Thies Gleiss auf der Sitzung, ist ein zusammengefasstes Regierungsprogramm, ohne dass die passende Regierung oder überhaupt nur Wahlen vorhanden sind. Er schlug vor, um das Papier immerhin noch ein wenig praktisch nützen zu können, es den Genoss*innen in Thüringen zukommen zu lassen, die gerade über ein Programm einer Minderheitsregierung in Erfurt verhandeln. Dazu wäre das Papier sehr nützlich, verbunden mit dem Hinweis, in keinem Punkt von den dort aufgeführten Forderungen zurückzugehen
Das „Konzeptpapier“ wurde schließlich mit den beiden Gegenstimmen von Lucy und Thies und bei einer Reihe von Enthaltungen mit großer Mehrheit gebilligt.

Ohne Gegenstimme nahm das Treffen eine aktuelle Resolution gegen einen drohenden Krieg im Iran an. (

Am Sonntag gab es die traditionelle Kranzniederlegung diverser Gremien und Strukturen der LINKEN und das sogenannte „schweigende Gedenken“. Etwas lauter, aber nicht weniger traditionell fand die Luxemburg-Liebknecht-Demonstration statt. Etwa 5000 Teilnehmer*innen aus allen Gruppen und Strömungen der radikalen Linken zogen ebenfalls zur Gedenkstätte für die Sozialist*innen in Berlin-Friedrichsfelde

akl - Antikapitalistische Linke


Grafikquelle     :           Das zerbrochene Gewehr: Logo antimilitaristischer Organisationen, so der Kriegsdienstverweigerer-Verbände wie War Resisters International

Abgelegt unter Berlin, Kultur, P. DIE LINKE, Überregional | Keine Kommentare »

Plädoyer – Strategiedebatte

Erstellt von DL-Redaktion am 14. Januar 2020

Für eine emanzipatorische LINKE in Bewegung

File:Red Umbrella (18784873033).jpg

Von  Tim Dreyer

Plädoyer zur Strategiedebatte: Die Partei muss mehr Mut zum inneren Widerspruch zeigen und sich vom Verständnis der sozialdemokratischen Stellvertreter*innenpolitik lösen.

Die Partei DIE LINKE ist ein Geschenk. Noch nie zuvor ist es in Deutschland gelungen, eine Linkspartei jenseits der Sozialdemokratie zu etablieren, der dauerhaft eine bundespolitische Bedeutung zugeschrieben wird. Dieser Erfolg beruht auf der Tatsache, dass DIE LINKE unterschiedliche Strömungen und Ansätze des linken Spektrums bündelt und sammelt. DIE LINKE ist im besten Sinne des Wortes also eine linke Sammlungspartei. Bei allen notwendigen Debatten über die strategische Ausrichtung der Partei, darf dieser Fakt niemals vergessen werden. Nur gemeinsam und solidarisch im Umgang können wir stark sein. Oberstes Prinzip sollte deshalb der Grundsatz „Einheit vor Klarheit“ sein. Brüche mit einzelnen Traditionen innerhalb der Partei schaden nicht nur der Partei als Ganzes, sondern der gesamten gesellschaftlichen Linken. Dennoch habe ich versucht einige Gedanken zur künftigen strategischen Ausrichtung der Partei auszuformulieren, die dieses Prinzip berücksichtigen.

Mut zum inneren Widerspruch!

Genau so vielfältig wie die Mitglieder und Strömungen der Partei DIE LINKE sind die kollektiven und individuellen Ausbeutungs- und Diskriminierungserfahrungen in modernen kapitalistischen Gesellschaften. Was sie eint ist, dass der neoliberale Kapitalismus diese Ausbeutungs- und Diskrimierungserfahrungen nicht beseitigt, sondern immer wieder reproduziert:

Der Neoliberalismus bringt den von der bürgerlichen Mitte bereits überwunden geglaubten Klassenkonflikt als neue soziale Frage zurück auf das Tableau der politischen Auseinandersetzung. Dabei stehen die Kämpfe und Auseinandersetzungen um Wohnraum, prekäre Arbeit, Armut, Gesundheit und die ungleiche Vermögensverteilung im Zentrum der Debatte.

Die Kämpfe um den Paragraphen 219a und die große Zahl an Femiziden zeigen, dass das Patriarchat nach wie vor fest im Sattel sitzt. Die zunehmende Abschottungspolitik der Industriestaaten, Asylrechtsverschärfungen, Neonazi-Netzwerke bei Polizei und Bundeswehr und rechtsterroristische Gewalt sind Symptome einer strukturell rassistischen Mehrheitsgesellschaft. Trotz Fortschritten wie der „Ehe für Alle“ ist die Gleichstellung von queeren Menschen ist noch lange nicht erreicht.

Die Klimakrise verstärkt die Effekte einer auf Ausbeutung und Ungleichheit beruhenden globalen Wirtschaftsweise noch zusätzlich. Während die Einen durch ihren schier grenzenlosen Ressourcenhunger die Klimakrise vorantreiben, werden die Anderen zuerst von seinen Auswirkungen betroffen sein. Neue Fluchtursachen und steigende Fluchtbewegungen werden die Folge, eine nochmals verstärkte Abschottungspolitik die Antwort sein. Auch innerhalb reicher kapitalistischer Gesellschaften werden sich die Reichen leicht vor den Folgen der Klimakrise schützen können, während die Armen von den Kosten der Klimapolitik mit aller Wucht getroffen werden.

DIE LINKE muss die Kämpfe gegen all diese unterschiedlichen Ausbeutungs- und Diskriminierungserfahrungen bündeln und eine Plattform für all jene bieten, die nicht zu den Gewinner*innen des neoliberalen Kapitalismus gehören. Sie muss die verschiedenen sozialen Kämpfe in einer verbindenden Klassenpolitik zusammenführen.

Mitglieder des Parteivorstands der LINKEN halten ein Transparent mit dem Text: Für Frieden und Demokratie in der Türkei. Solidarität mit der HDP. DIE LINKE.

Dabei können vordergründig durchaus Widersprüche zwischen unterschiedlichen sozialen Kämpfen entstehen, die nicht immer aufzulösen sind. DIE LINKE muss deshalb immer wieder das Verbindende in den Vordergrund stellen und Mut zum inneren Widerspruch zeigen. Ein verbindendes Element ist die Forderung nach sozialer Gerechtigkeit, hinter dem sich unterschiedliche soziale Kämpfe vereinen lassen. Statt mit detailreichen realpolitischen Forderungen in die politische Auseinandersetzung zu ziehen, muss unser Programm die Herzen und Emotionen der Menschen ansprechen. Damit wäre es im besten Sinne „linkspopulistisch“, da es die Vision einer besseren Zukunft vermittelt, ohne immer schon auf alle Fragen eine Antwort parat zu haben. Wir müssen den Mut haben uns auf den Weg zu machen, diese Antworten zu finden. Auf diesem Weg ist ein breiter und diskursiver Prozess notwendig, der nicht von oben dirigiert, sondern von den Betroffenen selbst entwickelt werden muss.

Wie dies gelingen kann, zeigt das Beispiel Hessen deutlich. Auf der einen Seite fungiert DIE LINKE hier als parlamentarischer Arm der Flughafenausbau-Gegner*innen, auf der andere Seite ist sie wichtige und anerkannte Verbündete im Kampf für gute und sichere Arbeitsplätze am Frankfurter Flughafen. Dieser scheinbare Widerspruch zwischen den Interessen löst sich im Kampf gegen das neue Billigflugterminal auf: es steht für mehr Lärm und klimaschädliche Mobilität aber auch für schlechtere Arbeitsbedingungen und Ausbeutung.

Uns aus dem Elend zu erlösen, können wir nur selber tun

Quelle       :         Der Freitag            >>>>>          weiterlesen


Grafikquelle       :

Oben         —    Red Umbrella

Source Red Umbrella
Author Sonny Abesamis

This file is licensed under the Creative Commons Attribution 2.0 Generic license.


Unten          —        Twitter – DIE: LINKE

Abgelegt unter Hessen, Medien, P. DIE LINKE, Überregional | Keine Kommentare »

Linke Bilanz von 13 Jahren

Erstellt von DL-Redaktion am 13. Januar 2020

Ursachen- statt Symptombekämpfung!

Die Linke Weltpremiere Der junge Karl Marx Berlinale 2017.jpg

Kleider machen Leute aber nur schlechte Politik

Quelle           :            AKL 

Ein Beitrag zur Strategiedebatte der LINKEN von Sascha Staničić

Nur ein wirklicher Kurswechsel kann DIE LINKE nach vorne bringen

Woran messen wir Erfolg und Misserfolg der LINKEN? An den katastrophalen Wahlergebnissen in Brandenburg, Sachsen und bei der Europawahl? An den besseren Wahlergebnissen in Thüringen und Bremen? An dem bescheidenen Mitgliederzuwachs im Westen? An den Mitgliederverlusten im Osten? An nichts von alldem.

Wir sollten uns alle die Frage stellen, warum wir angefangen haben, uns links politisch zu engagieren. Sicher nicht als Selbstbeschäftigung und auch nicht, um eine Partei zu bilden, die zum Selbstzweck oder zum Vehikel zur Lösung der eigenen sozialen Frage wird. Nein, wir wollten die Gesellschaft verändern!

Bilanz von 13 Jahren

Wenn wir 13 Jahre Existenz der LINKEN daran messen, wie sich die Gesellschaft verändert hat, dann müssen wir eine ernüchternde Bilanz ziehen. Abgesehen von der Einführung des Mindestlohns und der einen oder anderen bedeutungsschwachen Sozialmaßnahme ist dieser Staat unsozialer, undemokratischer, militaristischer, ungleicher, rassistischer geworden. Der von einigen Genoss*innen bei jeder Gelegenheit verwendete Slogan „Links wirkt“ ist vor diesem Hintergrund einfach Quatsch. Sicher: ohne DIE LINKE wären die Verhältnisse wahrscheinlich noch schlimmer. Aber die sozialistische Arbeiter*innenbewegung wurde nicht zur Schadensbegrenzung gegründet, sondern um die Arbeiter*innenklasse von der Lohnsklaverei zu befreien und den Kapitalismus durch eine sozialistische Demokratie zu ersetzen. Dieses Ziel ist angesichts der durch den globalen Kapitalismus entfesselten Destruktivkräfte und des milliardenfachen Elends auf der Welt heute drängender denn je.

Was aber in gewisser Hinsicht noch ernüchternder ist: vom großen Aufbruch und der Dynamik der Vereinigung von WASG und PDS im Jahr 2007 ist nichts übrig geblieben. Wir sind heute in Westdeutschland mehr Mitglieder als damals, aber wir dürfen nicht ignorieren, dass viele Tausend, die sich voller Hoffnung in der LINKEN organisiert und engagiert haben, sich wieder – oftmals enttäuscht – zurück gezogen haben. Für viele Menschen aus der Arbeiter*innenklasse, für Jugendliche und nicht zuletzt für viele in Gewerkschaften und sozialen Bewegungen Aktive ist DIE LINKE so etwas wie der linke Teil des politischen Establishments, aber nicht eine rebellische, konsequente und vertrauenswürdige Vertretung ihrer Interessen.

Schonungslose Kritik nötig

Wenn diese Strategiedebatte nicht eine langweilige Wiederholung ähnlicher Debatten der Vergangenheit werden soll, dann muss sie erstens mit einer schonungslosen Kritik des Zustands der Partei beginnen und zweitens zu konkreten und realen Veränderungen führen.

Viele Genoss*innen, die sich wie ich zur Parteilinken zählen, haben den Fokus ihrer Beiträge zu dieser Debatte auf die Praxis der Partei gelegt. Sie mahnen mehr Aktionsorientierung und eine Schwerpunktsetzung auf außerparlamentarische Aktivitäten (zum Beispiel Unterstützung von Streiks und sozialen Bewegungen) an. Damit haben sie Recht, aber sie machen in gewisser Hinsicht den zweiten Schritt vor dem ersten. Denn die mangelhafte Praxis der Gesamtpartei (und mit dieser Bewertung möchte ich das aufopferungsvolle Engagement vieler Mitglieder nicht geringschätzen) ist Folge und nicht Ursache einer mangelhaften politischen Analyse, Programmatik und Perspektive. Deshalb sollte die Strategiedebatte damit beginnen, dass wir uns über unsere Einschätzung des gegenwärtigen Kapitalismus und seine Entwicklungsperspektiven austauschen und darüber, mit welchem politischen Programm DIE LINKE darauf reagieren sollte. Dazu findet in der Partei aber bisher kaum eine Debatte statt.

Da die Länge von Beiträgen zur Strategiedebatte auf 10.000 Zeichen begrenzt ist, kann ich diese Fragen nur thesenhaft behandeln und verweise auf Analysen, die ich und andere auf veröffentlicht haben.

Kapitalismus krisenhaft

Um es so kurz wie möglich zusammen zu fassen: Der Kapitalismus befindet sich weltweit in einer multiplen Krise. Es gibt zweifellos eine dramatische ökologische Krise (wobei der Krisenbegriff hier nicht ganz zutreffend ist, da es keinen Grund gibt, anzunehmen, dass sich die zerstörerische Entwicklung des kapitalistischen Systems im Hinblick auf die Natur auch nur zeitweilig umkehren wird). Die traditionellen bürgerlichen Parteien und damit die herrschende Kapitalistenklasse befinden sich weltweit in einer tiefen Legitimationskrise, die die politische Instabilität hat enorm anwachsen lassen und zur Entstehung neuer politischer Kräfte, sowohl des Rechtspopulismus aber auch auf der Linken, geführt hat. Aber vor allem („vor allem“ weil die Ökonomie für Sozialist*innen letztlich die Basis gesellschaftlicher und politischer Entwicklungen ist) hat der Kapitalismus schon lange sein Potenzial ausgeschöpft einen ökonomischen Fortschritt zu erzeugen, der die Lebensverhältnisse der Menschen verbessert. Stattdessen führen technische Innovationen zu Verschlechterungen der Lebens- und Arbeitsbedingungen und kann das System den wiederkehrenden Wirtschaftskrisen nicht entkommen. Auch wenn es nach der letzten „Großen Rezession“ von 2007 bis 2009 eine außergewöhnlich lange Aufschwungphase gab, so hat diese der Masse der Arbeitenden nichts gebracht, sondern vor allem die Reichen noch reicher gemacht. In den meisten Ländern wurde das durch die Krise Zerstörte außerdem nicht wieder aufgebaut und – was noch wichtiger ist – wurden die Auswirkungen der Krise durch Maßnahmen begrenzt, die eine nächste, womöglich tiefere Krise nur vorbereitet haben. Vieles spricht dafür, dass wir am Anfang einer solchen neuen ökonomischen Krise, möglicherweise sogar eines Crashs, der die Auswirkungen der Pleite von Lehman Bros. in den Schatten stellen wird. Und selbst wenn wir „nur“ am Anfang einer konjunkturellen Abschwung- oder Rezessionsphase stehen, hat das für die Arbeiter*innenklasse schon jetzt dramatische Folgen hinsichtlich von Stellenabbau und Betriebsschließungen.

Die Ursachen dieser krisenhaften Entwicklung des Kapitalismus liegen nicht in einer falschen – neoliberalen – Wirtschaftspolitik. Sie sind vielmehr struktureller Natur, liegen dem System inne und haben ihre tiefere Ursache in den Überakkumulationsprozessen von Kapital, das keine ausreichenden profitablen Anlagemöglichkeiten, vor allem in der so genannten Realwirtschaft, findet. Das führt zu der perversen Situation, die schon Marx und Engels im Kommunistischen Manifest beschrieben haben: der Kapitalismus führt zu Krisen aus Überfluss. Das bedeutet, dass trotz des Überflusses – und des enormen privaten Geldreichtums in den Händen einiger weniger – der Spielraum der Kapitalisten und ihrer Regierungen für Zugeständnisse an die Arbeiter*innenklasse in Form von höheren Löhnen, kürzeren Arbeitszeiten ohne Lohnverlust, besseren Sozialleistungen, einer für die Masse der Menschen ausgebauten Infrastruktur etc. aufgrund des verschärften Konkurrenzkampfes zwischen Konzernen geringer geworden ist. Das bedeutet gleichermaßen, dass der Spielraum für die Durchsetzung klassischer reformistischer Politik, wie wir es zum Beispiel in Zeiten des Nachkriegsaufschwungs sahen, geringer geworden ist. Das ist auch der Hintergrund dafür, dass nahezu alle traditionellen sozialdemokratischen Parteien in den letzten Jahrzehnten sozialdemokratische Politik aufgegeben haben. Und auch die neuen linken Parteien haben mit linker Politik aufgehört, sobald sie in Regierungen eingetreten waren, wie Syriza in Griechenland. Für Podemos ist eine ähnliche Entwicklung zu erwarten.

Alles muss erkämpft werden

Was ist aus diesen Thesen zu schlussfolgern? Nicht, dass Zugeständnisse an die Arbeiter*innenklasse nicht möglich wären. Aber, dass sie erstens von den Herrschenden und Besitzenden immer wieder angegriffen werden und zweitens, dass sie erkämpft werden müssen. Durch Massenbewegungen und vor allem Streiks und Generalstreiks. Der Gedanke, dass Sozialreformen im Interesse der Arbeiter*innenklasse auf parlamentarischem Weg und durch Regierungskoalitionen mit SPD und Grünen dauerhaft durchsetzbar sind, ist falsch und es gibt keine historischen Belege für ihn. Im Gegenteil haben Regierungsbeteiligungen von linken oder sich als sozialistisch verstehenden Parteien mit prokapitalistischen Parteien früher oder später immer zur Beteiligung an arbeiter*innenfeindlichen Maßnahmen, der Aufgabe linker Prinzipien und in der Folge zur Schwächung dieser linken Parteien geführt. Das ist auch die grundlegende Erfahrung der PDS/LINKEN, die durch die in einer spezifischen Situation begründete Stärkung der LINKEN in Thüringen nicht aufgehoben wird. Und auch hier darf nicht vergessen werden, dass die rot-rot-grüne Regierung abgewählt wurde und die AfD die Hauptgewinnerin der Wahl war.

Es ist jedoch der falsche Gedanke, dass innerhalb des Kapitalismus ein grundlegender Politikwechsel im Interesse der Lohnabhängigen und sozial Benachteiligten möglich wäre, der zur politischen Orientierung auf Regierungsbeteiligungen mit SPD und Grünen führt. Ebenso ist es eine Illusion zu glauben, es könnte zur Einführung einer Art von Wirtschaftsdemokratie kommen, die die grundlegenden Eigentums- und Machtstrukturen in der Gesellschaft unangetastet lässt und auf dem parlamentarischen Weg eingeführt werden könnte. Mit diesen Gedanken muss die Partei brechen und stattdessen eine Strategie entwickeln, die das Handeln im Hier und Heute in eine direkte Verbindung zur Notwendigkeit und dem Ziel einer sozialistischen Veränderung der Gesellschaft setzt. In diesem Zusammenhang sollte auch erklärt werden, dass eine sozialistische Demokratie sich grundlegend von den bürokratischen Diktaturen der DDR und Sowjetunion unterscheidet und auf Selbstverwaltung und demokratische Entscheidungsfindungen durch die arbeitende Bevölkerung basiert.

Sozialistisches Programm

Programmatisch hätte das zur Folge, dass DIE LINKE nicht fordert, was sie für im Rahmen des Kapitalismus durchsetzbar oder angesichts des derzeitigen Bewusstseinsstands in der Arbeiter*innenklasse für mehrheitsfähig hält, sondern was notwendig ist, um die Lebenssituation der Menschen qualitativ und nachhaltig zu verbessern (das bedeutet übrigens nicht, die rote Fahne schwenkend und „Revolution“ rufend durch die Gegend zu laufen und natürlich muss sehr genau überlegt werden, wie bestimmte Forderungen vermittelt werden und welche zu welchem Zeitpunkt mobilisierungsfähig sind und dementsprechend in den Vordergrund gestellt werden sollten). Das muss auch bedeuten, dass DIE LINKE bei jeder Gelegenheit die Eigentumsfrage in den Mittelpunkt ihrer Propaganda stellen sollte. Es muss uns und vor allem den beiden Vorsitzenden zu denken geben, wenn andere gesellschaftliche Kräfte das weitaus offensiver und effektiver machen, wie die Kampagne „Deutsche Wohnen enteignen“ hinsichtlich der Forderung nach der Enteignung der großen Immobilienkonzerne oder der Juso-Vorsitzende Kevin Kühnert, als er die Vergesellschaftung der Autokonzerne in die Diskussion brachte. Es ist peinlich, wenn eine sich als sozialistisch verstehende Partei bei diesen Debatten hinterher trabt oder sich ihr Vorsitzender sogar dagegen ausspricht die Forderung nach Überführung der Autoindustrie in Gemeineigentum aufzustellen (obwohl diese übrigens Teil des Wahlprogramms der Partei zur letzten Bundestagswahl war). Wenn DIE LINKE nicht treibende Kraft antikapitalistischer Diskurse und Bewegungen ist, macht sie sich überflüssig.

Was würde das praktisch bedeuten? Schluss mit den Regierungsbeteiligungen mit SPD und Grünen auf Landesebene und der Debatte über eine solche auf Bundesebene! Offensive Kampagnen für Forderungen wie drastische Arbeitszeitverkürzung bei vollem Lohn- und Personalausgleich, einen Mindestlohn von 13 Euro als ersten Schritt zu 15 Euro, Verbot von Leiharbeit und Missbrauch von Werkverträgen um nur einige Beispiele zu nennen. Es würde darum gehen, die gemeinsamen Klasseninteressen aller Teile der Lohnabhängigen zu formulieren und Angebote für den Kampf darum zu machen. Das wird gerade in der Partei mit dem Begriff „verbindende Klassenpolitik“ diskutiert – entscheidend ist aber nicht nur die (gar nicht besonders innovative) Erkenntnis, dass diese Verbindungen gezogen werden müssen, sondern vor allem, dass eine Klassenpolitik in jeder Situation zum Ausgangspunkt des Handelns der Partei wird.

Das muss einher gehen mit einer offensiven Propagierung der Vision eine tatsächlich grundsätzlich anderen Politik und Gesellschaft. Nicht nur Enteignung der großen Immobilienkonzerne, weil ihr Handeln den Interessen der Mieter*innen widerspricht, sondern auch der Pharmaindustrie, weil ihr Wirtschaften den Interessen der Kranken widerspricht, der Auto- und Energiekonzerne, weil ihr Agieren den Interessen einer ökologisch nachhaltigen Entwicklung widerspricht und diese nur erreicht werden kann, wenn die Produktion ökologisch nachhaltig umgestellt wird, was wiederum nur möglich ist, wenn Privateigentum und Profitlogik ausgeschaltet werden. Es würde bedeuten selbstbewusst, rebellisch und frech deutlich zu machen, dass man mit den etablierten Parteien und den Konzernchefs wirklich nichts gemein hat, dass man im unüberbrückbaren Widerspruch zu ihnen steht. Keine Tänze mehr mit Unionspolitikern auf Pressebällen! Das könnten die Abgeordneten der LINKEN auch dadurch dokumentieren, dass sie sich durch ihre Mandate nicht materiell über die Masse der lohnabhängigen Bevölkerung erheben, sondern alles, was von den überhöhten Diäten über einen durchschnittlichen Facharbeiter*innenlohn hinausgeht, an die Partei und soziale Kämpfe spenden.

Und natürlich würde eine solche politische und programmatische Wende zu tatsächlich sozialistischer Politik bedeuten, den Fokus der praktischen Tätigkeit der Partei, ihres Apparates und ihrer Mandatsträger*innen und deren Mitarbeiter*innen darauf zu legen, gewerkschaftliche und soziale Kämpfe zu fördern und zusammen zu führen, die Selbstorganisation von Arbeiter*innen, Jugendlichen, Mieter*innen etc. voran zu treiben und auf dieser Basis die Partei zu einer wirklich sozialistischen Massenpartei zu machen. Gelegenheiten dazu wird es auch im Jahr 2020 genug geben.

Sascha Staničić ist Mitglied im AKL-Länderrat und Bundessprecher der Sozialistischen Organisation Solidarität (Sol)

akl - Antikapitalistische Linke


Grafikquellen        :

Oben           —        Zwei Welten auf einen Foto

Vertreter der Partei Die Linke bei der Weltpremiere von Der junge Karl Marx bei der Berlinale 2017: v.l.n.r. Oskar Lafontaine, Sahra Wagenknecht, Dietmar Bartsch, Katja Kipping, Petra Pau und Kristian Ronneburg

Abgelegt unter Arbeitspolitik, Berlin, P. DIE LINKE, Sozialpolitik, Überregional | Keine Kommentare »

Nich nur polit SF dramolett

Erstellt von DL-Redaktion am 13. Januar 2020

kein licht

Datei:2014-11-22 angebliche „Demo für Alle“-Kundgebung in Hannover, (1005).JPG

Quelle       :         Scharf  —   Links

von dieter braeg

Wir schreiben das Jahr 2020. Ein Marktlpatz in irgend einer xbeliebigen Stadt in Bayern. Es herrscht reges Treiben. Neben den sonst üblichen Wahlbewerberständen sieht man drei  mit hell- mittel und dunkelorangenen Sonnen/Regenschirmen.

Die Hellorangenen:

„WählerinWähler nehmt uns, wir sind die die bürgernäher als nah sind.  Wir sind die radikalen Wieauchimmerbasisdemokraten. Wir machen alles was SIE wollen, wenn wir es auch wollen. Kommen Sie näher. Demokratie  ist machbar. Nehmen Sie unseren Bastelausschneidebogen mit und basteln sie in ihren vierHartzVIwänden den einzig wahren basisdemokratischen Basisdemokraten.“

Die Mittelorangenen die manchmal auch MiittelGRÜNorangenen gennnt werden:

WählerinWähler gebt uns eure Stimme. Wir sind die die es geschafft haben die historische Chance zu verwirklichen, wir haben Deutschland eine einzige einige deutsche Linkspartei geschenkt. Mit unseren Führerinnen und Führern garantieren wir auch weiterhin:  konsequentradikaldemokratischer Verkauf von öffentlichem Eigentum, Abbau der Bürgerrechte, kein Mindesteinkommen für Arbeitsverweigerer und chronische Faulenzer. Nehmen sie den Gutschein mit für eine ermäßigte Fahrt in der einzigen und wahren neuen Linkspartei Geisterbahn. Dort erleben Sie wie das Politkasperle die böse Groko Hexe besiegt,  um dann mit ihr Verlobung zu feiern. Trauzeugen werden ausgelost! Wählen sie uns, die anderen sind genau so schlecht.“

Die Dunkelorangenen diskutieren mit sich selbst, welche Taktik angebracht sei um herauszufinden wer nun die 5% Klausel schafft – die Hellorangenen oder die Mittelorangenen. Ein Einziger (sieht Dunkelrotorange aus) schreit: „BürgerinBürger unterstützt die XYZ Aufbauorganisation, geht nicht wählen. Spendet zur Sanierung der Bundesparteizentralkasse.“

Ein Polizeieinsatzwagen fährt vorbei.  Der Polizeilautsprecher:

„Letzte Aufforderung an alle Arbeits- und Obdachlosen. Ab 16.00 tritt das tägliche Ausgehverbot in Kraft. Sie haben sich unverzüglich im zuständigen Bezirksarbeitslager einzufinden.“

Meine  Verwunderung über die Strategiedebatte in der Partei DIE LINKE; sie wird sicherlich wie so oft bei den Bestimmenden in dieser Partei keine Veränderung bewirken, nimmt jene grotesken Züge an, die ich in der österreichischen Politik erlebe. Eine nationalreaktionäre FPÖ hat nach reichlichen Skandalen noch immer mehr Zuspruch beim jenen die abhängig beschäftigt sind, während die Sozialdemokratie mit einem „weiterso“ jenen Niedergang dokumentiert, der in Deutschland und Österreich sich mehr und mehr der 5%Hürde nähert.

Die jetzige Strategiedebatte unterscheidet sich kaum von jenen Diskussionen, die in der Linken schon immer geführt wurden. Wer eine Veränderung, eine Abschaffung dieses nichtmeinen Gesellschaftssystems zwar in sein Programm schreibt um dann „mitzuregieren“, der wird, so zeigt es die Entwicklung, auf Dauer kaputt gehen. Wer sich den jetzigen „ParteiParlamentsspielregeln“ unterwirft, seine Existenz letztendlich einem Mandat verdankt, das den Spieregeln dieser kapitalistischen Gesellschaft entspricht,  trägt nur zu jener Entwicklung bei, die wir jetzt erleben. Das zum Beispiel in Österreich der 12 Stundentag Gesetz ist, der Widerstand gegen diesen Arbeitszeitwahnsinn unwirksam blieb, zeigt doch deutlich wie wenig  Organisationen wie Gewerkschaften, Parteien, soziale Netzwerke wirken um den notwendigen Widerstand zu entwickeln.

Die Partei DIE LINKE. hat in der Zwischenzeit eine Qualität der „Parteitagsinszenierung“ erreicht, die keine Unterscheidungen gegenüber dem Rest der Parteien in diesem nichtunseren Land erkennen lässt.  Wie lächerlich das schon klingt, wenn man, mal wieder, die Endlosspruchschleife  „Wir sind anders, Wir werden die Welt retten!“  noch dazu mit zum Teil jämmerlichster Rhetorik auf die Parteitagslandschaft niederprasseln lässt.

Man erkennt, hier trifft das die Macht habende Parteiestablishment auf das schlecht vorbereitete Parteivolk, dass nicht am Tropf des Parlamentarismus hängt. Hier erlebt man

die bürgerliche Gesellschaft.  Ja es ist eine Zusammenkunft derer, die über Arbeitsplätze in der Partei und Fraktion entscheiden, mit denen, die froh sind hier und dort untergekommen zu sein. Gar nicht gefragt sind jene, die, sprachlich und politisch erbärmlich, noch  den Anschluss zum Apparat suchen. Das alles haben viele von uns, immer machtvoller und ausgeprägter erlebt, seit den Tagen der WASG mit Fortsetzung in der Zusammenschlusspartei Die Linke.

Die AKL verkündet SEIT LANGER Zeit so oder ähnlich:

„Wir stehen für eine Partei, in der Pluralität, Offenheit, Inklusion, Demokratie, Mitgliederbeteiligung keine Worthülsen sind. Wir werben für eine Parteiführung, die nicht in Programmen das eine unterstützt und im Alltag das Andere verkündet oder gar umsetzt. Mit dieser Praxis muss Schluss sein. Sie frustriert Mitglieder, Symphatisantinnen sowie Bewegungen und präsentiert DIE LINKE in der Öffentlichkeit als eine Partei, die so funktioniert wie die anderen Parteien auch: von oben nach unten. Unsere Politik des Widerstandes und der Selbstbestimmung ist bunt, radikal, phantasievoll und manchmal auch widersprüchlich. Sie entspricht in keiner Weise den glatten Konzepten und technokratischen Modellen der bürgerlichen Parteien. Aber sie hat all diesen etwas voraus: sie ist Leben.“

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Niemand hier und keiner da.

Stehen? Für eine Partei? Als Antikapitalist liegt man doch schon lange am Boden und ist der Fußabtreter für jene, die mit blankgeputzten Schuhen gar nicht abwarten können mit der SPD Seit an Seit zu schreiten. Dass die AKL nun endgültig zum Komplettanhängsel der Partei Die Linke. werden will und für einen Beitritt in die Partei wirbt, ist das Signal für jene, die eine Politik des Widerstandes und der Selbstbestimmung bunt, radikal, phantasievoll und manchmal auch widersprüchlich haben wollen, sich aus dieser Partei der Versöhnung mit den gesellschaftlichen Gegebenheiten zu verabschieden.

Alle haben sich schon vor Jahrzehnten vom Grundwiderspruch zwischen Kapital und abhängiger Beschäftigung verabschiedet und wollen mit einer Gießkanne den Kapitalismusgroßbrand löschen, bei dem zum Schluss höchstens die reiche Minderheit überleben wird.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen        :

Oben           —     „Demo für Alle“

Urheber Foto: Bernd Schwabe      /  Quelle     —     Eigenes Werk

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.


Unten            —          Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom

Autor    :     Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg
  • Created: 2014-05-10 13:18:56.

Abgelegt unter Bayern, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Die Linke aus Bayern

Erstellt von DL-Redaktion am 12. Januar 2020

Vertrauen ist gut, rote Haltelinien besser

Von   Johannes König

Der Parteivorstand lädt ein zur großen Strategiedebatte. Ein Plädoyer für Pluralismus, (neue) rote Haltelinien und Lernen aus Fehlern

Die Gründung der LINKEN ist historisch eng mit der Agenda 2010 und dem Kriegskurs der rot-grünen Bundesregierung unter Gerhard Schröder verbunden. Daraus ergab sich die Notwendigkeit einer neuen gesamtdeutschen Sammlungspartei, die allen eine politische Heimat bieten soll, die sich links von SPD und Grünen verorten. Die politische Vielfalt, die sich unter dem gemeinsamen Dach der LINKEN vereinigt, gehört somit zu ihrer Identität. In der Praxis zeigt sich, dass im Pluralismus Stärken genauso wie Schwächen liegen. Zwar ist eine Bündelung aller linken Kräfte, die gegen Neoliberalismus und Rechtsruck kämpfen, heute angesichts der gesellschaftlichen Kräfteverhältnisse mindestens so dringlich wie im Gründungsjahr 2007. Gleichzeitig zeigen aber vor allem die letzten Jahre, dass wir unser Potential aufgrund von Innenwendung und parteiinternen Reibereien, die sich auch aus ebendiesem Pluralismus ergeben, nicht ausschöpfen konnten. Politische Energie wird nach innen verschwendet, während wir nach außen ein zerstrittenes und politisch inkonsistentes Bild abgeben. So hat denn auch der Niedergang der Sozialdemokratie der LINKEN kaum Gewinne eingebracht.

Der Grundkompromiss der pluralistischen LINKEN

Seit es DIE LINKE gibt, schlagen (mindestens) zwei Herzen in ihrer Brust. Antikapitalist*innen, die auf außerparlamentarische Bewegung als Grundlage für gesellschaftliche Veränderung setzen, gehören ebenso dazu wie Reformer*innen, die eine schrittweise Annäherung an eine sozialistische Gesellschaft im Rahmen einer Regierungsbeteiligung anstreben. Eine erfolgreiche Zusammenarbeit dieser beiden Pole (und allerlei dazwischen) ist kein leichtes Unterfangen, sondern bedarf Anstrengungen. Der Errungenschaft, die eine gesamtdeutsche plurale Linkspartei bedeutet, sollte man sich dabei bewusst sein.

DIE LINKE hat zur Frage der Regierungsbeteiligung – also dort, wo sich Positionen innerhalb der Partei mitunter am meisten unterscheiden – im Erfurter Programm einen Kompromiss festgeschrieben, der Regierungsbeteiligung nicht ausschließt, jedoch deutlich formuliert, was mit ihr auf keinen Fall zu machen ist: „An einer Regierung, die Kriege führt und Kampfeinsätze der Bundeswehr im Ausland zulässt, die Aufrüstung und Militarisierung vorantreibt, die Privatisierungen der Daseinsvorsorge oder Sozialabbau betreibt, deren Politik die Aufgabenerfüllung des Öffentlichen Dienstes verschlechtert, werden wir uns nicht beteiligen.“ Dieser Formulierung von roten Haltelinien ging eine intensive Programmdebatte voraus, die auch unter dem Eindruck der Politik in Berlin stand. Die PDS koalierte dort seinerzeit mit der SPD und verkaufte über 100.000 öffentliche Wohnungen an private Immobilienkapitalisten. Sie verlor innerhalb von zehn Jahren fast die Hälfte ihrer Wähler*innen. Das Meinungsspektrum in der Programmdebatte reichte dabei von Positionen grundsätzlicher Ablehnung von Regierungsbeteiligungen bis hin zur Befürwortung ohne nennenswerte Vorbedingungen. Einem Lager waren die formulierten Haltelinien nicht weitgehend genug, dem anderen zu streng, doch letztlich stimmten 95 Prozent aller Mitglieder in einer Urabstimmung für das Erfurter Programm und den darin enthaltenen Kompromiss.

Rote Haltelinien müssen zur verbindlichen Grundlage werden

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Gregor Gysi sagte 2017 in seiner Rede auf dem Hannoverschen Parteitag: „Ich weiß, dass wir dazu tendieren, 50 rote Haltelinien zu verabschieden, aber ich habe Vertrauen zu unserer Parteiführung und weiß, dass sie diese nicht benötigt.“ Tatsächlich ist das Gegenteil der Fall. Jede einzelne Landesregierung, an der DIE LINKE bisher beteiligt war, hat auf die ein oder andere Weise die roten Haltelinien des Erfurter Programms verletzt: 2017 stimmten die links mitregierten Bundesländer Berlin, Thüringen und Brandenburg im Bundesrat einer Grundgesetzänderung zu, die Privatisierung der Autobahnen ermöglichte. Der Berliner Senat verabschiedete 2018 eine „Schulbauoffensive“, die neben richtigen Investitionen gleichzeitig auch Privatisierungen von Schulgebäuden ermöglichte. 2019 schrieb schließlich die Brandenburger LINKE gemeinsam mit der SPD die Schuldenbremse in die Landesverfassung. All diese Regierungsbeteiligungen haben die roten Haltelinien des Erfurter Programms untergraben und somit der Glaubwürdigkeit der LINKEN als anti-neoliberale Kraft Schaden zugefügt. Auch 2020 drohen sich ähnliche Fehler zu wiederholen: Im Rahmen der ersten westdeutschen Regierungsbeteiligung der LINKEN in Bremen stehen derzeit Kürzungen im Krankenhausbereich an, während der Berliner Senat kürzlich zwei Drittel der Berliner S-Bahn ausgeschrieben hat, was aufgrund der wahrscheinlichen Zerschlagung bereits Proteste von Gewerkschafter*innen und Klimaaktivist*innen auf den Plan gerufen hat. Diese Erfahrungen zeigen, dass DIE LINKE dort, wo sie regiert, vonseiten SPD und Grünen (im Verbund mit Kapitalfraktionen und ihren Medien) unter großem Druck steht, neoliberale Politik mitzutragen. Dies hat wenig mit persönlichem Versagen, jedoch viel mit der systemischen Sogwirkung zu tun, der linke Regierungen im Kapitalismus grundsätzlich ausgesetzt sind. Die Notwendigkeit roter Haltelinien begründet sich daher nicht in einem „Misstrauen“ gegenüber der Parteiführung, sondern in einer realistischen Einschätzung der kapitalistischen Rahmenbedingungen.

DIE LINKE als antikapitalistische Klimapartei

Quelle          :           Der Freitag         >>>>>          weiterlesen


Grafikquellen        :

Oben        —       Die Linke Bayern / Creative Commons Lizens CC BY 2.0.

Fotomontage DL


Unten            —          Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom

Autor    :     Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg
  • Created: 2014-05-10 13:18:56.

Abgelegt unter Bayern, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

CDU Politiker schießt scharf

Erstellt von DL-Redaktion am 10. Januar 2020

Mann in Köln von Politiker angeschossen

Von Andreas Wyputta

In Köln schießt ein Lokalpolitiker einen 20-Jährigen an – und legt sein Mandat erst nach tagelangen Protesten nieder.

Der Kölner CDU-Lokalpolitiker, der Ende Dezember einen 20-Jährigen mit einem Schuss aus einem Revolver verletzt hat, lässt jetzt immerhin sein Mandat in der Bezirksvertretung ruhen. Das erklärte der Stadtverband der Christdemokraten in einer Mitteilung.

Kölns CDU-Parteichef Bernd Petelkau, der auch Vorsitzender der Stadtratsfraktion und Abgeordneter im nordrhein-westfälischen Landtag ist, betonte darin aber, es gelte „für die Beteiligten die Unschuldsvermutung“. Er hoffe auf schnelle Ermittlungsergebnisse, „damit rasch Klarheit entsteht, was sich tatsächlich zugetragen hat“.

Dem Lokalpolitiker, der für die Christdemokraten bisher in der Bezirksvertretung des Stadtteils Porz saß, wird vorgeworfen, einem 20-Jährigen in der Nacht vom 29. auf den 30. Dezember in die Schulter geschossen zu haben. Der 72-jährige Schütze soll dabei alkoholisiert gewesen sein. Auslöser der Schießerei am Porzer Rheinufer könnte ein banaler Streit über Lärm gewesen sein – um kurz nach Mitternacht soll sich der Christdemokrat von dem Opfer und dessen 21, 22 und 23 Jahre alten Begleitern gestört gefühlt haben.

In Onlinenetzwerken wird spekuliert, die Schüsse könnten auch einen rassistischen Hintergrund gehabt haben. Das Opfer habe einen osteuropäischen Migrationshintergrund, heißt es dort. Außerdem soll der Schütze auf Facebook regelmäßig rechtspopulistische, an das Umfeld der AfD erinnernde Beiträge geteilt haben.

Stadtbild Köln (50MP).jpg

Fünf scharfe Waffen

Im Haus des CDU-Senioren fand die Polizei fünf scharfe Schusswaffen. Der Mann, der vorübergehend festgenommen wurde, ist auch Sportschütze. Die Staatsanwaltschaft, die zunächst eine Mordkommission gegründet hatte, ermittelt mittlerweile nur noch wegen des Verdachts auf gefährliche Körperverletzung.

Quelle            :          TAZ          >>>>>          weiterlesen


Grafikquellen           :

Oben         —        Köln  –  Porzer Innenstadt

Autor      Arminia

  • CC BY-SA 3.0Hinweise zur Weiternutzung
  • File:Innenstadt-Köln-Porz.JPG
  • Erstellt: ‎9‎. ‎Oktober‎ ‎2004



 Unten             —     City center of Cologne, Germany.

 © Thomas Wolf, (CC BY-SA 3.0 DE)

Created: ‎28‎ ‎August‎ ‎2017

Abgelegt unter Innere Sicherheit, Köln, P.CDU / CSU, Regierungs - Werte, Überregional | Keine Kommentare »

Die Macht ist männlich

Erstellt von DL-Redaktion am 10. Januar 2020

„Nicht die Genossinnen müssen sich ändern, sondern die Spielregeln….“

Youth 2030 - The Image of the Future panel session2.jpg

Quelle        :         Scharf   —   Links

Ein Beitrag vom Sprecherinnenrat LISA NRW

2020 sind in NRW Kommunalwahlen. Hier lohnt sich ein Blick auf die bisherigen Strukturen:

  • Beim Frauenanteil an den Mandaten der Kreistage und der Gemeinderäte in NRW zeigen sich große Unterschiede: Während der Kreistag von Höxter mit 14 % den geringsten Frauenanteil hat, sind in Dortmund 39 % der Mandatsträger*innen weiblich. Insgesamt ergibt sich ein Schnitt von 30 % Frauenanteil in den Kommunalparlamenten in NRW. Die Höhe des Frauenanteils hängt übrigens nicht unbedingt davon ab, wie städtisch die Region ist. So weist Borken einen Frauenanteil von 38 % aus, in der kreisfreien Stadt Solingen lassen sich die Bürger*innen nur von 27 % Frauenanteil im Gemeinderat vertreten lassen.
  • In NRW regieren in 396 Kommunen Ober- oder Bürgermeister*innen und in 31 Landkreisen Landrätinnen und Landräte. In Zahlen: 45 der 373 Bürgermeister*innen sind weiblich. Unter den 23 Oberbürgermeister*innen gibt es nur eine Frau, in Köln. Die 31 Landkreise werden ebenfalls bis auf eine Ausnahme (Soest) von Männern regiert.

So überrascht es nicht, dass auf der ver.di-Landesbezirksfrauenkonferenz NRW folgender Antrag zur Abstimmung kam und angenommen wurde:

„Die Hälfte der Erde, die Hälfte des Himmels, die Hälfte der Macht – Parität auch im Parlament!

ver.di setzt sich für ein Paritäts-Gesetz mit verbindlichen Frauenquoten bei der Aufstellung von Wahllisten ein. Ein Paritäts-Gesetz soll alle Parteien verpflichten:

  • ihre Wahllisten abwechselnd mit einer Frau und einem Mann zu besetzen
  • weitergehend in ihren Statuten einen verbindlichen Frauenanteil von 50 Prozent für alle parteilichen Funktionen und Mandate aufzunehmen
  • bei den Direktkandidaturen im Wahlkreis/Stimmkreis Frauen und Männer in gleicher Zahl aufzustellen und auf chancenreiche Listenplätze zu setzen
  • eine innerparteiliche Kultur z.B. hinsichtlich Kommunikation, Sitzungsabläufen und Führungsverhalten zu fördern,  die es Frauen erleichtert und ermöglicht, Funktionen und Mandate zu übernehmen“

Wir beziehen uns auf die letzte Forderung des Beschlusses und überlegen, was das für uns als Partei bedeutet.

Frauen sind in der Politik unterrepräsentiert, sind weniger in Parteien aktiv bzw. erscheint ihnen politische Arbeit nicht attraktiv. Anders sieht es im Ehrenamt aus: Vor allem Frauen mit Kindern im Haushalt sind freiwillig engagiert. 54 % der Frauen zwischen 25 und 54 Jahren mit Kindern arbeiten ehrenamtlich – vor allem in Schule, KiTa, Religion und Kirche sowie im gesundheitlichen und sozialen Bereich. Bei den gleichaltrigen Männern sind es 52,2 %, auch mit Kindern im Haushalt. Hier sind es eher die Bereiche Sport, Politik, Unfall- und Rettungsdienst und bei der Freiwilligen Feuerwehr.

Ist also das Interesse von Frauen an Politik weniger ausgeprägt als bei Männern? Ein Blick auf die Wahlbeteiligung zeigt, dass diese These wenig aussagekräftig ist. Bei Kommunal-, Landtags- und Bundestagswahlen gibt es in der Wahlbeteiligung von Männern und Frauen keine großen Unterschiede.

Die Linke – eine feministische Partei?

Die Linke versteht sich als sozialistische und feministische Partei, die patriarchale und kapitalistische Verhältnisse überwinden will. So steht es im Programm. Wir Linke haben eine Vision einer gerechten Gesellschaft, die sich von allen anderen Parteien abhebt. Das gilt auch für unsere Vision der Gleichstellung von Frauen und Männern. Das heißt nicht, dass Frauen am herrschenden Männerbild gemessen werden, sondern Gleichstellung für alle und alles: Wir wollen Lebenszeit, Lohn- und Sorgearbeit, Zeit für Politik, Freund*innen, Bekannte, Familie und die eigene Weiterentwicklung gerecht zwischen den Geschlechtern verteilen. Dazu fordern wir eine radikale Verkürzung der Arbeitszeit für ein gutes Leben für alle.

Inhaltlich lässt das Programm also viel Raum für feministische Interventionen und politische Einmischung von Frauen: Aber: der Frauenanteil am 31.12.2018 beträgt 36 %, entspricht also nicht dem Anteil von Frauen an der Bevölkerung, der ca. 51 % beträgt. In NRW haben wir einen Frauenanteil von nur 29 %. Warum ist das so? Warum sind in der Linken weniger Frauen organisiert als Männer, warum wählen weniger Frauen die Linke?

Einschub: das gilt nicht für die Gewerkschaftsmitglieder: Hoffnungsvoll macht, dass bei den Bundestagswahlen 2017 10 % der männlichen Gewerkschaftsmitglieder die Linke gewählt haben und bei den weiblichen Gewerkschaftsmitgliedern 13 %. Das ist auch ein Ergebnis unserer Politik der vergangenen Jahre, bei der wir in Arbeitskämpfen präsent waren, wie etwa an Kliniken, bei denen wir mit für eine bessere Personalausstattung in Krankenhäusern gekämpft haben.

Um dem Anspruch gerecht zu werden eine feministische Partei zu sein, hat die Linke Instrumente entwickelt. Wir haben Doppelspitzen aus Frauen und Männern in der Bundestagsfraktion und in der Partei auf Bundesebene und in fast allen Ländern. Alle Gremien sind nach Geschlecht quotiert, wir führen quotierte Redelisten. Bei jedem Parteitag findet ein Frauenplenum der weiblichen Delegierten statt, bei der sich die Genossinnen über wichtige Punkte verständigen. Außerdem haben wir in fast allen Landesverbänden eine eigene feministische Struktur. Bei uns in NRW ist es LISA. In diesen feministischen Strukturen können sich Frauen vernetzen, kreativ sein, Spaß an der Politik haben und gemeinsam Projekte entwickeln.

Das alleine reicht allerdings nicht aus. Zwar werden Kreisvorstände quotiert gewählt – zur Not bleiben die sogenannten Frauenplätze frei – über Jahre. Hier gibt es Lücken, die zu schließen sind. Wir haben eine Satzung, die fortzuentwickeln ist. Nicht nur die Parteistruktur auch die Parteikultur muss feminisiert werden.

Was muss passieren, damit sich mehr Frauen in und für die Linke engagieren?

In NRW haben wir dazu Veranstaltungen gemacht und die Genossinnen folgendes gefragt:

  1. „In unserer Partei gibt es genügend Situationen, in denen Politik Spaß macht. Ich habe ausreichend Gelegenheit, mich konstruktiv einzubringen.“ Hier konnte gepunktet werden auf einer Skala von 1 bis 10. Die Punkte waren gleichmäßig verteilt zwischen 2 und 9 Punkten, also durchweg gemischt.
  2. „Politische Termine (Gremiensitzungen u.a.) sind so organisiert, dass ich sie gut und gerne wahrnehmen kann. Ich kann politisches Engagement gut in Balance bringen mit meinem Alltag und anderen mit wichtigen Themen.“ Hier wurde fast nur zwischen 0 (keine Zustimmung) und 5 gepunktet. Nur ein Punkt fand seinen Platz bei 8.
  3. „Ich finde die Regeln zur Gleichstellung wie Quotierung der Funktionen, quotierte Redeliste, offiziellen Sprachgebrauch sinnvoll und gut.“ Hier gab es nur Punktevergaben zwischen 8 und 10 (volle Zustimmung)
  4. „In der LINKEN erlebe ich eine feministische Kultur über die Formalien hinaus. Die Genossen verhalten sich meist emanzipiert. Ich erlebe wenig tradierte Verhaltensweisen wie männliche Dominanz (Gesprächsanteile, Mansplaining usw.). Die meisten Frauen bringen sich aktiv ein. Insgesamt erlebe ich die Gesprächs-/Debattenkultur als wertschätzend, partizipativ und solidarisch.“ Hier wurden alle Punkte gleichermaßen von 0 (keine Zustimmung) bis 5 gepunktet.

Was können Ansätze sein?

Wir wollen eine andere Sitzungskultur entwickeln. Wir brauchen eine Sitzungskultur, an der auch Frauen, die ja meistens zu Hause die Sorgearbeit erledigen, teilnehmen können. Da gibt es ganz profane Dinge wie eine Kinderbetreuung, die vorhanden sein muss. Und zwar eine gute Kinderbetreuung mit ausgebildetem Personal, vernünftigen Räumen und einem Spielplatz in der Nähe. Und die Genossen können an sich und der Debattenkultur arbeiten. Männer haben ja – nicht nur bei uns – auch die Angewohnheit, das zu widerholen, was die Vorrednerinnen gesagt haben oder sich nur auf Männer zu beziehen. Viele Genossinnen haben sich angewöhnt, dies auf den Sitzungen zu thematisieren. Es gilt, eine andere Sicht auf unsere Sitzungen und Veranstaltungen zu entwickeln. Noch immer gibt es Veranstaltungen, die nicht quotiert besetzt sind und bei denen dann eine Genossin als Moderatorin als Alibi genutzt wird. Dass muss aufhören. Wir haben genug fähige Genossinnen, die zu allen Themen Stellung nehmen können. Und Befähigung muss nicht an eine formale im Bildungssystem erworbene Qualifikation gebunden sein.

Wir schlagen vor, gemeinsam Methoden zu finden, die nicht mehr auf Konkurrenz  untereinander und Personalisierung von Erfolgen ausgerichtet sind, sondern auf Kooperation und Versachlichung. Dazu müssen wir gemeinsam neue Praxen entwickeln, die es Mitgliedern leicht machen gleichberechtigt mitzuarbeiten, sich dabei politisch zu entwickeln und nicht zuletzt auch Spaß an der politischen Arbeit zu haben. Hilfreich könnte dabei eine Enthierarchisierung der Arbeitsweise in der Partei wirken: Arbeitsgruppen statt aufgeblähter Vorstände, Mitglieder ermächtigen sich selbst für ein politisches Projekt….Die sozialen Bewegungen zeigen uns schon lange, wie so etwas geht.

Also: auch bei uns müssen die von Genossen über Jahrzehnte geprägten Strukturen verändert werden. Dazu gehören andere Sitzungszeiten, Angebote für Kinderbetreuung, ein Verzicht auf Hinterzimmerpolitik und eine kooperative Arbeitsweise. Nicht nur die Genossinnen, auch die Genossen können davon profitieren.

Und, was hat das alles mit unserer Strategie zu tun? Wir meinen sehr viel: Eine Partei, die ihre politischen Grundsätze nach innen umsetzt wirkt glaubwürdig, zieht Frauen (und Männer) an und verändert die Lebensrealität schon Stück für Stück durch ihre tägliche Praxis.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle           :       19th World Festival of Youth and Students. Youth 2030: The Image of the Future panel session

Abgelegt unter Linksjugend, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Zur Prostata-Früherkennung

Erstellt von DL-Redaktion am 9. Januar 2020

Prostata-Früherkennung: Hände weg vom PSA-Test

Quelle     :         INFOsperber   CH.

Von     Urs P. Gasche

Man weiss es schon lange: Der PSA-Test schadet mehr als er nützt. Dies bestätigt jetzt erneut das deutsche Qualitätsinstitut IQWiG.

Schon vor sechs Jahren hatte Infosperber über das informiert, was schon damals längst erwiesen war: «Der PSA-Test soll Prostata-Krebs frühzeitig erkennen. Doch die Risiken von Impotenz und Inkontinenz sind enorm. Viele Männer sind wegen PSA-Test unnötig impotent.»

Schon damals stützte sich Infosperber auf eine Einschätzung des «Instituts für Qualität und Wirtschaftlichkeit im Gesundheitswesen» IQWiG: Auf einen einzigen Mann, der dank einem PSA-Test vor dem Tod an Prostata-Krebs gerettet wird, kommen 36 Männer, die wegen eines PSA-Tests eine Krebsdiagnose erhalten, ohne von der Frühentdeckung zu profitieren. Einige von ihnen werden nach einer Bestrahlung und Operation impotent und inkontinent, ohne irgend einen Vorteil zu haben.

Aus diesen Gründen zahlen Krankenkassen weder in Deutschland noch in der Schweiz PSA-Tests zur Früherkennung von Prostata-Krebs. Ausser Urologen, die an den Prostata-Operationen verdienen, und einigen Hausärzten, die an den PSA-Tests verdienen, raten weltweit fast alle nationalen Gesundheitsbehörden und medizinischen Fachgesellschaften (ausser den Urologen) von PSA-Tests ab, wenn keine Symptome einer Prostata-Erkrankung vorliegen.

Trotzdem wollte die Urologen-Lobby in Deutschland, dass die dortigen Kassen PSA-Tests künftig bezahlen müssen. Aus diesem Grund hat das IQWiG die Vor- und Nachteile dieses Prostata-Screenings erneut beurteilt und die frühere Einschätzung bestätigt:

«Zwar nutzt das Screening einigen Männern, indem es ihnen eine Belastung durch eine metastasierte Krebserkrankung erspart oder verzögert. Im Gegenzug müssen aber deutlich mehr Männer wegen Überdiagnosen und Übertherapie mit dauerhafter Inkontinenz und dauerhafter Impotenz rechnen, und das in relativ jungem Alter.»

Vom Screening des Prostatakarzinoms verspricht man sich die Entdeckung von Prostatakarzinomen mit einem hohen Progressionsrisiko in einem heilbaren Stadium, um die die Zahl der Erkrankungen und die Sterblichkeit zu reduzieren.

Fragwürdiger Nutzen

Zwar bewahrt ein PSA-Screening – nach dem neusten Befund des IQWiG – statistisch 3 von 1000 Männern, die sich während 16 Jahren regelmässig einem PSA-Test unterziehen, vor dem Tod wegen eines Prostatakrebses. Doch an der Gesamtsterblichkeit der 1000 Patienten ändert sich nichts. Das heisst, 3 der 1000 Männer sterben im gleichen Zeitraum zusätzlich an einer anderen Todesursache. Es kann sein, dass Folgen der Überbehandlungen – infolge des PSA-Screenings – zum vorzeitigen Tod von drei Männern führt.

Erhebliche Schäden

Der PSA-Test führt

  1. häufig zu Verdachtsfällen, die sich in der Folge nicht erhärten lassen;
  2. zur Entdeckung von Krebszellen, welche den betroffenen Männern bis zu ihrem Tode nie Beschwerden verursacht hätten.

Im ersten Fall bedeute allein die Diagnose einer potenziell tödlichen Krankheit einen Schaden, erklären die IQWiG-Autorinnen und Autoren. Zudem machen Ärzte bei vielen dieser Männer mit einem erhöhten PSA-Wert Prostata-Biopsien, ohne dass diese Männer einen Nutzen davon haben.

Im zweiten Fall werden die Männer ohne Nutzen operiert. Komplikationen wie Inkontinenz und Impotenz sind in vielen Fällen irreversibel.

Schon frühere Studien hatten gezeigt, dass viele ältere Männer einen kleinen Tumor in der Prostata haben, der entweder gar nicht wächst oder nur so langsam, dass er nie Beschwerden verursachen würde. «Wenn man die Zellen der Prostata untersucht, hat fast jeder zweite Mann zwischen 50 und 60 Jahren ein Prostatakarzinom», stellte der Mannheimer Professor und Urologe Maurice-Stephan Michel bereits 2008 fest.

Wenn man diese Zellen dank Früherkennung entdeckt, kann man bis heute nicht feststellen, bei welchen wenigen Männern diese Zellen eines Tages zum Problem werden könnten. Deshalb werden nach der Entdeckung fast alle behandelt und operiert – die allermeisten ohne jeden Nutzen. Doch viele dieser Männer glauben dann fälschlicherweise, sie seien dank der Operation vom Krebs verschont geblieben.

Elf randomisierte kontrollierte Studien mit mehr 400’000 Teilnehmern ausgewertet

Die neue IQWiG-Nutzenbewertung eines PSA-Screenings beruht auf der Auswertung von elf randomisierten kontrollierten Studien mit mehr als 400’000 eingeschlossenen Teilnehmern (in der Regel Männer zwischen 55 und 70 Jahren, Beobachtungszeitraum zwischen 13 und 20 Jahre). In allen Studien verglichen die Studienautorinnen und -autoren ein Prostatakarzinomscreening mittels PSA-Test mit keinem Screening. Ein Resultat in Zahlen: 25 der oben genannten 1000 Männer bleiben wegen der nutzlosen Behandlungen dauerhaft impotent.

Swiss Medical Board: «Mehr Nachteile als Vorteile»

In der Schweiz war der von Pharma, Kassen und Urologen unabhängige «Swiss Medical Board» schon 2011 zum Schluss gekommen, dass der PSA-Test zur Früherkennung eines Prostata-Krebses mehr schadet als nützt. Mehr Vor- als Nachteile brächten PSA-Tests nur Männern mit familiärer Vorbelastung oder mit verdächtigen Symptomen [in diesen Fällen redet man nicht von Screening]. Der Swiss Medical Board wird von der FMH, der Akademie der Medizinischen Wissenschaften und von der Konferenz der kantonalen Gesundheitsdirektoren finanziert.

Deutsche Allgemeinmediziner distanzieren sich vom PSA-Test

Noch immer raten sowohl in der Schweiz als auch in Deutschland zu viele Hausärzte Männern zu einem PSA-Test. Doch die Deutsche Gesellschaft für Allgemein- und Familienmedizin rät in einer neuen Empfehlung ihren Mitgliedern davon ab, Männern eine Früherkennung mittels PSA-Wert aktiv anzubieten. Sollten Männer von sich aus danach fragen, sollten die Ärzte sie über Vor- und Nachteile gründlich aufklären.


Dazu frühere Informationen auf Infosperber:

1. September 2015, Urs P. Gasche:
«NZZ am Sonntag» schürt falsche Hoffnungen.

14. April 2015, Stiftung Warentest:
Prostata-Krebs: Ärzte beraten häufig ungenügend. Ein Stichproben-Test.

2. Januar 2015, Prof. Gerd Gigerenzer:
«NZZ», «Tages-Anzeiger» und «Bund» verbreiten eine Unstatistik über den PSA-Test als vermeintlichen Lebensretter.

14. September 2014, Urs P. Gasche:
Medizinisch unerklärlich viele Operationen. Bei vergleichbaren Diagnosen werden Männer in einigen Gegenden der Schweiz achtmal häufiger an der Prostata operiert als in andern. Mit verantwortlich sind die PSA-Tests und andere Methoden zur Früherkennung.

31. März 2013, Urs P. Gasche:
Viele Männer sind wegen PSA-Test unnötig impotent.

11. Oktober 2013, Urs P. Gasche:
PSA- und andere Tests: Verstehe ich, was der Arzt sagt? So erkenne ich irreführende Informationen.



© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.


Grafikquelle       :           Jürgen Windeler, Leiter des Instituts für Qualität und Wirtschaftlichkeit im Gesundheitswesen (IQWiG), August 2015

Abgelegt unter Bücher, Gesundheitspolitik, Medien, Überregional | Keine Kommentare »

Auf Sraßen und in Betriebe

Erstellt von DL-Redaktion am 9. Januar 2020

Das Konkrete und die Utopie verbinden

Quelle      :     Scharf  —   Links  

Autor*innenkollektiv: Edith Bartelmus-Scholich, Iris Bernert-Leushacke, Helmut Born, Nina Eumann , Sylvia Gabelmann, Michaele Gincel-Rheinhardt, Inge Höger, Ulla Jelpke, Daniel Kerekes, Alexandra Mehdi, Sonja Neuhaus, Jasper Prigge, Bastian Reichardt, Kathrin Vogler, Sascha H. Wagner, Marion Wegscheider, Hubertus Zdebel, Wolfgang Zimmermann

Unsere Vision ist eine Gesellschaft, in der Menschen gut und gerne leben und in der sie die Möglichkeit haben, an Entscheidungsprozessen teilzuhaben und Veränderungen mitzugestalten. DIE LINKE muss Motor dieser Veränderung und eines gesellschaftlichen Umbruchs sein. Das funktioniert nur dann, wenn wir unsere Politik gemeinsam mit denen, die unzufrieden mit dem Status Quo sind, entwickeln und nach außen tragen. Denn dort liegen unsere Wurzeln, unsere politische Verankerung. DIE LINKE muss sich auf diese Wurzeln rückbesinnen und (wieder) Marke für soziale Gerechtigkeit sein. Unsere Forderungen und Konzepte sind gut, aber nützen niemanden, der sie nicht kennt. Das heißt: Auf die Straße, in die Betriebe, in die Stadtteile  – für eine LINKE, an der man nicht vorbeikommt und eine Welt, die wir uns selbst erschaffen!

Die Arbeiter*innenbewegung war lange Motor des Fortschritts: in ihr drückten sich Hoffnungen und Zuversicht auf eine bessere Zukunft durch gesellschaftlichen Fortschritt aus. Diese Hoffnung ist Teilen der Arbeiter*innenbewegung im 20. Jahrhundert abhandengekommen und wir müssen die Lust auf Zukunft wieder entdecken: Im Kapitalismus bedeutet  technologischer Fortschritt Ersetzung von menschlicher Arbeit durch Maschinen, heute durch Roboter, Computer oder andere Systeme der Digitalisierung. Wir wollen die Technik nutzen, damit die Menschen sich von entfremdeter Arbeit befreien können. Als ersten Schritt dorthin setzen wir uns für eine Verkürzung der Arbeitszeit, die jede Form von Arbeit auf Alle verteilt, ein. Das ist momentan die Forderung nach der 30 Stunden Woche bei vollem Lohn- und Personalausgleich, die wir verbinden mit der Forderung nach Kontrolle der Produktion und Dienstleitungen durch die Beschäftigten. Dies ist der erste Schritt für die Übernahme der Betriebe durch die Beschäftigten.  Wir müssen Ängste vor Erwerbslosigkeit ernst nehmen, aber wir müssen zeigen, wie Digitalisierung und/oder Maschinen die gesamtgesellschaftliche Arbeitszeit reduzieren und somit die Grundlage einer Arbeitszeitverkürzung bei vollem Lohnausgleich für alle legen.

Die Krisenhaftigkeit des Kapitalismus spitzt sich zu. Ausbeutung von Menschen und Natur, Kriege und Umweltzerstörung bedrohen die Zukunft des Planeten. Als Folge erleben wir eine Erosion des etablierten Parteiensystems, sowohl in Deutschland als auch überall in Europa. Die bisherigen sog. Volksparteien verlieren bei fast allen Wahlen an Zustimmung. Die AfD & andere rechte Organisationen gerieren sich als Herausforderer der Regierungen und der bisher etablierten Parteien. DIE LINKE wird bisher kaum wahrgenommen als Partei einer solidarischen und demokratischen Lebensweise, die Antworten auf die krisenhafte Zuspitzung des Kapitalismus geben kann.

Wir erleben aber nicht nur ein Erstarken der Rechten, sondern auch ein Erstarken von Bewegungen und gesellschaftlicher Opposition. Millionen folgen seit Monaten den Aufrufen von „Fridays for future“. Sie demonstrieren und streiken gegen die Herrschenden und verlangen einen radikalen Politikwechsel um den Klimawandel abzuwenden. Sie lassen sich nicht mit schönen Worten abspeisen und haben so das Klimapaket der Bundesregierung sofort als Mogelpackung entlarvt. Hunderttausende gehen für Seebrücke und #unteilbar, für Menschenrechte und humanen Umgang mit Geflüchteten auf die Straße. Es gibt unzählige Initiativen gegen Rechts und der Aufschrei gegen die Aberkennung der Gemeinnützigkeit der VVN-BdA ist groß. Bis vor kurzem war es undenkbar, dass eine Kampagne zur Enteignung von Immobilienkonzernen von einer breiten Mehrheit in der Bevölkerung getragen und vorangetrieben wird. Gewerkschaftliche Kämpfe mit neuen Forderungen nach Arbeitszeitverkürzung, Mindestpersonalbemessung und Aufwertung von sozialen Berufen, die Frauen*streiks zeigen eine neue Qualität von Klassenkämpfen.

Es kommt nun für DIE LINKE darauf an, an diese Bewegungen anzuknüpfen und sie zusammen zu führen. Es geht um organisierende Arbeit – verbinden, verbreitern, verankern. Das ist gut gelungen in der Kampagne für bezahlbaren Wohnraum in Berlin oder bei der Frage der Personalbemessung in Krankenhäusern. Eine verbindende Klassenpolitik muss an den Alltagsbedürfnissen der Menschen ansetzen und auf unmittelbare Verbesserungen abzielen. Das betrifft betriebliche Kämpfe für bessere Arbeitsbedingungen und Arbeitszeitverkürzung ebenso wie Kämpfe um die Reproduktionsbedingungen wie Gesundheit, Wohnen und Ökologie. DIE LINKE muss in all diesen Kämpfen eine radikale Perspektive aufzeigen und klar sagen, dass wir die kapitalistische Ausbeutung von Mensch und Natur überwinden wollen. Klimaschutz und soziale Gerechtigkeit sind keine Gegensätze sondern Klimaschutz ist eine soziale- und eine Klassenfrage. Die kapitalistische Produktion beruht auf der Ausbeutung von Mensch und Natur und zerstört Klima, Boden, Luft, Wasser. Auch die industrielle Nahrungsmittelproduktion trägt mit zur Zerstörung der Umwelt bei. Die Produktion von immer mehr Autos und Rüstungsgütern nutzen nur den Konzernen und zerstören die Umwelt. Das Privateigentum an Produktionsmitteln und die Konkurrenz auf dem Markt müssen von uns in Frage gestellt werden. In den akuten Auseinandersetzungen und Kämpfen zeigen sich immer auch die verheerenden politischen und sozialen Zustände aber auch reale Alternativen, die über die konkreten Kämpfe hinauszeigen und reale Utopien sichtbar machen.

Eine linke Strategie muss darauf zielen, immer und überall für Schritte der Verbesserung der Lebensverhältnisse der Menschen einzutreten und die tagespolitischen Kämpfe mit der Schwächung der Machthabenden bzw. der Kapitalfraktionen zu verbinden. DIE LINKE muss in diesen Kämpfen immer wieder die Ursachen benennen und daran anknüpfen. Das heißt auch immer den Kampf für Verbesserungen mit der Eigentumsfrage verbinden bzw. mögliche Utopien aufzeigen. DIE LINKE muss gemeinsam mit Bewegungen jene Themen finden und setzen, die nicht nur das Leben der Vielen im hier und jetzt verbessern würden, sondern die auch das Potential eines Bruchs mit dem Kapitalismus in sich tragen. Die Verbindung des Konkreten mit der Eigentumsfrage und einer transformatorischen Utopie kann die gesellschaftliche Hegemonie nach links verschieben, das Zeigen nicht zuletzt die Kämpfe von Deutsche Wohnen Enteignen, Fridays for future und vieler weiterer Initiativ

  • Der Kampf gegen den Klimawandel ist nicht möglich, ohne die kapitalistische Produktionsweise, die Jagd nach Mehrwert und Profiten in Frage zu stellen. Sozial-ökologischer Umbau erfordert als einen ersten Schritt  die Verstaatlichung der Schlüsselindustrien, beginnend mit den Energie- und dann den Automobilkonzernen.
  •  Im Kampf gegen Kriege und Aufrüstung und Rüstungsexporte fordern wir ein Verbot der Rüstungsproduktion den Umbau der Produktion für zivile Produkte unter gesellschaftlicher Kontrolle.
  • Den Kampf gegen die Luftverschmutzung durch den Autoverkehr führen wir für autofreie Städte, den Ausbau des ÖPNV und die Vergesellschaftung der Automobilindustrie und die Umstellung auf die Produktion von Bussen und Bahnen.
  • Den Kampf für ein selbstbestimmtes Leben führen wir mit einer klaren Haltung gegen jegliche Form von Sexismus, LGBTQ-Feindlichkeit und Rassismus. Für eine Gesellschaft, in der Geschlecht, sexuelle Orientierung, sexuelle Identität, Herkunft und Religion keine Diskriminierungsmechanismen mehr sind.
  •  Den Kampf gegen Mietenwucher und für bezahlbares Wohnen führen wir auch als Kampf für ein konkretes Recht auf Wohnen, für die Enteignung der Immobilienkonzerne und für die Vergesellschaftung von Grund und Boden, für kommunale Wohnungen.
  • Den Kampf für mehr Personal in Krankenhäusern und der Pflege verbinden wir mit der Forderung nach Rekommunalisierung aller Krankenhäuser und Pflegeeinrichtungen, der Organisierung eines öffentlichen Gesundheitswesens unter gesellschaftlicher Kontrolle.

Mitmachen in Parlamenten kann diese Kämpfe nur unterstützen, aber nie ersetzten. Deshalb ist es auch notwendig, die Parlamente nicht als Mittel zur Veränderung der gesellschaftlichen Kräfteverhältnisse zu sehen, sondern den Klassencharakter des Staates und der parlamentarischen Gremien zu entlarven. Wir müssen neue Formen von Demokratie entwickeln und in unserer Partei erproben, selbstermächtigend, basis- und rätedemokratisch. Wir entwickeln Demokratie neu in Zukunfts-, Wirtschafts- und Umwelträten.

Connewitzer Kreuz.jpg

Auf dem Weg dahin müssen wir lernen, die Parlamente zur Unterstützung der außer-parlamentarischen Kämpfe zu nutzen. Wir sollten Aktive aus der Klima- und Umweltbewegung, Betrieben und Gewerkschaften, aus den Kämpfen gegen Mietwucher und für soziale Gerechtigkeit in die Parlamente auf Bundes- und Landesebene entsenden und zwar zeitlich begrenzt. Sie sollen ihre Kämpfe in die Parlamente tragen und anschließend wieder zurückkehren in die Bewegungen, die Betriebe und Kommunen. Abgeordnete sollen sich nicht in parlamentarischen Regeln und Geschäfts-ordnungen verfangen, sondern mit der Basis und an der Basis aktiv sein und entsprechend in Parlamenten wirken. Dies gilt in ähnlicher Form auch für unsere Kommunalparlamente.

Zudem müssen wir für eine Partei kämpfen, in der sich Menschen gerne organisieren. Dafür muss es zu einem Bruch mit althergebrachter Redekultur und Organisationsformen kommen. Nicht die monatliche Mitgliederversammlung oder ein – angeblich – allmächtiger Kreisvorstand dürfen der Ausgangspunkt aller Aktivitäten sein. Vielmehr müssen wir diese Organe als Diskussions- und Ermöglichungsrunden verstehen, die es Aktiven in Aktiventreffen und Basisorganisationen erleichtern, eine verbindende Klassenpolitik nach außen zu tragen. Zudem muss an einer Debattenkultur gearbeitet werden, die nicht in Verlier*innen und Gewinner*innen unterteilt, sondern die geprägt ist vom gemeinsamen Wachsen und Lernen und alle Genoss*innen, unabhängig von Alter und Geschlecht, ernst nimmt. Erst eine solche Parteikultur wird zu einer langfristigen Stärkung unserer Partei führen und ihr Leben verleihen.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikqellen :

Oben         —            Scharf  –  Links         –    Bildmontage   HF


Unten       —           Connewitzer Kreuz (Kopie von 1994, Anfertigung Markus Gläser, Original im Stadtgeschichtlichen Museum)

paternité partage à l’identique Ce fichier est disponible selon les termes de la licence Creative Commons Attribution – Partage dans les Mêmes Conditions 3.0 (non transposée).
Attribution: Martin Geisler

Abgelegt unter Medien, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Streit vor Fraktionsklausur

Erstellt von DL-Redaktion am 8. Januar 2020

Linke auch beim Klima gespalten

Von Malte Kreutzfeld

Umweltverbände loben das Klimakonzept der Linken. Doch Ex-Parteichef Klaus Ernst sieht darin „Autofeindlichkeit“ und fordert weitreichende Änderungen.

Wenn es um den Klimaschutz geht, war die Linkspartei schon immer breit aufgestellt: Während sie als Regierungspartei in Brandenburg jahrelang an der Seite der Kumpel gegen einen schnelleren Ausstieg aus der klimaschädlichen Braunkohle kämpfte, beteiligten sich viele Linken-Abgeordnete gleichzeitig an Anti-Kohle-Protesten im Hambacher Forst oder an den Braunkohle-Blockaden der Initiative „Ende Gelände“.

Während der Parteivorstand sich im vergangenen September mit den Protesten gegen die Automesse IAA solidarisierte, schaute Linken-Wirtschaftsexperte und Porschefahrer Klaus Ernst dort unter anderem neue Sportwagen an. Und je nachdem welche*r Abgeordnete sich äußert, ist ein CO2-Preis in Pressemitteilungen der Linksfraktion mal ein gerechtes und wirksames Instrument gegen den Klimawandel (“Einnahmen aus CO2-Bepreisung als ‚Öko-Bonus‘ zurückzahlen“), mal eine unsoziale und unwirksame Zumutung (Mitteilung von Klaus Ernst).

Bisher standen solche widersprüchlichen Positionen einfach nebeneinander. Doch bei der Fraktionsklausur der Linken, die an diesem Donnerstag und Freitag stattfindet, könnte es zum Showdown kommen. Denn dort steht endlich der „Aktionsplan Klimagerechtigkeit“ auf der Tagesordnung.

Dieses 80-seitige Papier war im Sommer von mehreren Abgeordneten, darunter der Klimapolitiker Lorenz Gösta Beutin und die Verkehrspolitikerin Sabine Leidig, erarbeitet worden. Im Oktober wurde es von einem der fünf Arbeitskreise der Fraktion, jenem für sozialökologische Transformation und Haushalt, verabschiedet. Anschließend sollte es eigentlich im November von der ganzen Fraktion beschlossen und parallel zu den Protestaktionen von Fridays for Future und Ende Gelände in der Bundespressekonferenz vorgestellt werden. Doch daraus wurde nichts: Nach Widerstand aus der Fraktion beschloss die Fraktion nur das einleitende Kapitel – über den Rest soll auf der Klausurtagung entschieden werden.

Und dabei zeichnet sich eine deutliche Kontroverse ab. Denn in der Umweltszene mag der Aktionsplan auf große Zustimmung stoßen: „Das Konzept bietet wirklich viele gute Lösungsansätze“, meint etwa Barbara Metz, stellvertretende Geschäftsführerin der Deutschen Umwelthilfe. Doch aus den Reihen der WirtschaftspolitikerInnen der Fraktion gibt es erhebliche Widerstände. Das zeigen zahlreiche Änderungsanträge, die der taz vorliegen. Neben der weitreichenden Forderung, ihn zu einem unverbindlichen Diskussionspapier herunterzustufen, gibt es zahlreiche konkrete Änderungswünsche: Bekämen diese eine Mehrheit, würden sie den Plan inhaltlich deutlich abschwächen und teils ins Gegenteil verkehren.

Besonders deutlich zeigt sich das beim Thema Verkehr. Hier fordert der Aktionsplan neben weniger und kleineren Autos unter anderem den „schrittweisen Übergang zum Nulltarif“ im Nahverkehr und ein „Verbot von Kurzstreckenflügen zu Orten, die in 5 Stunden mit der Bahn zu erreichen sind“. Alle diese Forderungen möchte der wirtschaftspolitische Sprecher Klaus Ernst streichen lassen. „Ich will beim Fliegen keine Verbote, sondern bessere Alternativen“, sagte er der taz. Kostenlosen Nahverkehr lehnt er mit dem Argument ab, dass das Geld für den notwendigen Ausbau „auch über die Ticketpreise reinkommen“ müsse.

Quelle         :          TAZ          >>>>>          weiterlesen

Zerwürfnis in der Linkspartei

Lagerkoller nicht erwünscht


Von Anna Lehmann

Auf der Fraktionsklausur der Linkspartei soll es harmonisch zugehen. Das brisanteste Thema, die Neuwahl des Fraktionsvorstands, wird ausgespart.

90 Minuten am Freitagnachmittag hat sich die Linksfraktion laut vorläufiger Tagesordnung auf ihrer Klausurtagung Zeit gegeben, um über Klimagerechtigkeit zu diskutieren. Gleich danach, um 13.30 Uhr, ist schon die Abschlusspressekonferenz gesetzt. Ein ehrgeiziger Zeitplan angesichts dessen, wie umstritten der Punkt ist.

Hält sich die 69-köpfige Fraktion auf ihrer diesjährigen Klausur also an selbst gesetzte Zeiten oder lässt sie, wie 2017, als die innerfraktionellen Spannungen eskalierten, die Journalisten bis kurz vor Mitternacht warten? Wohl kaum. Zum einen hat die Fraktion externe Gäste eingeladen: der Sozialwissenschaftler Oliver Nachtwey wird etwa über die Spaltung der Gesellschaft referieren, der Außenexperte Volker Perthes über die aktuelle Eskalation im Nahen Osten. Ein linker Familienkrach wäre fehl am Platz.

Und: Das brisanteste Thema steht nicht auf der Tagesordnung und wird auch nicht draufgesetzt, wie Fraktionssprecher Michael Schlick der taz bestätigte: die Neuwahl des Fraktionsvorstands. Seit November 2019 bemüht sich die Linke, ihren 13-köpfigen Vorstand zu komplementieren. Die Besetzung der Nachfolge von Sahra Wagenknecht mit Amira Mohamed Ali als neuer Fraktionsvorsitzender neben Dietmar Bartsch lief damals mit zwei Wahlgängen noch relativ glatt. Doch nachdem sich Mohamed Ali überraschend gegen ihre Mitbewerberin Caren Lay durchgesetzt hatte, verharrten die etwa gleichstarken Fraktionslager in Verbitterung und bescherten einander Wahlschlappen.

Auch im zweiten Anlauf im Dezember brachte weder die Fraktionsspitze ihren Kandidaten für den Vizeposten durch noch erreichte Nicole Gohlke, die die „Bewegungslinken“ repräsentiert, die erforderliche absolute Mehrheit. Auch der Posten der Beauftragen für soziale Bewegungen ist nach wie vor unbesetzt.

Persönliche Loyalitäten

Quelle        :          TAZ         >>>>>         weiterlesen

Gespaltene Linkspartei

Praktische Vernunft statt linker Ideologie

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Kommentar von Anna Lehmann

An überzeugenden Zukunftsvisionen für die großen Fragen fehlt es der Linkspartei derzeit. Dazu bräuchte sie eine neue Streitkultur.

An kritischer Analyse herrscht bei der Linkspartei kein Mangel. Partei und Fraktion haben gleich mehrere Wissenschaftler zu ihren Klausuren zum Jahresbeginn eingeladen, die den GenossInnen fundiert darlegen werden, warum die Gesellschaft sich weiter spaltet, die Arbeitskämpfe härter werden und die Lage im Nahen und Mittleren Osten eskaliert.

Am Ende werden die Linken wieder genau wissen, was alles schiefläuft in der Welt, und davon reden, dass es jetzt darauf ankomme, die Gesellschaft zu einen und Hass und Gewalt zu bekämpfen.

Stimmt. Allerdings kriegt das die Linkspartei nicht mal in ihren eigenen Reihen hin – Ideal und Wirklichkeit klaffen auseinander. In der Fraktion sind die Gräben derzeit so tief, dass es nicht gelingt, langweilige Formalien wie die Wahl des Vorstands geräuschlos und unspektakulär zu regeln. Abgebrühte werden sagen, so sei das nun mal bei Linken, sollen sie halt ihre Ansprüche runterschrauben. Aber so einfach ist es nicht.

Ja, die Linkspartei hat in den vergangen zweieinhalb Jahren nach außen vor allem ein Bild der Zerstrittenheit abgegeben. Katja Kipping stritt mit Sahra Wagenknecht und mit den beiden Spitzenfrauen: AktivistInnen, die offene Grenzen für alle fordern, mit jenen, die heimische Arbeitsmärkte gegen Konkurrenz schützen wollen, EU-Fans versus -KritikerInnen und nun eben radikale KlimaschützerInnen mit motorisierten ArbeitnehmervertreterInnen.

Zu wenige praktische Antworten

Quelle          :       TAZ            >>>>>           weiterlesen


Grafikquellen      :

Oben           —        Demo „Kohle stoppen! Klimaschutz jetzt!“ in Berlin, 1 december 2018 (COP24)

Abgelegt unter Berlin, P. DIE LINKE, Überregional, Umwelt | Keine Kommentare »

Keinen Krieg gegen Iran!

Erstellt von DL-Redaktion am 7. Januar 2020

Verhandeln statt eskalieren! Atomwaffen weltweit ächten!

B-53 Gravity Bomb - Flickr - brewbooks.jpg

Quelle        :          Scharf  —  Links

Von FiedensNetz Saar

Kundgebung am Mittwoch, 08.01.2020, 17 Uhr, St. Johanner Markt Saarbrücken

Mit dem völkerrechtswidrigen Angriff auf den Flughafen von Bagdad und der Ermordung des iranischen Generals Solaimani und des Vizekommandeurs der irakischen Volksmobilmachungskräfte al-Muhandi hat die US-Regierung eine unverantwortliche neue Eskalationsspirale ausgelöst. Manche sehen darin eine Kriegserklärung. Ein Krieg zwischen den USA und Iran hätte dramatische Folgen für den ganzen Nahen und Mittleren Osten – es droht ein Flächenbrand. Einziger Nutznießer ist die internationale Rüstungsindustrie.

Wir verurteilen jede militärische und politische Einmischung in andere Länder – ob durch NATO-Staaten, Russland, Israel oder den Iran. Die menschenverachtenden Stellvertreterkriege müssen beendet werden.

Jetzt muss es kurzfristig darum gehen, jede weitere Eskalation der Gewalt zu stoppen und Verhandlungen ohne Vorbedingungen aufzunehmen. Mittelfristig muss es zu einer Gesamtlösung für den Nahen und Mittleren Osten kommen, der multilaterale Abrüstungsschritte mit gegenseitigem Gewaltverzicht verbindet und zu einer atomwaffenfreien Zone in der Region führt. Gleichzeitig muss der brutale Krieg im Jemen so schnell wie möglich beendet werden. Die Waffenlieferungen aus Deutschland an kriegführende Staaten ist ein Skandal!

Wir sind solidarisch mit allen Kräften im Nahen und Mittleren Osten, die sich für eine demokratische und friedliche Zukunft einsetzen. Vor allem sie werden durch diese Eskalation und den drohenden Krieg geschwächt.

Wir fordern:

Die Bundesregierung und Außenminister Maas müssen auf das Schärfste gegen die Eskalation der Gewalt durch die US-Administration protestieren und beide Seiten auffordern, jede weitere militärische Handlung zu unterlassen. Auch von US-Stützpunkten in Deutschland, wie z.B. von der Airbase Ramstein oder dem EUCOM in Stuttgart, darf kein Krieg ausgehen. Die UNO muss den Angriff auf den Flughafen in Bagdad verurteilen.

Im Gegenzug zu diesem Gewaltverzicht muss die EU den faktischen Handelsboykott gegen den Iran mit geeigneten Maßnahmen unterbinden. Gleichzeitig verzichtet der Iran auf seine Pläne zur Urananreicherung zur Produktion bombenfähigen Materials.

Deutschland muss Nein sagen zum Krieg gegen den Iran. Sofortiger Abzug der Bundeswehr aus der Region.

Japanese bomb hits USS Enterprise (CV-6) flight deck during Battle of the Eastern Solomons, 24 August 1942 (80-G-17489).jpg

Schluss mit der Kriegsvorbereitung in unserer Region: Militärische Übungsflüge stoppen! Büchel muss atomwaffenfrei werden! Die militärische Drehscheibe für US-amerikanische Kriege in aller Welt in Ramstein muss geschlossen werden!

Abrüstung jetzt! Wir brauchen die Milliarden für Klima- und Umweltschutz – Für Bildung, Soziales und die Solidarität mit vor Krieg, Verfolgung und Not geflüchteten Menschen.

Die Welt braucht zivile Lösungen und keine neuen Kriege!

c/o Thomas Hagenhofer @ Waltraud Andruet                                                  Saarbrücken, 06.01.2020               

FriedensNetz Saar:

Für Spenden:

Friedens-Netz-Saar, Sparkasse Saarbrücken, IBAN: DE49 5905 0101 0610 5552 60, BIC: SAKSDE55XXX;

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen        :

Oben          —          It was sobering to see this. It is: „B-53 Gravity Bomb High-yield (multi-megaton) internally carried, heavy strategic, thermonuclear weapon. Status: retired This training unit is on loan to the Atomic Testing Museum from the United States Air Force.“ National Nuclear Security Agency We visited the Atomic Testing Museum wich is in the Frank H. Rogers Science and Technology Building, Las Vegas Nevada. This is the only area where photography is permitted – it is an extensive museum, primarily devoted to Nevada National Security Site (also known as Nevada Test Site). „Between 1951 and 1992, there were a total of 928 announced nuclear tests at Nevada Test Site. Of those, 828 were underground.“ (While this museum is affiliated with the Smithsonian – and presumably the US government, photography was permitted in only a very limited area, I would guess for security and also publicity reasons.) It seems tho me that that such a museum should be open access – but it’s not. jtz 217


Unten           —        A Japanese bomb explodes on the flight deck of USS Enterprise, 24 August 1942 during the Battle of the Eastern Solomons, causing minor damage. This was the third and last bomb to hit Enterprise during the battle. The bomb was dropped by a Japanese Aichi D3A1 „Val“ dive bomber piloted by Kazumi Horie who died in the attack. According to the original photo caption in the US Navy’s archives, this explosion killed the photographer, Photographer’s Mate 3rd Class Robert F. Read. This image, however, was actually taken by Photographer’s Mate 2nd Class Marion Riley, who was operating a motion picture camera from the aft end of the ship’s island, above the flight deck and who survived the battle although his photographic equipment was damaged. The film Riley took that day, and of which this still was extracted together with others and published in Life, can be seen at this Youtube link (explosion at 03:05). Robert Read was stationed in the aft starboard 5″ gun gallery and was killed by the second bomb to hit Enterprise. The smoke from the bomb explosion that killed Read can be seen in the upper left of this photograph. (Source: [1])

Abgelegt unter APO, Kriegspolitik, Saarland, Überregional | Keine Kommentare »

Die zornigen Zwanziger

Erstellt von DL-Redaktion am 5. Januar 2020

Der Generationenkonflikt

An ASEAN Youth Leader Asks Secretary Kerry a Question (10174729113).jpg

Eine Kolumne von

Die Konflikte, die wir erleben, drehen sich fast alle darum, ob Regeln und Gewohnheiten der Vergangenheit unverändert gelten sollen. Progressive haben dabei die mächtigste Kämpferin auf ihrer Seite: Zeit.

Menschen sind symbolgeil bis in ihre ältesten Kleinsthirnwindungen hinein, schon deshalb macht die neue Dekade einen Unterschied. Seit einiger Zeit kocht blubbernd der bestimmende Sound des neuen Jahrzehnts herauf: Die zornigen Zwanziger beginnen.

Diese Dekade wird, für diese Prognose braucht man keine hellseherischen Fähigkeiten, von Konflikten geprägt werden. Auf den ersten Blick wirken viele darunter wie Varianten eines klassischen Generationenkonflikts. Kein Zufall, dass die ikonische Figur des alten, weißen Mannes vor einiger Zeit ins öffentliche Bewusstsein geriet. Im März 2019 schrieb Bernd Ulrich in der ZEIT: „1968 war ein Kindergeburtstag – verglichen mit dem beginnenden Generationenkonflikt.“

Das 20. Jahrhundert kollidiert mit dem 21. Jahrhundert

In den vergangenen Wochen gab es eine Menge Anzeichen dafür, dass das Alter eine wesentliche Rolle bei den Konflikten spielt, die sich bezeichnenderweise alle rund um Netz- und Medienereignisse drehten und in erster Linie in sozialen Medien ausgetragen wurden:

  • Das weltweite Strohfeuer der Wendung „Ok Boomer“.
  • Die Aufregung um einen vorweihnachtlichen Tweet von Fridays for Future über demnächst sterbende Großeltern.
  • Ein satirisches Liedchen einer WDR-Sendung, in dem eine fiktive Oma als „Umweltsau“ bezeichnet wurde.

Obwohl sich die jeweiligen Aufregungen unterschieden, schienen die Spannungen zwischen Alten und Jungen das wiederkehrende Muster zu sein. Ich glaube nicht, dass wir einen klassischen Generationenkonflikt vor uns haben, wie es ihn schon oft und eigentlich ständig gab – sondern einen Konflikt der Epochen. Holozän versus Anthropozän, um gleich dickstmöglich aufzutragen. Oder etwas kleiner, nachvollziehbarer: Das 20. Jahrhundert kollidiert mit dem 21. Jahrhundert.

Konflikte über die Gültigkeit von Regeln aus einer vergangenen Epoche

Historiker sprechen vom „langen 19. Jahrhundert„, weil es eigentlich erst mit dem Ausbruch des Ersten Weltkriegs 1914 endete. Ich schlage vor, künftig vom „viel zu langen 20. Jahrhundert“ zu sprechen, das in seinem egozentrischen Furor nervig bis in die Zwanzigerjahre rein ragt.

Die Konflikte, die wir erleben, drehen sich fast alle darum, ob Regeln und Gewohnheiten des vergangenen Jahrhunderts weiterhin unverändert gelten sollen. Oder man nicht neu nachdenken sollte, was vielleicht einmal richtig war oder schien, aber jetzt falsch geworden ist.

Vordergründig ist es leicht, den Kampf zwischen Holozänikern und den Anthropozän-Leuten als Generationenkonflikt zu begreifen, und ganz falsch mag das nicht sein. Aber die Grenzen sind viel stärker verwischt. Es sind ja nicht nur die Alten, es sind ja auch und manchmal vor allen anderen die Mittelalten, die heute vielleicht zwischen 35 und 55 Jahre alt sind.

Es handelt sich um eine Alterskohorte, die bei ihrem persönlichen Fortkommen oft viel Zeit und Arbeit investiert hat in gesellschaftliche Strukturen, die sich gerade verwandeln, verschieben oder untergehen.

Die eher bürgerlich orientierten Leute, die Banklehren gemacht haben oder Journalistik studierten, die von Sportwägen träumten oder auf eine Kreuzfahrt sparten, die Karriere machten oder zumindest ihr Leben danach ausrichteten, weil die große Überbotschaft des Bürgertums im ausgehenden 20. Jahrhundert war: Du bist dein Job.

Woraus leicht eine sehr materiell fixierte Haltung entsteht, wenn man nicht aufpasst. Die Überbetonung des Dinglichen, in einer Zeit, in der das Nichtdingliche, das Virtuelle, das Digitale offensiv und rücksichtslos voranschreiten.

Kampf gegen die Insignien von Erfolg und bürgerlichem Glück

Plötzlich kommen von überall her Leute, die die Insignien von Erfolg und bürgerlichem Glück aus dem 20. Jahrhundert nicht nur ignorieren, sondern ablehnen oder sogar bekämpfen.

Wp10 20110115 IMG 9974.jpg

Und es sind eben nicht nur die Jungen, sondern auch die Menschen, die schon in den vergangenen 20, 30, 40 Jahren weniger mit der Konsum- und Karrieregesellschaft anfangen konnten.

Denen es leicht fällt, den Sportwagentraum aufzugeben, weil sie ihn genau genommen noch nie träumten. Die zornigen Zwanzigerjahre werden geprägt sein von den Abwehrkämpfen derjenigen, die ihre Mühen noch in die Gesellschaft des 20. Jahrhunderts investiert haben.

Die echten Konflikte erscheinen zu schmerzhaft, um sie ernsthaft zu diskutieren

Quelle       :          Spiegel-online        >>>>>         weiterlesen


Grafikquellen      :

Oben          —            A student asks U.S. Secretary of State John Kerry a question during a Youth Leaders meeting in Bandar Seri Begawan, Brunei, before the U.S.-ASEAN Summit meeting begins on October 9, 2013. [State Department photo/ Public Domain]


Unten          —        Sascha Lobo; 10 Jahre Wikipedia; Party am 15.01.2011 in Berlin.

Abgelegt unter Bildung, Kultur, Positionen, Überregional | Keine Kommentare »

Die Sonntags – Frage

Erstellt von DL-Redaktion am 4. Januar 2020

Wir alle sind Umweltsäue


Von Peter Unfried

Die „Umweltsau“-Debatte der vergangenen Tage verhüllt das eigentliche Kernproblem. Was wir aus ihr trotzdem für das Jahr 2020 mitnehmen können.

Die politische Großdebatte der vergangenen Tage war eine mutmaßlich mehrheitlich geheuchelte „Spektakelpolarisierung“ (Bernhard Pörksen) wegen eines Kinderchors, der in einer Fernsehsatire „Unsere Oma ist’ne alte Umweltsau“ sang. Dennoch kann man das nicht lapidar damit abtun, dass das eh gaga oder nur Twitter sei.

Diese „Umweltsau“-Debatte steht pars pro toto für die Verhüllung des Kernproblems (Klima­krise), die strategische Instrumentalisierung und Beförderung dysfunktionaler Gesellschaftsgespräche durch Gegner von Klimapolitik und die deshalb drängende Lösung der gesellschaftlichen Kommunikationskrise.

Es zu machen, wie Helmut Kohl Europa machte – volle Pulle, aber nicht darüber reden –, geht nicht. Wir müssen ein ernsthaftes Gespräch über das zentrale Problem hinbekommen. Das ist der zu Ende gehende CO2-Speicherraum in der Atmosphäre durch unser aller fossil befeuertes Wirtschaften und Leben. Die Antwort ist eine demokratische Mehrheit für den politischen Wechsel ins postfossile Wirtschaften. Eine gesellschaftliche Mehrheit, nicht eine parteipolitische.

Nun ist Oma (und Opa) im alten Denken tatsächlich eine Umweltsau, wenn das für nicht zukunftsfähige Wirtschafts- und Lebensweise steht. Aber die Enkelin und der Enkel auch. Mutti und Vati. Christ und Muslim. Konservativer, Liberaler, Linker und Grüner. Ocasio-Cortez und Trump. Rassist und Diskriminierte. In der physikalischen Realität sind Europäer (fast) alle „Täter“. Deshalb ist der erste und wichtigste Schritt, die eingeübte Kultur des Spaltens in Gute und Böse abzulegen.

Selbstverständlich handelt es sich auch um einen Generationenkonflikt. Aber eben nicht kulturell oder ideologisch wie 1968 ff., sondern materiell. Das ist der Grund, warum Klimapolitik diese Dynamik bekommen hat; weil sie nicht mehr nur von privilegierten Minderheiten eines bestimmten politischen Spektrums (Ökos, Grüne) moralisch begründet wird, sondern von einem parteiübergreifenden Mainstream namens Fridays for Future als Verteilungskonflikt erkannt wurde.

Quelle          :         TAZ           >>>>>            weiterlesen


Grafikquellen       :

Oben       —        Peter Unfried

Abgelegt unter Köln, Medien, Überregional, Umwelt | Keine Kommentare »

Tanz mit dem Faschismus

Erstellt von DL-Redaktion am 3. Januar 2020

Schön bei der Leine halten – noch

File:Demonstration Chemnitz 2018-08-27.jpg

Quelle         :        untergrund-blättle CH.

Herausgegeben von einem Kollektiv antifaschistischer Gruppen.

Seit der letzten grossen Wirtschaftskrise vollzieht sich in vielen Ländern der Welt ein Rechtsruck. Im Windschatten dieser Entwicklung konnte auch die militante Rechte erstarken. In Deutschland äussert sich diese Entwicklung beispielsweise in den unzähligen Angriffen auf Geflüchtete und deren Unterkünfte. Zwar erübrigte sich deren Zweck mit dem Schliessen der europäischen Aussengrenzen und ihre Zahl nahm wieder ab, doch die BrandstifterInnen sind immer noch da. [1]

Weniger offensichtlich bildeten sich mit dem Aufschwung der rechten Bewegung immer mehr bewaffnete faschistische Gruppen. Wie viele es mittlerweile sind, kann wohl ausser dem Verfassungsschutz niemand sagen. Doch die Anzahl der Gruppierungen, welche in den letzten zwei Jahren aufgedeckt wurden, gibt zumindest einen verschwommenen Einblick. Der Mord an Walter Lübcke [2] und die Aufdeckung der Organisation „Nordkreuz“ [3] dürften den meisten noch am besten im Gedächtnis sein. Aber auch das Waffenlager in Hannover [4], der geplante Aufstand der Gruppe „Revolution Chemnitz“ [5] oder die Gruppe „Nordadler“ [6] sind ebenfalls Beispiele dieser Entwicklung.

Um die eigentliche Frage zu beantworten, muss allerdings auch ein Blick auf die gesamtgesellschaftliche Entwicklung geworfen werden. Die letzte grosse Wirtschaftskrise im Jahr 2007 brachte die kapitalistische Akkumulation weltweit ins Wanken. Im Vergleich zu den südeuropäischen Ländern waren die Auswirkungen der Krise in Deutschland verhältnismässig gering. In den südeuropäischen Ländern formierte sich ein massiver Widerstand innerhalb der Bevölkerung. Und auch wenn in diesem Fall alles wieder in systemkonforme Bahnen gelenkt worden konnte, zeigte die kämpferische Bewegung in Griechenland, wie schnell sich in Krisenzeiten Dynamiken entwickeln können.

Die Methoden zur Krisenbewältigung, welche den Laden beim letzten Mal gerade noch zusammen gehalten hatten, sind für die nächste Krise keine Option mehr. Die Auswirkungen der Krise wurden vor allem auf der Grundlage einer massiven Ausweitung der öffentlichen Verschuldung bekämpft. Die Zentralbanken setzten den Leitzins auf Null und kauften Staatsanleihen im Wert von mehreren Billionen Euro. Das Zinsniveau ist immer noch auf einem historischen Tief und die Staatsverschuldungen sind hoch. Damit verengen sich die ökonomischen Spielräume für die Lösung der nächsten zu erwartenden Krise. Darüber hinaus ist die Jugendarbeitslosigkeit in Südeuropa immer noch exorbitant hoch und viele Länder wie zum Beispiel Frankreich befinden sich in tiefen politischen Krisen.

Der nächste Crash wird kommen und er wird auch in Deutschland einschlagen. Durch die starke Exportorientierung ist das deutsche Kapital besonders abhängig von der Lage der Weltwirtschaft. Und so werden bereits jetzt Vorbereitungen für die nächste Krise getroffen. Durch die neuen Polizeiaufgabengesetze (PAG) werden die Befugnisse der Sicherheitsbehörden erweitert und der Überwachungsstaat ausgebaut. Auch die Umgehung demokratischer Mitbestimmung mittels der EU und die Einschränkung des Streikrechts zeigen, dass die herrschende Klasse auf den autoritären Staat setzt, um auch die nächste Krise zu überstehen.

Der diskrete Charme des Faschismus

Doch warum arbeitet die Bourgeoisie nicht gleich auf den Aufbau einer faschistischen Diktatur hin? Die Interessen des Kapitals gegen revoltierende Lohnabhängige lassen sich in der Krise doch wohl kaum besser durchsetzen als durch fanatische FaschistInnen. Doch genau darin liegt auch das Risiko für die Bourgeoisie. Sie muss hierbei einen Teil ihrer Macht an die FaschistInnen abgeben. Und dies ist für sie mit einigen Risiken verbunden.

Solange es den gemeinsamen Gegner – die organisierte ArbeiterInnenbewegung – gibt, können Widersprüche innerhalb der faschistischen Bewegung oder zwischen Kapital und faschistischer Bewegung überdeckt werden. Doch auch historisch war die erste Zeit nach der kompletten Zerschlagung der Arbeiterbewegung (ab Mitte 1933) in Deutschland durch Richtungskämpfe innerhalb der NSDAP-Elite geprägt. Die Politik der FaschistInnen war in weiten Teilen deckungsgleich mit den Interessen des Kapitals, trotzdem kam es immer wieder zu Konflikten. Sollten diese einmal zu gross werden, lässt sich eine parlamentarische Regierung letztlich deutlich leichter absetzen als eine faschistische Diktatur.

Und die FaschistInnen sind keineswegs blosse BefehlsempfängerInnen der herrschenden Klasse. Vereinfacht gesagt kann ihre Politik auch im Chaos und in der totalen Niederlage enden. Der unglaubliche Aufwand mit welchem die physische Vernichtung der JüdInnen betrieben wurde, war nicht unbedingt im Sinne der herrschenden Klasse. Im Gegenteil: Die Fokussierung der faschistischen Führung auf ihren antisemitischen Wahn mitten im zweiten Weltkrieg trieben Teile der herrschenden Klasse in eine oppositionelle Haltung zum NS-Regime, die bis hin zur Vorbereitung zum Tyrannenmord reichte.

Mögen die Gewinnaussichten noch so traumhaft sein, wenn die Überreste des Sozialstaats und der Gewerkschaften beseitigt sind, ist die herrschende Klasse langfristig doch darauf angewiesen, auf ein stabiles politisches System bauen zu können. Aus diesem Grund ist der Faschismus für die Bourgeoisie immer der letzte Notnagel in einer ansonsten ausweglosen Situation. Solange weniger risikoreiche Herrschaftsmöglichkeiten eine Option sind, wird sie auch auf diese setzen.

Für die heutige Lage schliessen wir daraus, dass der bürgerliche Parlamentarismus mit seinen Volksparteien zwar angezählt sein mag, aber immer noch funktioniert. Offensichtlich arbeitnehmerInnenfeindliche Politik wie die Hartz-Reformen oder die oben aufgezählten Entwicklungen lassen sich ohne grossen Widerstand durchsetzen. Die faschistische Bewegung wird deshalb nur von kleinen Teilen des Kapitals unterstützt. Konsequent bekämpft wird sie natürlich nicht, weil die grundlegenden Pfeiler des Kapitalismus durch die FaschistInnen niemals angetastet werden.

Schön bei der Leine halten – noch

Auf der Agenda der FaschistInnen steht zurzeit vor allem eins: Rache an den „Schuldigen“ der „Flüchtlingskrise“. In ihrem Weltbild kommen Geflüchtete nicht nach Europa, weil sie vor Krieg, Hunger und Armut flüchten, sondern aufgrund eines angeblichen Plans zum grossen „Bevölkerungstausch“. Demnach würden die Eliten der bürgerlichen Politik daran arbeiten, durch gezielte Zuwanderung die europäischen Völker unter Druck zu setzen, um willige ArbeitssklavInnen zu erhalten. Der Linken wird vorgeworfen die passende Hegemonie dazu herzustellen. Und so stehen neben Linken eben auch eine ganze Reihe bürgerlicher PolitikerInnen auf den Todeslisten der Nazis. Der Mord an Walter Lübcke und die Mordversuche an Andreas Hollstein [7] und Henriette Reker [8] zeigen diese Tendenz des Rechtsterrorismus. Die Verselbständigung der faschistischen Ideologie wird hier deutlich. Denn zumindest solange die bürgerliche Demokratie noch im Sinne der Herrschenden funktioniert, hat das Kapital kein Interesse an Angriffen auf politische MandatsträgerInnen. Aus diesem Grund werden die putschistischen Kräfte innerhalb der militanten Rechten eingebremst.

Mehr wird im staatlichen Kampf gegen rechten Terror aber auch nicht passieren. Solange FaschistInnen ihre Angriffe auf Linke und vermeintliche AusländerInnen beschränken, bleibt die Praxis von Polizei und Verfassungsschutz die gleiche wie schon vor der Selbstenttarnung des NSU. Die unzähligen ungeklärten Angriffe auf Geflüchtetenunterkünfte und linke Hausprojekte, sowie Übergriffe auf MigrantInnen sprechen für sich.

WirSindMehr Chemnitz Demonstration 2018.jpg

Ein Beispiel hierfür ist die Gruppe „Revolution Chemnitz“. Die Mitglieder waren schon jahrelang in verschiedenen rechtsradikalen Strukturen in Sachsen aktiv. Mindestens vier hatten bereits in der Gruppe „Sturm 34“ Erfahrung in Hetzjagden, Waffenbeschaffung und dem Aufbau terroristischer Organisationen gesammelt. Die Gruppe wurde 2006 unter Beteiligung eines Geheimdienstspitzels gegründet und wütete zwei Jahre lang in Sachsen. Obwohl mehrere Opfer lebensgefährliche Verletzungen davon trugen, musste niemand mit schweren Strafen rechnen. Christian Keilberg, der sowohl bei „Sturm 34“, als auch später bei „Revolution Chemnitz“ Führungsrollen übernahm, hatte seit 2006 zudem regelmässig Kontakt zum Verfassungsschutz.

Auch als „Revolution Chemnitz“ konnte die Gruppe unbehelligt Menschenjagden auf MigrantInnen veranstalten. Sie beteiligten sich unter anderem an den Ausschreitungen in Chemnitz im August 2018 und patrouillierten als „Bürgerwehr“ durch die Stadt. Erst aber, als sie mit konkreten Vorbereitungen für einen Putsch begannen, wurden sie von den Behörden als ernstzunehmende Bedrohung wahrgenommen. Im Oktober 2018 wurde die Gruppe schliesslich verhaftet. Diesmal waren aber nicht MigrantInnen das Ziel, sondern die Feierlichkeiten zur Wiedervereinigung in Berlin. Die FaschistInnen hofften durch den Terroranschlag einen Bürgerkrieg auszulösen und infolgedessen die Regierung zu stürzen.

Natürlich bekommen Polizei, Geheimdienst und Staatsanwaltschaften keine Anweisungen des Kapitals, ob und wann sie eine faschistische Terrorgruppe hochnehmen sollen. Dass die Polizeibehörden aber auf dem rechten Auge blind sind, ist kein Zufall. Zum einen legt das die Geschichte dieser Behörden nahe. Das Bundeskriminalamt (BKA) wies bei seiner Gründung genauso wie die Justiz oder der Verfassungsschutz eine grosse personelle und strukturelle Kontinuität zur Zeit des Faschismus auf. Aufgebaut wurde es von ehemaligen SS-Angehörigen. Diese Leute wurden in erster Linie für diese Aufgaben ausgewählt, weil sie stramme AntikommunistInnen waren und sind. Und zum anderen ist das aber auch die logische Folge einer ihrer grundlegenden Aufgaben innerhalb der bürgerlichen Gesellschaft, dem Schutz der herrschenden Eigentumsverhältnisse.

Der Umgang des Staates mit faschistischen Strukturen hängt aber noch von mehreren Faktoren ab. Wie gut ist die Organisation mit Spitzeln durchsetzt? Hat sie internationale Kontakte? Welche Aktionen plant sie im Einzelnen und wie konkret sind ihre Pläne? Für uns ist wichtig festzuhalten, dass dieser Staat niemals grundsätzlich gegen die faschistische Bewegung vorgehen wird. Einzelne Verhaftungen oder Verbote ändern daran nichts.

Auszug aus der Broschüre „Staat und Nazis Hand in Hand? Einschätzung zur Aktualität der faschistischen Gefahr in Deutschland“, herausgegeben von einem Kollektiv antifaschistischer Gruppen. Beteiligt sind die Antifaschistische Aktion Karlsruhe, Antifaschistischer Aufbau München, Antifaschistische Aktion (Aufbau) Stuttgart, Antifaschistische Aktion (Aufbau) Tübingen, Antifaschistische Aktion (Aufbau) Mannheim und Antifaschistische Aktion [o] Villingen-Schwenningen.


[1] Die Angriffe auf Geflüchtete und ihre Unterkünfte stiegen ab 2015 stark an. Für 2016 verzeichnet die gemeinsame Chronik der Amadeu Antonio Stiftung und Pro Asyl einen Höchstwert von 3.768 Angriffen. Danach sank die Zahl wieder von 2.285 in 2017 auf 1.434 in 2018. Für 2019 sind zum Zeitpunkt der Veröffentlichung dieses Textes 37 Übergriffe dokumentiert. Die Dunkelziffer liegt vermutlich für alle Jahre deutlich über den angegebenen Zahlen.

[2] Walter Lübcke war ein hessischer CDU-Politiker und bis zu seinem Tod Regierungspräsident im Regierungsbezirk Kassel. Durch Aussagen gegen Pegida-Anhänger erlangte er grössere Bekanntheit. Am 02. Juni 2019 wurde er mutmasslich durch den Faschisten Stephan Ernst getötet.

[3] Nordkreuz war zusammen mit Südkreuz und Westkreuz Teil des faschistischen Hannibal-Netzwerks. Im Rahmen der Ermittlungen gegen den faschistischen Oberleutnant der Bundeswehr Franco Albrecht im Sommer 2017 wurde die Struktur aufgedeckt.

[4] Im April 2019 wurden bei einem Faschisten in Hannover 51 Waffen, Munition, rund 100.000€ Bargeld sowie Nazi-Orden gefunden.

[5] Die faschistische Gruppe „Revolution Chemnitz“ wurde im Herbst 2018 festgenommen, nachdem bekannt geworden war, dass sie sich um halbautomatische Schusswaffen bemüht hatten. Sie waren schon in der Vergangenheit an faschistischen Attacken beteiligt und sollen für den 03. Oktober einen Angriff auf die „Einheitsfeierlichkeiten“ geplant haben.

[6] Bei der Gruppe „Nordadler“ fanden im April 2018 Hausdurchsuchungen statt. Sie hatten Listen mit persönlichen Daten von AntifaschistInnen sowie PolitikerInnen angelegt und sich in Chats über Waffen und mögliche Anschlagsziele ausgetauscht.

[7] Andreas Hollstein ist Mitglied der CDU und Bürgermeister der westfälischen Stadt Altena. Am 27. November 2017 stach ihm ein Mann mit einem Messer in den Hals und verletzte in gefährlich. Sein Motiv war die Politik gegenüber Geflüchteten des CDU-Mannes. Sie war ihm zu „liberal“.

[8] Henriette Reker ist parteilose Oberbürgermeisterin von Köln. Am Tag vor ihrer Wahl wurde sie bei einem Wahlkampftermin mit einem Messer angegriffen und schwer verletzt. Auch hier wurde die Politik gegenüber Geflüchteten als Motiv angegeben. Der Täter war ein früheres Mitglied der ehemaligen faschistischen Partei FAP.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikquellen         :

Oben      —        Demonstranten auf der von Pro Chemnitz angemeldeten Demonstration am 27.08.2018 in Chemnitz mit Flaggen und Transparent.

Author Lord van Tasm

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license


Unten        —         WirSindMehr Chemnitz Demonstration 2018

Abgelegt unter Opposition, Positionen, Sachsen, Überregional | Keine Kommentare »

Eskalation mit Ansage

Erstellt von DL-Redaktion am 3. Januar 2020

Connewitzer Kreuz.jpg

Connewitzer Kreuz

Aus Leipzig und Berlin:  Alko Kempen und Konrad Litschko

In Leipzig werden PolizistInnen angegriffen – und eine neue Debatte über linke Gewalt entbrennt. Einiges bleibt widersprüchlich.

Am Donnerstagmittag schaltet sich dann Bundesinnenminister Horst Seehofer in die Connewitz-Debatte ein. „Den brutalen Angriff auf Polizeibeamte in der Neujahrsnacht verurteile ich auf das Schärfste“, erklärt der CSU-Mann. „Diese Tat zeigt: Menschenverachtende Gewalt geht auch von Linksextremisten aus.“ Die Gesellschaft müsse „geschlossen“ hinter den PolizistInnen stehen.

Da also hat die Silvesternacht in Leipzig-Connewitz die Bundespolitik erreicht. Schon zuvor hatte Leipzigs Bürgermeister Burkhard Jung (SPD) von einem „heftigen kriminellen Gewaltausbruch“ gesprochen. Und Sachsens Innenminister Roland Wöller (CDU) kritisierte „bewusste und gezielte Angriffe auf Menschenleben“. Was war passiert?

Das freilich wurde auch am Donnerstag nicht gänzlich klar. Noch in der Silvesternacht hatte die Leipziger Polizei eine erste Darstellung veröffentlicht. Demnach hatten sich um Mitternacht mehr als 1.000 Menschen am Connewitzer Kreuz, einer zentralen Kreuzung des Stadtteils, versammelt. Gegen 0.15 Uhr seien dann PolizistInnen „massiv mit Steinen, Flaschen und Feuerwerkskörpern angegriffen“ worden. Einige Angreifer hätten versucht einen brennenden Einkaufwagen „mitten in eine Einheit der Bereitschaftspolizei zu schieben“. Dabei sei ein 38-jähriger Beamter so schwer verletzt worden, dass er das Bewusstsein verlor und im Krankenhaus „notoperiert“ werden musste.

Am Donnerstagnachmittag legte das sächsische LKA mit einer Mitteilung nach, mit mehr Details – und teils Abschwächungen. Demnach sei der brennende Einkaufswagen nur noch „in Richtung“ der Polizeibeamten geschoben worden. Beim Versuch, einen der Täter festzunehmen, seien drei Polizisten durch etwa 20 bis 30 teils vermummte Personen angegriffen worden. Die Täter hätten den Beamten die Helme von den Köpfen gerissen, diese zu Fall gebracht und „wirkten massiv auf sie ein“. Von einer Notoperation des schwer verletzten Beamten ist hier nun keine Rede mehr, sondern von einer stationären Krankenhausaufnahme. Auch die anderen beiden Beamten seien „nicht unerheblich verletzt worden“.

Und die Ermittler hängen den Fall hoch. Wurde wegen des Angriffs auf den 38-Jährigen zunächst wegen versuchten Totschlags ermittelt, wurde dies noch am Mittwochabend auf versuchten Mord hochgestuft. Und die politische Debatte nahm ihren Lauf.

Zwei Versionen: Wer hat recht?

Dabei schildern mehrere Augenzeugen die Vorgänge etwas anders. Demnach sei der als Polizeiauto dekorierte Einkaufswagen angezündet und rund 30 Meter von den Polizeieinheiten entfernt auf der Kreuzung abgestellt worden. Dies zeigen auch Fotos und Videos, die der taz vorliegen. Wenig später sei die Polizei aus einer kleinen Gruppe heraus mit Böllern beworfen worden. Als daraufhin PolizistInnen in die Menge stürmten, folgte die Situation, in der der Beamte angegriffen und verletzt wurde. Die Augenzeugen berichten, sie hätten gesehen, dass der Polizist seinen Helm noch trug, als er von Kollegen weggetragen wurde.

Auch blieb unklar, auf welche Weise und wie schwer verletzt der Beamte wurde. Ab Mittwochabend schrieben zahlreiche Medien unter Berufung auf Polizeikreise von einer schweren Ohrverletzung und weiteren Kopfverletzungen. “Leipziger Polizist fast das Ohr weggesprengt“, schlagzeilte Focus Online.

In Krankenhauskreisen zeigte sich man sich verwundert über diese Darstellung und die Polizeimeldung von einer „Notoperation“. Von dort erfuhr die taz, dass es einen Eingriff an der Ohrmuschel des Beamten unter lokaler Betäubung gegeben habe. Der Mann sollte demnach am Donnerstag oder Freitag wieder entlassen werden. Lebensgefahr oder drohender Gehörverlust hätten nicht bestanden.

„Rabiates Vorgehen“ der Polizei

Auch die Linken-Landtagsabgeordnete Juliane Nagel, die ihr Büro direkt am Connewitzer Kreuz hat und dort Silvester verbrachte, hat Fragen. Sie habe sowohl Angriffe auf Polizisten als auch „rabiates Vorgehen“ der Polizei erlebt, sagt sie der taz. Immer wieder seien Polizeigruppen in Menschentrauben gelaufen, hätten dabei Personen umgerannt und verletzt. Daraufhin sei die Polizei beworfen worden.

2016-12-16 Juliane Nagel (Landtagsprojekt Sachsen) by Sandro Halank.jpg

Nagel spricht von einer „Eskalationsspirale“, die „durch eine waghalsige Einsatzstrategie befeuert wurde“. Anders als in den Vorjahren habe die Polizei nicht auf Deeskalation gesetzt. „Der Polizeipräsident trägt hier klar Verantwortung.“

Jener Polizeichef, Torsten Schultze, hatte zuvor klare Worte verloren. „Polizeibeamte sind Menschen. Es ist erschreckend, wie skrupellos Personen in der Silvesternacht am Connewitzer Kreuz durch offensichtlich organisierte Angriffe schwerste Verletzungen von Menschen verursachen. Es gibt keine rechtsfreien Räume.“ Bemerkenswert: Schultze benannte in seiner Mitteilung auch einen Kritiker, den linken Aktivisten Marco Bras dos Santos, namentlich. Dass dieser via Twitter die Angriffe rechtfertige, sei „erschreckend“.

All dies wirkt wie eine Eskalation mit Ansage. Schon seit Wochen verüben mutmaßlich Autonome in Leipzig Straftaten: Sie zündeten Baukräne an, attackierten Polizisten, griffen im November auch eine Immobilienmaklerin an. Polizeichef Schultze, seit Jahresbeginn 2019 im Amt, setzte wiederum auf eine harte Linie gegen die Szene. Und im Dezember richtete das LKA eigens eine „Soko Linx“ ein, um linke Straftäter aufzuspüren. Sie ermittelt nun auch zur Silvesternacht.

Schatten des Wahlkampfs

Quelle         :        TAZ          >>>>>        weiterlesen


Die Debatte Debatte um die Gewalt an Silvester in Connewitz

Beide Seiten kritisieren

File:Police brutality at Nigerian Embassy protest.jpg

Prügeln bis der Arut kommt ?

Kommentar von Tobias Schulze

Wer nach den Silvester-Ausschreitungen von Leipzig-Connewitz eine differenzierte Debatte führen möchte, braucht ein dickes Fell.

Auf Twitter kassieren User, die die Polizeistrategie hinterfragen, Beleidigungen und Drohungen. Der Polizeipräsident persönlich bezeichnet Kritik an seinen Leuten in einer Pressemitteilung als „erschreckend“. Teile der CDU werfen insbesondere der Linkspartei vor, sie verharmlose und dulde Gewalt. Ein mehrdimensionaler Blick auf die Ereignisse von Connewitz? Scheint derzeit so akzeptiert wie eine Mitgliedschaft in der RAF.

Dabei ist es kognitiv eigentlich gar nicht so schwer, sowohl die gewaltaffinen Randalierer als auch die staatlichen Gegenmaßnahmen zu kritisieren. Dass in Leipzig Teile der linksextremen Szene auf Gewalt an Silvester hinfiebern, ist zu verurteilen. Es greifen in diesem Fall noch nicht mal die gängigen linksextremen Rechtfertigungsmuster für politische Gewalt – sei es das der Notwehr oder das des Generierens von Aufmerksamkeit. Aus dem Spek­trum der demokratischen Parteien heraus gibt es schon gar keine Unterstützung für die Täter.

Quelle          :      TAZ          >>>>>         weiterlesen


Grafikquellen      :

Oben           —         Connewitzer Kreuz (Kopie von 1994, Anfertigung Markus Gläser, Original im Stadtgeschichtlichen Museum)

paternité partage à l’identique Ce fichier est disponible selon les termes de la licence Creative Commons Attribution – Partage dans les Mêmes Conditions 3.0 (non transposée).
Attribution: Martin Geisler


2.) von Oben      —      Juliane Nagel (Die Linke)

Abgelegt unter Kultur, P. DIE LINKE, Sachsen, Überregional | Keine Kommentare »

36. Chaos Communication C.

Erstellt von DL-Redaktion am 26. Dezember 2019

Programm-Empfehlungen aus der Redaktion

34C3 (41570976181).jpg

Quelle        :      Netzpolit8ik ORG.


Zwischen den Jahren findet der 36. Congress des Chaos Computer Clubs statt. Wir haben uns durch das Programm gearbeitet und ein paar Vorträge zusammengestellt, die in den Themenbereich von fallen. Als kleine Orientierungshilfe für Anwesende und Zuhausegebliebene.

Alle Jahre wieder steht Ende Dezember nicht nur das Weihnachtsfest sondern auch der Chaos Communication Congress bevor. Unter dem Motto „Resource Exhaustion“ werden sich zwischen den Jahren wieder mehrere Tausend Hacker:innen in Leipzig versammeln. Das Programm ist wieder sehr umfangreich und vielseitig und deshalb haben wir hier ein paar Empfehlungen zusammengestellt, die das Zurechtfinden im Programm erleichtern.

Diese Liste ist nicht vollständig und wir legen jeder und jedem ans Herz, sich den Fahrplan selbst genau anzusehen. Neben den Vorträgen gibt es auch zahlreiche Workshops, Kunstinstallationen und andere Veranstaltungen auf dem Messegelände. Wir haben die Talks unter Beteiligung unserer Redakteur:innen in einem anderen Artikel gesondert aufgelistet, der am 26. Dezember erscheint.

Wer nicht in Leipzig sein kann, kann alle hier gelisteten Vorträge im Livestream oder später als Video gucken.

Freitag, Tag 1

Am ersten Tag präsentieren Kai Biermann und Martin Haase ihre Auswertung der Sprache im Bundestag. Für ihren Vortrag “Vom Ich zum Wir – Gesellschaftlicher Wandel in den Reden im Bundestag“ um 14:10 nutzen sie das Tool von Zeit Online zur Auswertung der Plenarprotokolle des Bundestages.

Die Qual der Wahl gibt es um 23:30. Arne Vogelsang spricht über die gamingbasierte Strategien der radikalen Rechten mit Beispielen aus Deutschland und den USA. Titel: “Let’s play Infokrieg – wie die radikale Rechte (ihre) Politik gamifiziert“. Außerdem präsentiert Gabriella „Biella“ Coleman das Projekt Hack_Curio. Die Gruppe sammelt Videos von und über Hacker:innen. “Decoding the Cultures of Hacking One Video at a Time“.

Samstag, Tag 2

Um 14:10 geben Patrick „packi“ Stählin, Kire und Hakuna MaMate einen Jahresrückblick auf die Netzpolitik in der Schweiz: “Netzpolitik zwischen Bodensee und Matterhorn – E-ID, E-Voting, Netzsperren und andere netzpolitische Schauplätze“. Um 17:10 spricht Elisabeth Niekrenz über “Die Zukunft grenzüberschreitenden Datenzugriffs und politischer Verfolgung“ auf Basis des Cloud-Acts in den USA und der e-Evidence-Verordnung der EU.

Um 19:10 erläutert Ross Anderson die EU-Richtlinie, die Konsument:innen das Recht auf langfristige Softwareaktualisierungen gibt. Der Vortrag, der sich mit dem Nachhaltigkeitsaspekt davon beschäftigt, heißt “The sustainability of safety, security and privacy“. Um 20:50 geht es um “The Case Against Wikileaks: a direct threat to our community“. Renata Avila, Naomi Auerfeld und Angela Richter erklären die rechtlichen und politischen Probleme der Vorwürfe gegen Assange und WikiLeaks.

Zum Abschied des 2. Tages geben Laura Pöhler und Johnny Parks einen Rückblick auf die Debatte um Polizeigesetze und einen Ausblick auf die nächsten nötigen Schritte. Ihr Vortrag heißt “It’s alive! – Nach den Protesten gegen die Polizeigesetze ist vor den Protesten gegen die autoritäre Wende“

Sonntag, Tag 3

Eine Einordnung zur Frage des Einflusses des Internets auf die Gesellschaft nimmt Michael Kreil um 11:30 vor. Im Vortrag “Vom Menschen radikalisiert: Über Rassismus im Internet“ wird er außerdem Vorschläge machen, um das Phänomen des Rechtsrucks besser zu verstehen.

Um 16:10 sprechen Ulf Buermeyer und Thorsten Schröder über die Klage mehrerer Organisationen gegen ein Unternehmen aus der Überwachungsindustrie: „Rechtsbrüche beim Export von Überwachungssoftware“. Zur gleichen Uhrzeit widmen sich Florina Speth und Simon Hegelich in einem dialogischen Gespräch wichtigen Fragen im Spektrum von Künstliche Intelligenz und Kunst. Ihr Vortrag heißt “Mensch – Kunst – Maschine: Mit künstlicher Intelligenz zu neuer Kunst zum kybernetischen Verstand“.

Edward Snowden und der Menschenrechtsanwalt Robert Tibbo geben um 17:30 ein Update zur Situation des Whistleblowers und der Flüchtlinge, die ihn auf seiner Flucht unterstützt haben: “Human Rights at a Global Crossroads – Whistleblowers and the Cases of The Snowden Refugees and Edward Snowden“. Am Abend, um 22:50, sprechen Chloé Berthélémy und Thoas Lohninger von der Bürgerrechtsorganisation EDRi über “Content take-downs: Who cleans the internet? – EU Plans to swipe our freedom of expression under the carpet“. Und Thomas Lohninger bleibt gleich auf der Bühne, um um 23:50 über “5G and Net Neutrality – Status of the Net Neutrality Reform in Europe“ zu referieren.

Montag, Tag 4

Zur Mittagszeit um halb eins reden Walter Hözendorfer und Bijan Moini über die Fluggastdatenspeicherung der EU. Sie erläutern, wie die Daten verarbeitet werden und haben eine klare Forderung schon im Titel: „#NoPNR – Let’s kill the next Data Retention Law“.

Und zum Abschluss – zumindest was unsere Empfehlungen angeht – wird der Bundesdatenschutzbeauftragte Ulrich Kelber ab 13:50 über „Weichenstellungen – In welcher digitalen Welt werden wir leben?“ sprechen.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.


Grafikquelle          :          A photo by Billie Ward. (This work is licensed under a Creative Commons Attribution 4.0 International License. Please provide attribution and a link back to this web page in a manner that associates the image with the image credit.)

Abgelegt unter APO, Politik und Netz, Positionen, Sachsen, Überregional | Keine Kommentare »

Linkspartei reagiert kühl

Erstellt von DL-Redaktion am 26. Dezember 2019

Ex-SPD-Vize Stegner denkt laut über Fusion mit Linken nach

2018-04-22 SPD Bundesparteitag 2018 Wiesbaden-6669.jpg

Von – DPA

Wahlergebnisse und Umfragewerte bieten der SPD zur Zeit wenig Grund zur Freude. Könnte ein Zusammenschluss mit der Linken helfen? Ex-Parteivize Stegner kann sich das auf die Dauer vorstellen. Ein Vertreter der Linken winkt ab.

Schleswig-Holsteins SPD-Fraktionschef Ralf Stegner hat sich für einen mittelfristigen Zusammenschluss mit der Linken ausgesprochen.

„In den nächsten vier, fünf Jahren stellt sich das aber noch nicht“, sagte Stegner der Deutschen Presse-Agentur. „Aber auf Sicht nützt die politische Spaltung der demokratischen Linken nur den Konservativen und rechtsextremen Parteien.“

Der Erste Parlamentarische Geschäftsführer der Linksfraktion im Bundestag, Jan Korte, reagierte kühl: „Einmal die Woche muss Ralf Stegner vorkommen, mit irgendetwas. Diesmal mit Fusionsgerede, ohne irgendeinen Anlass“, sagte Korte der dpa. „Die SPD sollte lieber wieder auf die Beine kommen, und die Linke hat selber genug zu klären. Kurz: Ein typischer Stegner halt.“

Stegner sagte, die Wahrscheinlichkeit einer Fusion werde steigen, je mehr sich in der Linkspartei „der Wille zum Gestalten und Regieren durchsetzt und sektiererische Positionen zu Europa und Nationalismus nicht mehr vertreten werden“, sagte Stegner. Linke-Politiker wie Bundestagsfraktionschef Dietmar Bartsch und Thüringens Ministerpräsident Bodo Ramelow seien „vernünftige Leute“. Notwendig sei eine „zivile Debatte“ über eine Fusion von SPD und Linkspartei. „Ich empfinde es nicht als Normalzustand, dass die politische Linke aufgesplittert ist.“

Wir kommen schon – aus dem Saarland auch zu Fuß

Stegner wird dem linken Flügel der SPD zugerechnet. Der langjährige Landesvorsitzende aus Schleswig-Holstein war zudem bis Anfang Dezember stellvertretender Bundesvorsitzender.

FDP-Fraktionsvize Michael Theurer erklärte: „Herr Stegners Traum einer Fusion zwischen SPD und der Linken ist ein Alptraum für die hart arbeitende Mitte der Gesellschaft in Deutschland.“

Brandenburgs Ministerpräsident Dietmar Woidke (SPD) geht derweil trotz anhaltender Diskussionen über das Regierungsbündnis von Union und SPD von dessen Fortbestand aus.

Quelle        :        Berliner –  Morgenpost         >>>><           weiterlesen
Grafikquelle         :

Oben        —      Außerordentlicher Bundesparteitag der SPD am 22. April 2018 iim RheinMain CongressCenter n Wiesbaden

CC BY-SA 3.0 de


Unten       —          Als Gründerin der Kommunistischen Plattform wurde sie einst bekannt –


Abgelegt unter Berlin, P. DIE LINKE, P.SPD, Überregional | Keine Kommentare »

Eine Weihnachtsgeschichte

Erstellt von DL-Redaktion am 24. Dezember 2019

Die Legende vom Büderich oder 2019 Jahre schlechte Laune

Bethlehemkirche Meerbusch-Buederich.JPG

Von Manja Präkels

Eine Geschichte über den Büderich, der es nun wirklich sehr deutlich übertrieben hatte.

Der Flecken lag mitten im Dunkel, trotzig, rechtwinklig, in stiller Überschaubarkeit. Umgeben von Feldern ging ein schwaches Funzeln von ihm aus. Denn die Hauptstraße, entlang derer seine Bewohner alles fanden, was sie brauchten, war mit leuch­ten­den Sternen geschmückt. Haus an Haus reihten sich Bank, Bäcker, Fleischer, ein kleines Mode- und Schuhgeschäft (für Damen nur bis Größe 42!), ein Reformladen für die ökologisch Bewussten, ein Laden für die Trinker und Raucher sowie ein Pizzaimbiss mit Döner Hawaii im Angebot.

Alles und jeder hatte hier seinen Platz. Und wer keinen fand, ging fort. Denn dies ist der Lauf der Welt. Nur der Büderich, der hatte es zu weit getrieben. Der hatte seinen Platz verloren. Die Bäckerin öffnete ihren Laden allmorgendlich als Erste. Und kaum hatte die Kirchturmuhr viermal geschlagen, fanden sich die ersten Kunden ein. Allen voran die alte Fuchs, deren Züge versteinert waren, seit ihr Mann pflegebedürftig und somit beider Leben in Armut gefallen war.

Gegen fünf trafen die Monteure ein. Auswärtige Männer mit verlebten Gesichtern und Tätowierungen auf den Händen. Bestellten Kaffee, versammelten sich mit den dampfenden Bechern und hochgezogenen Schultern draußen zum Rauchen. Kamen schnaufend vor Kälte und Müdigkeit zurück in den Laden und frühstückten mit mechanischen Bewegungen. Ihr Arbeitstag hatte begonnen. Bis sieben blieb es ruhig im Ort. Nur vereinzelt fanden sich Schlaflose und Gassigeher am Kirchplatz ein, den täglich einmal zu umrunden zu den Hauptbeschäftigungen der Einwohner des Fleckens gehörte. Dies ist mein Ort. Vier Ecken und zwei Beine. Die Uhr schlägt uns den Rhythmus. Wir schlagen Wege ein.

Nur der Büderich, der hatte es, potz Blitz, zu weit getrieben. Das wussten alle. Selbst solche wie Säbler, der dazu neigte, den Verlauf eines Disputs geduckt abzuwarten, bis er sicher sein konnte, wem der Sieg gebühren würde, auf wessen Seite er sich zu schlagen hatte. Selbst der hielt sich fern vom Büderich, weil er zu weit gegangen war. Und keinen Platz mehr hatte. Ohne Not.

Gegen halb acht eilten schließlich die Schülerinnen und Schüler, gelbgesichtige Bankangestellte, gestresste Verkäuferinnen und der gichtgeplagte Leiter des Reisebüros ihrem Tagwerk entgegen. Endlich wurde es hell, im Bäckerladen löschten sie die Lichter. Wer spart, gewinnt, dass wusste schließlich jeder. Nur der Büderich, der hatte es nun wirklich übertrieben. Selbst mit so einer einfachen Sache wie der Sparsamkeit. Sogar die Gefühle hatte der sich gespart. Und das war es, was sie ihm am wenigsten verzeihen konnten. Denn schließlich haben auch Gefühle einen festen Platz, einen Ort, an den sie hingehören, und an Weihnachten, so viel stand fest, war dieser Platz nun wirklich klar markiert.


Ein Überflüssiger

Ein kräftiger Wind schlug Regentropfen an die Fenster, die zeichneten schräg stehende Muster, die sich mit jeder neuen Böe veränderten und damit die Katzen auf den Fensterbänken hypnotisierten. Johann Fuchs, der sein ganzes Leben der Deutschen Reichsbahn, dem planmäßigen Abfahren und Ankommen schwerbeladener Güterzüge geopfert hatte, versetzte der Anblick einen Stich ins Herz.

Seit Monaten hatte er das Haus nicht mehr verlassen. Er, der die Schienennetze über zigtausende Kilometer hinweg bis ins Mark verinnerlicht hatte. Der noch immer ruhelos durch die Lande fuhr – nachts, allein. In seinen Träumen. Um dann, bei Tage, wieder nutzlos zu sein.

Quelle           :          TAZ        >>>>>          weiterlesen


Grafikquellen         :

Oben      —        protestant church in Meerbusch, Germany (Betlehemkirche)

Abgelegt unter Feuilleton, Nordrhein-Westfalen, Religionen, Überregional | Keine Kommentare »

CDU – Nach rechts gekippt

Erstellt von DL-Redaktion am 22. Dezember 2019

CDU und Rechte in Sachsen-Anhalt

Mann im Kreis.jpg

Von Anja Maier

Die Affäre Möritz zeigt: Der CDU-Landesverband Sachsen-Anhalt ist der Bundespartei entglitten. Wie der gesamte Osten.

Man muss die CDU nicht mögen und nicht wählen. Aber dass diese Partei zur unsicheren Variabel der parlamentarischen Demokratie wird, sollte man ihr und dem Land nicht wünschen. Wenn die CDU nicht mehr weiß, wofür sie steht – und wofür ausdrücklich nicht -, gerät die politische Tektonik ins Wanken. Eine CDU-Führung, die sich nicht klar gegen rechts abgrenzt, kann nach Hause gehen. Sie wird nicht mehr gebraucht, um die Mitte der Gesellschaft zu repräsentieren.

Als Anfang dieser Woche der Streit um einen bestens vernetzten Rechtsausleger im Landesverband Sachsen-Anhalt hochkochte, meinte man noch, das sei eine klare Sache. Spätestens am Montagmittag würde sich der Generalsekretär an die Öffentlichkeit wenden und erklären, was die CDU mit Nazis zu schaffen hat: Nichts. Kürzlich hatte Annegret Kramp-Karrenbauer ja beim Parteitag an den ermordeten Parteifreund Walter Lübcke erinnert und über die Rechten gesagt: „Das sind die Brandstifter, und wir dürfen nie die Biedermänner sein, die ihnen auch noch die Streichhölzer geben.“

Am Ende dieser Woche steht zu befürchten, dass Teile der CDU nicht nur die Streichhölzer weiterreichen. Robert Möritz musste erst selbst austreten – seine Parteifreunde hätten ihm eine „zweite Chance“ eingeräumt. Soweit ist es gekommen bei der CDU. Die Kreis- und Landesverbände können das, weil die Führung dieser Partei zwar dauernd mit großer Geste beteuert, so was von gegen Nazis zu sein.

„Ohne Wenn und Aber: Hakenkreuze gehen gar nicht“, hat CDU-Ministerpräsident Reiner Haseloff gesagt, als verstehe sich das nicht von selbst. Und Annegret Kramp-Karrenbauer beteuerte: „Wir gehen gegen jede Form von Rechtsextremismus entschlossen und kompromisslos vor.“ Wie, sagte sie nicht. Floskeln dieser Art sind folgenlos für Parteifreund Möritz und seine Getreuen. Es sind Wortstanzen, die Faschismus zur Privatmeinung verzwergen und praktizierten Extremismus zur akzeptierten Vereinstätigkeit.

Der hellbraune Gesäßstreifen auf der Mütze passt auf jede Haselnuss.

Der Landesverband Sachsen-Anhalt ist der Bundespartei entglitten. Wie eigentlich der ganze Osten. Im Konrad-Adenauer-Haus kann man nichts dafür, wenn in Sachsen-Anhalt der Landesparteitag beschließt, die CDU sei unterhalb einer Koalition bereit für eine Zusammenarbeit mit der AfD. Wenn zwei Vizefraktionschefs eine „Denkschrift“ veröffentlichen, in der es heißt: „Es muss wieder gelingen, das Soziale mit dem Nationalen zu versöhnen.“ Aber die Bundespartei muss entschlossen Haltung zeigen und darf sich nicht aus Angst vor dem Koalitionsbruch wegducken.

Quelle         :       TAZ       >>>>>           weiterlesen


Grafikquellen        :

Oben       —       Man in cirle (black sun)


Unten      —       Via –   Wikimedia Commons  Twitter    GRÜNE Mittelsachsen

Abgelegt unter Kultur, P.CDU / CSU, Sachsen-Anhalt, Überregional | Keine Kommentare »

Politische Regression: AfD

Erstellt von DL-Redaktion am 21. Dezember 2019

 Warum die AfD so erfolgreich ist

2019-04-11 AfD Fraktion im Bundestag by Olaf Kosinsky-7946.jpg

Wenn alle nur leere Versprechungen anbieten, reicht dem Gegner ein wenig Polemik aus.

Quelle        :       INFOsperber CH.

Von Jürg Müller-Muralt

Die AfD ist die erfolgreichste rechtsextreme Partei in Deutschland seit 1945: Ursachensuche im Dickicht einer kontroversen Debatte.

Wer hat den Zweiten Weltkrieg entfesselt? Die Frage stellen heisst sie beantworten. Doch nun beginnen Exponenten der «Alternative für Deutschland» (AfD) die Kriegsschuldfrage zu thematisieren, frei nach dem Motto: «Man wird ja wohl noch fragen dürfen». Michael Klonovsky, persönlicher Mitarbeiter des früheren AfD-Parteichefs Alexander Gauland, schreibt in seinem Blog «Acta diurna» am 12.09.2019: «Was geschah tatsächlich vor dem deutschen Angriff auf Polen vor 80 Jahren? Und warum weigern sich deutsche Offizielle, über dieses Thema zu sprechen?». Er faselt von «unbändiger Provokationslust» der Polen vor dem Kriegsausbruch 1939. Warschau sei «dem Reich ziemlich übermütig» entgegengetreten. Und «hohe polnische Militärs träumten 1939 offen davon, auf Berlin zu marschieren, was von erstaunlicher Hybris zeugt, es gab, wie mir ein damit beschäftigter Historiker versicherte, Grenzprovokationen und -scharmützel von beiden Seiten.»

Alleinschuld geleugnet

Mit anderen Worten: Ein AfD-Vertreter leugnet die Alleinschuld des Dritten Reiches am Zweiten Weltkrieg. Dieser Geschichtsrevisionismus ist für Markus Linden, Politikwissenschaftler an der Universität Trier, ein weiteres Merkmal für den rechtsradikalen Kurs der AfD, wie er in der NZZ vom 26.11.2019 schreibt. Die drei anderen Aspekte, die von Rechtsradikalität der AfD zeugen, sind gemäss Linden «die pauschale Abwertung von Bevölkerungsgruppen, die Gleichsetzung des bundesdeutschen Gemeinwesens mit einer Diktatur und die regelmässig vorgebrachten Aufrufe zum radikalen Widerstand gegen die vermeintlichen ‹Blockparteien› und das gesamte damit verbundene ‹System›.»

«Autoritärer Radikalnationalismus»

Häufig wird die AfD als rechtspopulistisch bezeichnet. Wilhelm Heitmeyer, Soziologe und früherer Professor an der Universität Bielefeld, lässt den Begriff Rechtspopulismus für die AfD nicht gelten, wie er auf Spiegel online schreibt: Damit würden politische Phänomene häufig auf Formfragen reduziert. Zudem werde vor allem in Deutschland Rechtspopulismus als Synonym für eine Art «Rechtsextremismus light» verwendet. Heitmeyer bezeichnet die Programmatik der AfD als «autoritären Radikalnationalismus». Die Partei habe sich seit 2015 ideologische Elemente angeeignet, «die erstens auf autoritären Vorstellungen von Ordnung und Führung basieren; zweitens nationalistisch aufgeladen und völkisch sind; und die drittens auf eine radikale Transformation der liberalen Demokratie abzielen, wofür gezielt rassistische Ressentiments sowie Freund-Feind-Schemata mobilisiert werden.»

Kein Randphänomen, sondern grosse Regression

Diese Einschätzung findet sich auch in einer im November 2019 veröffentlichten Forschungsübersicht (PRIF-Report 5/2019) des Peace Research Institute Frankfurt (PRIF) und des Leibniz-Instituts Hessische Friedens- und Konfliktforschung (HSFK): hier. Der Bericht trägt den Titel «Regressive Politiken und der Aufstieg der AfD – Ursachensuche im Dickicht einer kontroversen Debatte». Als regressiv bezeichnen die Autoren Daniel Mullis und Paul Zschokke Politikformen, «die vermeintlich exklusive Rechte verteidigen, dafür andere gezielt ausschliessen und herabsetzen und so für ein gesellschaftliches Projekt werben, das mit pluralistisch-demokratischen Prämissen bricht». In den Bericht eingeflossen sind auch Langzeitstudien und soziologische Erhebungen.

File:Keine AFD V1.svg

Der PRIF-Report stellt keinen Rechtsruck der Gesellschaft als ganzer fest, sondern eine Polarisierung zwischen einer erstarkenden extremen Rechten auf der einen Seite und Mobilisierungsgewinnen einer linken, an Ökologie, sozialer Gerechtigkeit und Gleichberechtigung orientierten deutschen Zivilbevölkerung auf der anderen. Zudem sei der Aufstieg der AfD kein gesellschaftliches Randphänomen, sondern eine «grosse Regression»: «Es geht um die latente Aushöhlung von Grundrechten, Verschiebungen im Bereich des Sagbaren und um verstärkte Präsenz von Nationalismus, Abschottungswünschen und autoritären Politikvorstellungen in weiten Teilen der Gesellschaft, d.h. eine gewisse Normalisierung extrem rechter Narrative und Einstellungen.»

Keine «Verführung unschuldiger Massen»

Der Stellenwert der AfD im politischen Gefüge Deutschlands geht allein schon aus der Tatsache hervor, dass zum ersten Mal seit dem Untergang des Nationalsozialismus eine rechtsextreme Partei zugleich in allen Landesparlamenten, dem Deutschen Bundestag und dem Europaparlament vertreten ist. Die AfD wurde 2013 als neoliberal-konservative, sozialstaatskritische und anti-europäische Partei gegründet, hat sich dann aber ab 2015 rasch zu einer völkisch-nationalen, chauvinistischen, antifeministischen, rassistischen und teilweise auch antisemitischen Partei entwickelt. Der Bericht unterstreicht, dass die Ursache dieser Entwicklung nicht auf einen erfolgreichen Ideologietransfer und damit auf eine «erfolgreiche Verführung ansonsten unschuldiger Massen» reduziert werden könne. Die Autoren verweisen auf Langzeitstudien, die verdeutlichen, dass autoritäre und ausländerfeindliche Einstellungen lange vor dem Aufstieg der AfD in der Mitte der Gesellschaft ihren Platz hatten. Der Erfolg der Partei ist also nicht ein Ausrutscher und darf auch nicht nur als Protest interpretiert werden. Zudem ist die AfD auch nicht ausschliesslich eine Partei der Marginalisierten, sondern findet auch in bürgerlichen Kreisen Zuspruch.

Neonazis im gehobenen Bürgertum

Ein eindrückliches Beispiel dieses Befundes liefert ein Beitrag von Radio SRF in der Sendung Rendez-vous am Mittag vom 17.12.2019. Die 27-jährige Heidi Benneckenstein berichtet dort über ihre Erfahrungen, die sie als Kind in einer Neonazi-Familie gemacht hat. Als junge Frau stieg sie aus und schrieb ein Buch über ihre Jugend. Ihr Vater war ein angesehener Beamter in Bayern, zu Hause war er ein Neo-Nazi. Heidi musste bereits im Vorschulalter an Lagern der «Heimattreuen Deutschen Jugend» teilnehmen. Die Eltern dieser Jugendlichen seien keine armen Leute oder Kleinbürger gewesen, sondern meist angesehene Honoratioren aus den oberen Bildungs- und Einkommensschichten, Intellektuelle, Professoren, Zahnärzte, «also keine stumpfen Glatzen, sondern eine sehr elitäre und gehobene Gemeinschaft», sagte Heidi Benneckenstein. Die meisten dieser Jugendlichen seien später nicht aus der Naziszene ausgestiegen. Viele sässen jetzt im Hintergrund an den Schalthebeln der Macht, etwa als Fraktionsmitarbeiter der AfD.

AfD nicht nur im Osten stark

Entgegen weitverbreiteter Auffassung ist die AfD auch nicht bloss ein Phänomen der östlichen Bundesländer oder ländlicher Regionen. Ganze zwei Drittel der 91 AfD-Bundestagsabgeordneten stammen aus den westlichen Bundesländern, was allerdings hauptsächlich der höheren Bevölkerungsdichte geschuldet ist. Zudem wählen sozio-demographisch ähnlich zusammengesetzte Gebiete ähnlich, was einer der Autoren zur Schlussfolgerung führt, dass «ein genuiner, womöglich sogar kulturell bedingter Ost-Faktor nur in begrenztem Masse» besteht. Studien zu Einstellungsmustern legen zudem nahe, dass die Entscheidung für die Wahl der AfD in Ost und West auf ähnlichen Faktoren basiert: Skepsis gegenüber Zuwanderung, Ablehnung kosmopolitischer und pluralistischer Lebensentwürfe und die Sehnsucht nach einer homogenen Welt.

Düsseldorf, Rosenmontag 2016, politische Karnevalswagen (03).jpg

Die Suche nach den Gründen

Doch was genau treibt die Wählerinnen und Wähler in die Arme der AfD? Sind es eher sozio-ökonomische Gründe, oder doch eher solche der Identitätspolitik und der kulturellen Abschottung? Die Verfechter einer eher sozio-ökonomischen Sicht haben den Begriff der Abstiegsgesellschaft geprägt. Nach 1945 hat demnach eine Ära der «sozialen Moderne» begonnen, die bis in die Neunzigerjahre des 20. Jahrhunderts dauerte. Hauptmerkmal dieser Epoche war ein planender und sozial verantwortlicher Staat, der die gesamte Bevölkerung durch Arbeit und Konsum integrierte und damit für Stabilität sorgte.

Mit der Einführung der Agenda 2010 sei dann der Abschied von der sozialen Moderne eingeleitet worden. Dieser sozialpolitische Kurswechsel habe zu einem wachsenden Druck auf die Erwerbslosen, aber auch auf die Erwerbstätigen geführt. Stichworte sind flexibilisierte Arbeitsregelungen, Möglichkeit der Leiharbeit, vermehrte (Schein-)Selbstständigkeit. Der demokratische Rechtsstaat sei zwar gleichzeitig beibehalten oder gar ausgebaut worden. Da die wirtschaftlichen Eliten jedoch immer mehr an Einfluss gewonnen hätten, habe die Demokratie «die inkludierende Kraft» zunehmend verloren, die «Tiefenstruktur der Gesellschaft» habe sich allmählich verändert.

Die Schlüsselstellung der Achtundsechziger

Die Agenda 2010, die Reform des deutschen Sozialsystems und Arbeitsmarkts, ist das Werk der Koalition von SPD und Grünen unter Bundeskanzler Gerhard Schröder; es waren also die Vertreter der Achtundsechziger-Generation. In ihrem Beitrag mit dem Titel «Vom Regen des progressiven Neoliberalismus in die Traufe des reaktionären Populismus» schreibt Nancy Fraser etwas zugespitzt: «Die Vertreter der Emanzipationsbewegung verbündeten sich mit den Partisanen des Finanzkapitalismus zum Angriff auf die sozialen Sicherungssysteme.»

In einer solchen Lage könnten weitere Krisen rasch zu einer Erosion des politischen Systems führen. So könne die «Integration ‹der Anderen› ökonomisch Marginalisierte überfordern». Typisch dafür sei die so genannte Flüchtlingskrise von 2015. Sowohl das liberale Bürgertum als auch die Linke hätten die Sorgen der mittleren und unteren Bevölkerungsgruppen vernachlässigt. Das habe wesentlich dazu beigetragen, viele Bürgerinnen und Bürger in die Arme der AfD zu treiben.

Nicht alle Marginalisierten denken gleich

Diese Argumentation hat allerdings Schwächen: Sie unterstellt, dass alle «ökonomisch Marginalisierten» gleich denken und gleich reagieren – und dass man mit einer Ausweitung der Sozialpolitik die Entwicklung des Rechtsextremismus eindämmen könne. Die Probleme liegen aber tiefer, nämlich in den Bereichen der Identitätspolitik und der kulturellen Abschottung: «Die Fokussierung auf die unteren sozialen Schichten trägt empirisch nicht», heisst es im PRIF-Report. Die Autoren verweisen auf eine europaweit vergleichende Studie, die zeige, dass Wählerinnen und Wähler extrem rechter Parteien durchs Band weg kosmopolitische, pluralistische und post-materialistische Lebensmodelle ablehnen und jeglicher Zuwanderung skeptisch gegenüberstehen. Anhängerinnen und Anhänger der AfD teilten «durchaus ökonomische Bedrohungswahrnehmungen, weit stärker falle aber der Wunsch nach einer homogenen Welt und die gemeinsame Ablehnung von Ausländerinnen und Ausländern ins Gewicht».

Einfache Kausalitäten gibt es nicht

Aufschlussreich und bemerkenswert sind in diesem Zusammenhang auch mehrere Untersuchungen, die auf lange historischer Kontinuitäten identitätspolitischer Vorstellungen von Gemeinschaft, Kultur und Zugehörigkeit verweisen: «So wird die AfD heute gerade dort gewählt, wo in der Vergangenheit ‹Die Republikaner› und die NPD bzw. zuvor schon die NSDAP erfolgreich waren». Es ist das Sehnen nach der Stabilität einer klaren Ordnung. Und es ist «eine Rebellion jener, die sich als stabile Mehrheit glaubten, nun aber feststellen, dass dem nicht so ist, und die sich zunehmend als Minderheit» beschreibt, als «fremd im eigenen Land».

Protest gegen die AfD im Bundestag (37851513826).jpg

Die Linke blieb mehr als zehn Jahre eine ungehörte Opposition

Man darf den Schluss ziehen: Einfache Kausalitäten, warum jemand die AfD wählt, gibt es nicht. Kulturelle, soziale und ökonomische Faktoren sind derart eng verschränkt, dass sie sich wechselseitig hervorrufen und verstärken. Die beiden Autoren formulieren es so: «Regressive Politiken sind also, so viel können wir auf Basis unserer Forschung jetzt schon sagen, keinesfalls einfach Folge von Zurücksetzung, eines Mangels an Repräsentation oder von Herausforderungen der Globalisierung. Sie gründen auf einer spezifischen Sicht auf die Welt, welche erfahrene bzw. vermeintliche Ungerechtigkeit in einen Gesamtzusammenhang stellt. Die Brille, durch die dieser Blick auf die Welt erfolgt, ist zunehmend Rassismus.»

Alle Parteien in der Verantwortung

Nur: Rassismus alleine erklärt auch noch nicht alles, Rassismus in unterschiedlichen Schattierungen gibt es in allen Gesellschaften. Die Frage ist, unter welchen Bedingungen er gesellschaftlich und politisch relevant werden kann: «Es bedarf dafür politischer Angebote und einer gesamt-gesellschaftlichen Stimmung, die Rassismus als Bindeglied mobilisiert – wofür längst nicht nur die AfD verantwortlich zeichnet: Thilo Sarrazin (SPD) riss die Tore weit auf, und in den Jahren nach 2015 waren es unter anderem Politiker und Politikerinnen wie Horst Seehofer, Alexander Dobrindt (beide CSU) oder Christian Lindner (FDP), aber auch Sahra Wagenknecht (Die Linke) oder Boris Palmer (Bündnis 90/Die Grünen), die mit fremdenfeindliche Positionen und rechten Narrativen zumindest öffentlichkeitswirksam kokettierten.»

Themenbezogene Interessen (-bindung) der Autorin/des Autors



© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.


Grafikquellen       :

Oben       —       AfD-Bundestagsfraktion, während einer Plenarsitzung im Bundestag am 11. April 2019 in Berlin.

  • CC BY-SA 3.0 deDie Persönlichkeitsrechte der abgebildeten Person(en) beschränken bestimmte Weiterverwendungen des Bildes ohne dessen/deren vorherige Zustimmung.Hinweise zur Weiternutzung
  • File:2019-04-11 AfD Fraktion im Bundestag by Olaf Kosinsky-7946.jpg



2.) von Oben     —        Keine Alternative für Deutschland. Aufkleber gegen die Partei Alternative für Deutschland, in SVG Format.

Source Own work
Author Weeping Angel

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.


3.) von Oben     —       Düsseldorf, Rosenmontag 2016

Kürschner (talk) 11:36, 8 February 2016 (UTC)Own work

  • Public Domainview terms
  • File:Düsseldorf, Rosenmontag 2016, politische Karnevalswagen (03).jpg
  • Created: ‎08‎ ‎February‎ ‎2016



Unten        —      Protestaktion gegen die AfD vor der Konstituierung des Bundestages. Foto: Martin Heinlein

Abgelegt unter Opposition, P.AfD, Positionen, Überregional | Keine Kommentare »

Jahresaussteigerin : Sahra

Erstellt von DL-Redaktion am 21. Dezember 2019

Sahra Wagenknecht verlässt die Politik, bleibt aber die Stimme der Linken

Maischberger - 2019-11-13-9491.jpg

Da hätte man früher gesagt: „Nun geh doch und Heule dich aus“

Von Peter Gauweiler

Sicher unter dem Motto: „Gute Freunde kann niemand trennen? „

Auch wenn die 50-Jährige von allen politischen Ämtern zurückgetreten ist, bleibt sie die Stimme des linken Lagers. Und sie ist noch nicht am Ende.

Niederlagen sehen anders aus. Mitte November gab Sahra Wagenknecht den Fraktionsvorsitz der Partei Die Linke im Deutschen Bundestag auf, indem sie sich nicht zur Wiederwahl stellte – einen Wimpernschlag später wird sie vom Meinungsforschungsinstitut Insa zur beliebtesten Politikerin Deutschlands ausgerufen. Bundeskanzlerin Angela Merkel – bis heute auch irgendwie, aber noch nicht wirklich zurückgetreten – verwies sie damit auf den zweiten Platz.

Vier Jahre zuvor hatte das ZDF-Politbarometer Wagenknecht noch zur unbeliebtesten Politikerin Deutschlands erklärt. Lieben und geliebt werden wollen alle, die dem Volke dienen. Bezogen auf das deutsche hat Sahra Wagenknecht im Jahr 2019 diese Erfüllung gefunden. „Bewege dich in deinen Eigenfarben, bis du im Recht bist“, sagte gerade in Stockholm der Nobelpreisträger Peter Handke.

Nicht, dass sie diese Alleinstellung gesucht hätte: Als Wagenknecht Anfang des Jahres aufgrund eines Burn-outs eine Auszeit nehmen musste, nannte sie auch die innerparteilichen Angriffe auf ihre Person als Grund. Kurz darauf kündigte sie an, nicht erneut als Fraktionsvorsitzende der Linken zu kandidieren. Sahra Wagenknecht hatte genug von den ewigen Kämpfen.

Denn das Kämpfen bestimmte schon seit frühester Jugend ihr Leben und zieht sich wie ein roter Faden durch die Biografie der Ostwestdeutschen. 1969 wird sie in Jena geboren. Der Vater stammte aus dem Iran, lernte ihre in der DDR lebende Mutter als West-Berliner Studentin kennen. Von einer Reise nach Teheran kehrte er nie mehr zurück. Wagenknecht selbst beschrieb dieses Erlebnis als „Verlustschmerz, den man mit ins Leben nimmt“ – ihr Elterngepäck auf dem Weg zur bekanntesten Einzelkämpferin der deutschen Politik.

Früh eckt sie mit ihren Ansichten an. Nach dem Abitur 1988 wird der außergewöhnlich begabten Gymnasiastin im real existierenden Sozialismus das Studium verweigert. Sie sei „nicht aufgeschlossen genug fürs Kollektiv“, wurde ihr attestiert. Wie klarsichtig!

Eine Arbeitsstelle als Sekretärin kündigt sie nach drei Monaten. Mit Nachhilfeunterricht hält sie sich finanziell über Wasser. Aber als alle sich von der delegitimierten DDR abwenden – im Jahr 1989 –, tritt Wagenknecht in die SED ein. Ich will kein Wendehals sein! Die 19-Jährige äußert demonstratives Verständnis für die Klassiker des Kommunismus. Für uns Antikommunisten eine unerhörte Provokation. „Lass dich ein“, heißt es bei Peter Handke. „Verachte den Sieg.“

Nach der Wende studiert sie in Jena und Berlin Philosophie und Neuere Deutsche Literatur. Dann schmeißt sie hin und lernt und forscht im niederländischen Groningen weiter. Mit einer Arbeit über die Hegelrezeption des jungen Marx schließt sie ihr Studium ab. Später promoviert sie in Volkswirtschaftslehre über das Verhältnis von Einkommen und Rücklagen in entwickelten Ökonomien.

Peter Gauweiler MdB.jpg

Ihre politische Karriere gewann in all den Jahren weiter an Fahrt. Doch auch hier verlief ihr Weg voller Reibungen. 1991 wurde Wagenknecht Mitglied des Parteivorstandes der SED-Nachfolgepartei PDS. Vier Jahre später musste sie jedoch auf Druck Gregor Gysis aus dem Vorstand ausscheiden – er hielt sie für untragbar. 2000 wurde sie erneut in den Vorstand der Partei gewählt.

Vier Jahre später zog sie für ihre Partei in das Europaparlament ein. Vorausgegangen war wieder eine innerparteiliche Kampfabstimmung. 2007 wurde sie Mitglied des Parteivorstandes der Partei Die Linke. 2009 zog sie in den Bundestag ein. Ein Jahr später wird sie stellvertretende Parteivorsitzende, kurz darauf stellvertretende Fraktionsvorsitzende. 2015 übernimmt sie gemeinsam mit Dietmar Bartsch den Fraktionsvorsitz der Linken im Bundestag. Die ewige Eifersucht der zu kurz Gekommenen nimmt damit kein Ende. Im Gegenteil.

Quelle      :           Das Handelblatt       >>>>>        weiterlesen


Grafikquelle      :

Oben       —        „maischberger. die woche“ am 13. November 2019 in Köln. Produziert vom WDR. Foto: Sahra Wagenknecht, Die Linke (ehemalige Fraktionsvorsitzende)

Abgelegt unter Bayern, P. DIE LINKE, P.CDU / CSU, Saarland, Überregional | 2 Kommentare »

Eintritt in die Linkspartei

Erstellt von DL-Redaktion am 19. Dezember 2019

Eintritt in eine Partei –
in keinem Fall sofort und schon gar nicht online!

Quelle        :         Scharf  —  Links

Von Wolfgang Gerecht

Am Beispiel der Partei DIE LINKE soll die Problematik eines Partei-Eintritts sofort und online betrachtet werden.

„Hier kannst Du sofort und online Deinen Eintritt in die Partei DIE LINKE erklären.

Schließ Dich mit uns zusammen für mehr soziale Gerechtigkeit, gegen die Rechtsverschiebung und die soziale Kälte.

Hier kannst Du sofort und online Deinen Eintritt in die Partei DIE LINKE erklären.

Jetzt Mitglied werden!

Mitmachen und einmischen!

Für Solidarität und soziale Gerechtigkeit. Gegen Waffenexporte und Kriegseinsätze der Bundeswehr. Für mehr Demokratie und eine gerechte Verteilung des Reichtums.

Hier kannst Du sofort und online Deinen Eintritt in die Partei DIE LINKE erklären.

Hiermit erkläre ich, Vorname * Name * E-Mail-Adresse *

meinen Eintritt in die Partei DIE LINKE,

Mitglied der Partei der Europäischen Linken (EL).

Ich bekenne mich

zu den programmatischen Grundsätzen der Partei DIE LINKE,

erkenne die Bundessatzung anund bin nicht

Mitglied einer anderen Partei im Sinne des Parteiengesetzes“

File:Red Umbrella (18784873033).jpg

Soweit die offizielle Internetseite der Partei (führung).


Politisch Interessierte, insbesondere junge Menschen, können folgende sinnvolle Überlegungen zu dem Thema „Partei-Eintritt, sofort und online“, anstellen.

Zunächst ist festzustellen, dass alle demokratischen Parteien,

  • viele gutklingende Forderungen verkünden (Ankündigungs-Modus) und
  • viele politische Versprechungen (Ankündigungs-Modus)  machen, und
  • wenige Forderungen realisieren und wenn an einer (Landes-, Bundes-Regierung beteiligt,
  • die meisten Versprechungen gar nicht einlösen und wenn, dann
  • nur wenige in homöopathischen Dosen (Alibi-Funktion).
  • Sie handeln fundamental gegen die eigenen programmatischen Grundsätze:
  • Bedingungslose Anerkennung des Inlands-Geheimdienstes „Verfassungsschutz“,
  • Bedingungslose Anerkennung der Schuldenbremse,
  • Bedingungslose Anerkennung von weltweiten NATO-Militär-Einsätzen im Ausland
  • Zustimmung zum Demokratie-Abbau wie den Polizeigesetze in Berlin, Brandenburg, Thüringen)

Vor einer Beantwortung der Frage, will ich Mitglied werden, kann Mensch überlegen welches Führungs-Personal der höheren Organisations-Einheiten der Partei und Fraktion in den Ländern und  im Bund muss ich nach einem Partei-Eintritt moralisch und politisch akzeptieren?

Wie steht es um die politische Glaubwürdigkeit der Parteiführung im Bund und Land?

Mit welchen Mitgliedern muss ich nach einem Partei-Eintritt ständig politisch arbeiten,

Das „normale“ bzw. Basis-Mitglied wird von seiner sozialen Umgebung (Familienverband, Verein, Arbeitsplatz,   u.s.w.) für das Unterlassen und ggfs. Handeln der Partei-Vorsitzenden im Blick auf die eigenen programmatischen Grundsätze ideell in Haftung genommen.

Die bildlich gesprochen, Flotte mit 16 Kreuzfahrtschiffen, insgesamt ca. 60.000 Passagieren/Mitgliedern, wird von den jeweiligen Kapitänen / Innen  (Vorsitzenden) mit ihren jeweiligen Steuer- Männern und Frauen (Vorstands-Beisitzer) gesteuert.

Kapitäne und Steuermänner und alle übrigen in Funktionen stehenden Personen der  Führungs-Crew, gehören – in der Regel – einer Landes- und/oder Bundes-Arbeits-Gemeinschaft an (LAG, BAG).

Dort bildet sich das Führungs-Personal der Partei seine jeweilige politische „Hausmacht“.

Auch als „Seilschaften“ bezeichnet wird ständig innerparteilich versucht Mehrheiten auf den jeweiligen Parteitagen über eine Delegierten-Mehrheit zu erzeugen. Die Delegierten sind oft in abhängiger Beschäftigung als Mitarbeiter in Fraktion und/oder Partei tätig. Sie verfügen über Insider-Wissen und führen das „Steuer-Ruder“ so, wie es ihre Vorsitzenden erwarten.

Diese Macht-Gruppen entscheiden letztlich über den Kurs

den die Flotte „DIE LINKE“ nimmt.

  • Demokratie hin oder her,
  • Parteitags-Beschlüsse hin oder her.
  • Partei-Grundsatz-Programme hin oder her!

Spätestens bei einer Beteiligung an einer Landes- oder Bundesregierung wird ohnehin

von den „‘stärkeren“ Koalitions-„Partnern“ entschieden, welche Politik-Schritte prioritär realisiert werden und der die geringeren Wahlergebnisse, sprich wenigsten Parlaments-Sitze vorweisen kann,  wird nur einen geringen Teil („Alibi-Funktion“) seiner politischen Forderungen  verhandeln können.


Wenn es  zu Bundestagswahlen kommt und es wider aller Wahrscheinlichkeiten zum „Kipping-Dream-Team“   GRÜN, SPD, LINKE  parlamentarisch käme, hätte die LINKE auf jeden Fall einen Kriegseinsatz der Bundeswehr zu akzeptieren. Ebenso die Schuldenbremse. Ebenso erhebliche Teile der AGENDA 2010. Und so weiter.

Da die Partei-Mitglieder, die Absichten eine politische Kurs-Abweichung durchzuführen, früher oder später erkennen, versuchen die „Partei-Oberen“ ein Aufkommen von Misstrauen wegen der Kurs-Abweichung dadurch zu besänftigen, dass das Märchen von den „Halte-Linien“, „Roten-Haltelinien“ und ähnliches erzählt wird. Grundsätze oder Rote Haltelinien platzen bei Koalitionsverhandlungen wie Seifenblasen, die ohnehin unter Ausschluss der (Partei) Öffentlichkeit stattfinden. Beispiel: „Bundesland“ Bremen.

Weitere Fragen:

Haben sich die Führungspersonen in der Vergangenheit (im Internet recherchierbar)  menschlich so verhalten, dass der potentiell an einer Mitgliedschaft Interessierte diese akzeptieren kann.

Sobald ein Mitglied sich für eine Position in der Partei-Hierarchie konkret interessiert beginnt in der Regel der Konkurrenz-Kampf um die zu besetzende Position.

Dieser Konkurrenz-Kampf wird graduell schärfer je höher die angestrebte Position (Orts-, Kreis-, Landes-, Bundesebene) sowohl in der Partei-Organisation als auch bei den Parlaments-Wahlen aller Ebenen, insbesondere Bundes- und Landtagswahlen.

In den sich – nach einem Wahlerfolg – bildenden – vom Wähler unabhängigen – Parlaments-Fraktionen, wird die eigentliche und vorherrschende Macht auch auf  bzw. in die Partei-Ebene hinein ausgeübt.

Eine Partei hat den vorrangigen Zweck,

  • politisches Personal heranzuziehen,
  • Abgeordnete für die Parlamente zur Wahl zu stellen  (Listenplatz – Direkt-Kandidat In)
  • Wahlkämpfe durchführen,
  • die Wahlberechtigten zur Wahl zu motivieren

Die folgende Besetzung der Parlamentssitze – wenn die Partei aufgrund der undemokratischen 5% Klausel überhaupt welche erreicht – trennt die Wähler Innen von den gewählten Parlamentariern und   die Wähler haben für die gesamte Wahlperiode keinen Einfluss   auf die Entscheidungen der „allmächtigen“ Parlamentsfraktionen.

Gerade auch die mit der Möglichkeit der Fraktions-Mitglieder ab Groß-Stadt-Ebene erst recht auf  Landesebene und Bundesebene bezahlte Positionen (Arbeitsplätze) zuweisen zu können, verstärkt den Konkurrenz-Kampf um die Mandate enorm.

In der Wahl der Mittel einen Konkurrenten auszubooten, sind die Partei-Funktionäre nicht wählerisch. Das sind keine „geregelten“ einigermaßen „objektive“ Verfahren wie z.B. in den Organisationen der Wirtschaft und den Verwaltungen.

Flag of Die Linke.svg

Dabei gibt es wechselnde – ausschließlich nach aktuellen Nützlichkeits-Abwägungen – zu bildende bzw. aufzulösende „Freundschaften“ die absolut nur dem jeweils angestrebten Aufstieg dienen und weitab von den propagandistischen Begriffen, wie solidarisch, Solidarität, demokratisch, Demokratie u.s.w. sind.

Die Aufforderung: Schließ Dich mit uns zusammen, für mehr soziale Gerechtigkeit, gegen die Rechtsverschiebung und die soziale Kälte, verkommt zu platten Leerformeln, wenn gleichzeitig die aktuelle seit 2012 im Amt befindliche Partei-Vorsitzende Frau Kipping eine GRÜNE-SPD-LINKEN-Bündnis als Bundesregierung anstrebt.

Ausgerechnet mit den Sozial-Abbau- und Kriegs-Parteien (AGENDA 2010 und Hartz IV, Renten-Abbau mit der GroKo-Union), (NATO-in Jugoslawien) SPD und GRÜNEN  sollen die in der Mitglieder-Werbung propagierten Ziele

  • „Solidarität und soziale Gerechtigkeit“,
  • „Gegen Waffenexporte und Kriegseinsätze der Bundeswehr.
  • Für mehr Demokratie und eine gerechte Verteilung des Reichtums“

erreicht werden.

Jeder politisch interessierte Mensch weiß, dass eine Beteiligung an einer Bundesregierung   n u r  mit der Voraussetzung möglich ist, dass die beteiligten Parteien an Kriegs-Einsätzen der Bundeswehr im Ausland teilnehmen und dafür jederzeit zur Verfügung stehen bzw. bereit sein müssen.

Mit dem propagierten Partei-Ziel „gegen Waffenexporte“ verhält es sich genau so. Hier gibt es noch die Besonderheit, dass die Entscheidungen über Waffenexporte im Geheimen sogenannten „Bundessicherheitsrat“ stattfinden.

Damit sind die Befürworter einer Beteiligung an einer Bundesregierung in DER LINKEN bereit, einen zentralen Bestandteil der programmatischen Grundsätzen der Partei DIE LINKE, die zu kennen, von jedem Neu-Eintritt in die Partei als Bedingung verlangt wird, aufzugeben.

Das die Aufgabe der programmatischen Grundsätzen der Partei DIE LINKE tatsächlich stattfindet, kann heute schon in den Regierungs-Beteiligungen auf Länderebene überprüft und nachgewiesen werden.

Ausbau des Inlands-Geheimdienstes „Verfassungsschutz“, obwohl DIE LINKE dessen Abschaffung bzw. Auflösung propagandistisch fordert. So geschehen in Brandenburg.

In Thüringen, wo DIE LINKE den Ministerpräsidenten stellt, das Stammland und Zentrum des Nationalsozialistischen Untergrundes (NSU),  wird der Inlands-Geheimdienstes „Verfassungsschutz“, weder abgeschafft noch aufgelöst.

Das gleiche im Koalitionsvertrag mit SPD und GRÜNEN in Bremen.

Die Akzeptanz der – dringend notwendigen öffentlichen Investitionen – behinderten Schuldenbremse ist ebenfalls eine zwingende Voraussetzung zur Regierungs-Beteiligung.  DIE LINKE propagiert jedoch „Weg mit der Schuldenbremse“.

Überall wo DIE LINKE in Regierungsverantwortung kommt, das Gleiche, die Programmatischen Grundsätze sind nur ein leere Versprechungen um den Mitgliedern eine Motivation zu bieten und  „bei Laune“ zu halten, anders ausgedrückt, die Gutgläubigkeit und den guten Willen der Mitglieder für eigene Zwecke zu missbrauchen.


Es gibt Oberflächkeiten genug in unserem Leben. Der Eintritt in eine Partei, sollte deshalb gut überlegt sein. In keinem Fall sofort und schon gar nicht online! Eine nicht verpflichtende Variante kannn ja eine Phase des konkreten Kennenlernens (Sympathisant) der Partei und deren Mitglieder vor Ort sein. Erst konkrete Kenntnisse der Personen und der Partei, und wie diese miteinander konkret umgehen, sollte einem Partei-Eintritt vorausgehen.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen           :

Oben        —          Kopie  von Scharf – Links — Bildmontage  HF


2. von Obern      —           Red Umbrella

Source Red Umbrella
Author Sonny Abesamis

This file is licensed under the Creative Commons Attribution 2.0 Generic license.


Unten           —         Flag of Die Linke, political party in Germany

  • Public DomainThis image contains content which may be subject to trademark laws.view terms
  • File:Flag of Die Linke.svg
  • Created: ‎04‎ ‎July‎ ‎2018  


Abgelegt unter Berlin, Bundestag, P. DIE LINKE, Überregional | Keine Kommentare »

Verfassungsschutz Erfurt

Erstellt von DL-Redaktion am 18. Dezember 2019

Diese Crêpes – von Linken – sind zu heiß

Crêpière (24557326247).jpg

Von Konrad Litschko

„Black Kitchen“ bekocht linke Protestierende – und schafft es damit in einen Landesverfassungsschutzbericht. Die Gruppe will nun dagegen klagen.

Martin Michel kocht gern Kürbissuppe oder brät Gemüsepfannen, und das in großem Stil: für Hunderte Hungrige – widerständische Hungrige. Denn Michel kocht mit einem Team namens „Black Kitchen“, einer linken Soli-Küche aus Thüringen. Zuletzt etwa bei den Protesten von Ende Gelände oder dem Klimacamp im Leipziger Land.

Für Michel ist das längst Routine. Der Endzwanziger und sein „Aktionskochkollektiv“ verpflegen linke Protestierende schon seit den Demos gegen den G7-Gipfel in Elmau 2015. Nun brachten sie es damit zu einem Novum: „Black Kitchen“ ist nach eigener Auskunft die erste vom Verfassungsschutz beobachtete Soli-Küche, seit Kurzem gelistet beim Thüringer Geheimdienst.

Die Gruppe, in Jena beheimatet, nahm das mit großer Verwunderung auf. „Wir sehen das etwas belustigt, aber eigentlich ist es ernst“, sagt Michel. „Denn wenn schon Gruppen, die nur Essen kochen, überwacht werden, dann ist keiner mehr sicher vor diesem Staat.“

Der Thüringer Verfassungsschutz wirft „Black Kitchen“ in seinem aktuellen Jahresbericht vor, sich aus „radikalen Linken“ und „AnarchistInnen“ zusammenzusetzen. Zitiert wird die Selbstdarstellung: Man koche nicht für „reformistische Kackscheiße oder reaktionäre Arschlöcher“, sondern stelle die „Essensversorgung für radikale und emanzipatorische Kämpfe“. Oder: „Wir wollen kein Stück von eurem Kuchen, wir haben selbst eine Bäckerei.“

„All Crêpes Are Beautiful“

Zentral aufgeführt wird im Bericht des Verfassungsschutzes indes, dass die Koch-Gruppe im August 2018 ihre Beteiligung an Protesten gegen ein Rechtsrock-Konzert im thüringischen Mattstedt ankündigte. Das Problem: Der geplante Pfannkuchen-Stand sollte „All Crêpes Are Beautiful“ heißen – eine Anspielung auf die Schmähung „All Cops Are Bastards“.

Martin Michel schüttelt über all das nur den Kopf. Wegen eines Crêpes-Stands in den Verfassungsschutzbericht? „Der Stand hat am Ende nicht mal stattgefunden, weil das Nazi-Konzert verboten wurde“, sagt Michel. Auch sei der Standname eine Anspielung auf den Prozess gegen eine ihrer Köchinnen gewesen – die 2016 beim Broteinkauf wegen eines Beutels mit dem Aufdruck „All Cats Are Beautiful“ eine Anzeige kassierte.

Und zur politischen Einstufung stehe auf der Webseite doch, dass auch Hippies und „viele liebe Menschen“ mitkochen würden, so Michel. „Das aber hat sich der Verfassungsschutz nicht rausgepickt.“


Der Jenaer hält den Vorgang für ein grundsätzliches Problem: „Wie, bitte schön, bekämpfen wir mit unserem Kochen die staatliche Grundordnung? Ist das jetzt schon zu gefährlich? Trifft es demnächst Lesekreise?“

Es wird weitergekocht

Der Verfassungsschutz und das Thüringer Innenministerium verwiesen auf taz-Nachfrage erneut auf die anarchistische und linksextreme Selbstverortung der „Black Kitchen“. Die Kochtruppe werde aber keinesfalls mit nachrichtendienstlichen Mitteln beobachtet, sondern nur mittels öffenlich einsehbaren Quellen, versichert ein Ministeriumssprecher. Heißt offenbar: Der Geheimdienst liest schlicht die Webseite von „Black Kitchen“ mit.

Quelle           :       TAZ           >>>>>          weiterlesen


Grafikquellen          :

Oben          —       Crêpière


Unten            —         Radishes and lettuce harvested from the White House Garden are prepared for the Congressional Spouses Luncheon May 17, 2009.

Abgelegt unter Einfach lecker - günstig, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Stadtgespräch aus Neukölln

Erstellt von DL-Redaktion am 13. Dezember 2019

Hipsterkiez mit Hakenkreuzen
Rechte Anschlagserie in Berlin-Neukölln

Von Malene Gürgen

Die rechten Taten bleiben weitgehend unter dem Radar der bundesweiten Öffentlichkeit. Doch die Opfer wissen ganz genau, wer gemeint ist.

Vielleicht wäre es einfacher, wenn Neukölln in Sachsen läge. Oder wenigstens am östlichen Rand von Berlin. Vielleicht wäre es einfacher, öffentliches Augenmerk auf eine aktuelle, unaufgeklärte rechtsextreme Terrorserie zu lenken, auf mangelnde Ermittlungserfolge und eine mögliche Verstrickung der Sicherheitsbehörden, wenn die Geschichte an einem Ort spielte, von dem man das erwartet: Neonazis, die Anschläge begehen, Polizei und Verfassungsschutz, die mindestens wegschauen.

Aber diese Geschichte spielt in Berlin-Neukölln. Ein Großteil der mehr als 60 Angriffe, Anschläge und Brandstiftungen, die der seit Mai 2016 laufenden Serie zugerechnet werden, ereignet sich dort, wo auch die mutmaßlichen Täter zu Hause sind, im Süden des Bezirks, viel weniger großstädtisch und viel weniger medial bekannt als der Norden. Aber ab und an trifft es auch den Norden, der dem Rest der Republik wahlweise als Hipster-Mekka oder Clankriminalitäts-Gruselmärchen bekannt ist. Zum Beispiel in dieser Woche, als die Fenster eines Imbissrestaurants, eines Spätkaufs sowie ein Treppenhaus großflächig mit Hakenkreuzen und SS-Runen besprüht wurden.

Vielleicht wäre es mit der bundesweiten Aufmerksamkeit auch einfacher, wenn durch diese Anschlagserie Menschen nicht nur eingeschüchtert, finanziell belastet und psychisch zermürbt würden, sondern wenn schon Menschen körperlich zu Schaden gekommen wären, so richtig. Bei Ferat Kocak, kurdischstämmiger Lokalpolitiker der Linkspartei, wäre es damals fast so weit gewesen, in einer Februarnacht 2018, als sein Auto nur ein paar Zentimeter neben der durchs Einfamilienhaus verlaufenden Gasleitung verbrannte.

Der Betreiber des Imbisses, auf dem am Dienstagmorgen große rote Hakenkreuze prangten, ist ein naher Verwandter von Ferat Kocak. Ob sich die Einschüchterung gegen ihn und seine Familie richtet oder allgemein gegen ein migrantisches Neukölln, ob die Täter dieselben waren wie die, die Kocaks Auto anzündeten, werden die Ermittlungen zeigen, würde man gern schreiben. Allein, die Ermittlungen haben in dieser Sache überhaupt noch nie irgendetwas gezeigt, weder jetzt noch bei der letzten Serie vor acht Jahren, als beispielsweise eine Einrichtung der Falken so oft attackiert wurde, dass die Jugendarbeit dort bis heute hinter einem meterhohen Hochsicherheitszaun stattfindet.

Tatort: Wildenbruchstraße

Gedenktafel Wildenbruchstr 10 (Neuk) Günter Bodek.JPG

Die beschmierten Häuser befinden sich in der Wildenbruchstraße, die in der Liste der Tatorte dieser Serie bereits mehrfach auftaucht: 2016 deponierten Unbekannte einen Brandsatz vor einem linken Café, ein weiteres Lokal, das als Treffpunkt linker und migrantischer Gruppen dient, wurde schon zweimal attackiert, zuletzt vor wenigen Wochen. Ebenfalls in der Wildenbruchstraße, Ecke Sonnenallee, befindet sich in einem imposanten Gebäude: die Polizeidienststelle Direktion 5, Abschnitt 54.

Quelle          :           TAZ         >>>>>         weiterlesen


Grafikquellen           :

Oben         —      Berlin-Neukölln,

This work has been released into the public domain by its author, Alex1011 at German Wikipedia. This applies worldwide.


Unten          —    Memorial plaque, Günter Bodek, Wildenbruchstraße 10, Berlin-Neukölln, Germany

Abgelegt unter Berlin, Bildung, Religionen, Überregional | Keine Kommentare »

Zerwürfnisse in der Linken

Erstellt von DL-Redaktion am 12. Dezember 2019

Linke muss noch mal nachsitzen

Sahra Wagenknecht and Dietmar Bartsch. Hannover Parteitag 2017.jpg

Sagt zum Abschied – bitte servus  ……..

Von Anna Lehmann

Auch im Drittel Anlauf scheitern die KandidatInnen, die Linke im Bundestag kriegt einfach keinen Vorstand zusammen. Die Gräben in der Fraktion.

Wieder eine Wahlniederlage für die Linke, diesmal eine interne. Dreimal hat die Partei im Bundestag versucht, ihren Fraktionsvorstand neu zu wählen. Auch nach dem dritten Wahlgang am Dienstag schafften es die Genossen nicht, ihren Vorstand in Gänze neu zu besetzen. Von der Aufbruchstimmung, die die beiden Fraktionschefs Amira Mohamed Ali und Dietmar Bartsch nach ihrer Wahl Mitte November verbreiten wollten, kann derzeit nicht die Rede sein. Abgeordnete sprechen vielmehr von desaströsen Zuständen.

Zwei Posten sind im 13-köpfigen Vorstand nach wie vor unbesetzt: ein Vize und die Stelle der Beauftragten für soziale Bewegungen. Für den Vizeposten kandidierten am Dienstag erneut Nicole Gohlke und Sören Pellmann. Während Pellmann, der bei der Bundestagswahl ein Direktmandat in Leipzig holte, der Wunschkandidat der Fraktionschefs ist, trat Gohlke als Repräsentantin der sogenannten Bewegungslinken an. Diese sehen sich als Initiative zur Erneuerung der Partei, die laut eigener Erklärung weg will von der „innerparteilichen Selbstzerfleischung“. Das offizielle Gründungstreffen findet an diesem Wochenende in Berlin statt.

Doch weder Pellmann noch Gohlke erreichten die nötige absolute Mehrheit von 35 der 69 Abgeordnetenstimmen. Für Gohlke stimmten 32 Abgeordnete, für Pellmann 31. Der Rest enthielt sich oder war nicht vor Ort. Ein klassisches Patt also.

Amira Mohamed Ali Rheda.jpg

Das gleiche Bild bei der Besetzung des dritten Postens, des Beauftragten für soziale Bewegungen. Dieser Vorstandsposten existiert erst seit 2017 und zwar als Konzession an das Lager um die Parteivorsitzende Katja Kipping. Lorenz Gösta Beutin, der klimapolitische Sprecher, trat zweimal an und scheiterte zweimal ohne GegenkandidatIn. Während er vor einem Monat mit 34 Stimmen knapp durchfiel, stimmten nun nur noch 24 Abgeordnete für ihn.

Wie zwei ineinander verkeilte Böcke

Er werde nicht noch einmal antreten, sagte Beutin der taz. Von der Klimakonferenz aus Madrid äußerte er sich ernüchtert über den Ausgang der Wahlen: „Die Hoffnung, dass mit der Neuwahl der Fraktionsspitze auch frischer Wind in die Fraktion kommt, hat sich erst einmal nicht erfüllt.“ Nun müsse die Führung in sich gehen und überlegen, wie sie diese Fraktion zusammenbringen wolle, um wieder handlungsfähig zu werden.

Aus dem Büro von Pellmann hieß es, er wolle erneut kandidieren. Gohlke ließ das noch offen.

Quelle        :         TAZ         >>>>>          weiterlesen


Grafikquellen         :

Oben         —         Die Spitzenkandidaten der Linkspartei für die Bundestagswahl 2017, Sahra Wagenknecht und Dietmar Bartsch, während des Bundesparteitages der Linken. 2. Tagung des 5. Parteitags der Linken. Vom 9. bis 11. Juni 2017 in Hannover.


Unten      —         MdB Amira Mohamed Ali (DIE LINKE) redet auf einer Veranstaltung in Rheda, Nordrhein-Westfalen.

Abgelegt unter Berlin, Bundestag, P. DIE LINKE, Überregional | Keine Kommentare »

Bewegung in der LINKEN?

Erstellt von DL-Redaktion am 11. Dezember 2019

Die Bewegungslinke gründet neue Strömung in der Partei

Nachdem die „Aufsteher in Erstarrung“ endeten wird in der braunen Suppe erneut kräftig gerührt? – Es kann der Frömmste nicht in Frieden leben – wenn es dem bösen Nachbarn nicht gefällt ?

Quelle      :       AKL

Von Sascha Staničić

Im Dezember gründet sich die Bewegungslinke als neue Bundesarbeitsgemeinschaft in der Partei DIE LINKE. Nicht wenige Parteimitglieder, die sich dem linken Flügel verbunden fühlen, verbinden damit die Hoffnung, dass DIE LINKE sich dahin bewegt, wo sie hingehört – nach links und auf die Straße. Ein Blick auf den Entwurf der Gründungserklärung der Bewegungslinken muss aber Skepsis hervorrufen.

Die Bewegungslinke ist entstanden aus den Konflikten, die sich im Zusammenhang mit Sahra Wagenknechts migrationspolitischen Positionen in der Parteiströmung Sozialistische Linke (SL) entwickelt hatten. Eine Mehrheit der SL unterstützte den linkspopulistisch-nationalen Kurs von Wagenknecht, während eine Minderheit um die Gruppe marx21 und andere die migrationspolitischen Positionen der Partei verteidigte. Diese Minderheit stellt nun den Kern der Bewegungslinken. Allein dieser Umstand legt die Vermutung nahe, dass wir es mit altem Wein in neuen Schläuchen zu tun haben.

Vieles, was die Bewegungslinke schreibt ist nicht falsch. Sie mahnt an, dass DIE LINKE verparlamentarisiert ist und sich zu wenig um soziale Bewegungen und Gewerkschaften kümmert. Sie sagt: Weniger Sitzungen, mehr Aktionen! Und sie will sich aktiv in die gesellschaftlichen Kämpfe gegen die Auswirkungen des kapitalistischen Systems einbringen. So weit, so gut. Doch die Praxis einer Partei ist letztendlich Folge ihres politischen Programms, ihrer Klassenzusammensetzung und ihrer politischen Perspektive und Orientierung.

Sozialismus fehlt

Das grundlegende Problem der Linkspartei ist, dass sie zwar von Sozialismus redet, aber kein sozialistisches Programm und keine sozialistische Perspektive vertritt; dass ihre nicht ganz selten guten Beschlüsse nur auf dem Papier stehen und nicht in praktische Politik umgesetzt werden – zum Beispiel wenn ein Bundesparteitag nach dem anderen auf Initiative von Parteilinken die Überführung der Banken und Konzerne in Gemeineigentum fordert, der Parteivorsitzende Bernd Riexinger sich aber explizit dagegen ausspricht, die Forderung nach Überführung der Autoindustrie in öffentliches Eigentum aufzustellen und stattdessen das Ausgeben von Belegschaftsaktien fordert, die die Arbeiter*innen dann doppelt zu Opfern der Krise in der Automobilindustrie machen würden und nichts an der umweltzerstörenden und profitgetriebenen Automobilproduktion ändern würden.

Regierungsbeteiligung als Gretchenfrage

Politisch drückt sich dieser Mangel an Sozialismus in der LINKEN unter anderem darin aus, dass große Teile der Partei darauf setzen in Regierungen mit den prokapitalistischen Parteien SPD und Grünen Arzt am Krankenbett des Kapitalismus zu spielen, anstatt alle Kraft darauf zu verwenden, Menschen aus der Arbeiter*innenklasse zu organisieren, um Verbesserungen von unten zu erkämpfen und den Kapitalismus perspektivisch zu überwinden. Diese politische Ausrichtung hat dazu geführt, dass sich die Partei in verschiedenen Landesregierungen von Mecklenburg-Vorpommern bis Bremen als zahnloser Tiger erwiesen hat, wenn nicht als Bettvorleger. Nirgends kann davon gesprochen werden, dass eine Regierungsbeteiligung der LINKEN zu dem viel versprochenen Politikwechsel geführt hat; oftmals hat sie sich an Kürzungen und Privatisierungen beteiligt, die sie haben in Konflikt mit denjenigen kommen lassen, die sie eigentlich vertreten soll: Lohnabhängige, Erwerbslose, sozial Benachteiligte, Gewerkschafter*innen. Ergebnis: DIE LINKE wird von vielen als linker Teil des politischen Establishments betrachtet und sie verliert in der Regel (mit der vorübergehenden Ausnahme von Thüringen) die Unterstützung, die sie sich vor dem Eintritt in die entsprechenden Regierungen aufgebaut hatte. Die Regierungsbeteiligung mit prokapitalistischen Parteien ist konzentrierter Ausdruck des mangelhaften Programms, der falschen Politik und Perspektive der Linkspartei. So kann es keine bewegungsorientierte, klassenkämpferische und antikapitalistische Partei geben.


Die Bewegungslinke setzt aber nicht an Programm und Politik der LINKEN an, sondern an ihrer Praxis. Diesen Ansatz verfolgt die marx21-Strömung schon seit Gründung der Partei – mit zweifelhaftem Erfolg. Gerade in diesem Jahr hat sich das Pendel in der Linkspartei wieder mehr nach rechts bewegt, nicht zuletzt durch die Regierungsbeteiligung der Partei in Bremen – zum ersten Mal in einem westdeutschen Bundesland. Die Fraktionsvorsitzende der LINKEN in der Bremischen Bürgerschaft ist Sofia Leonikadis, gleichzeitig einer der Köpfe der Bewegungslinken. Diese erklärt im Entwurf zu ihrer Gründungserklärung, dass an ihr auch solche Parteilinke beteiligt sind, die Regierungskoalitionen mit SPD und Grünen als Teil des Wegs zu gesellschaftlicher Veränderung sehen. Dieser Versuch sich zu waschen ohne nass zu werden ist zum Scheitern verurteilt.

Leonidakis, Sophia-9483.jpg

Eine sozialistische Parteilinke muss als Ausgangspunkt eine schonungslose Kritik der bestehenden Politik, Programmatik und Praxis der Linkspartei nehmen. Die Systemimmanenz großer Teile der Partei und die Ausrichtung auf Koalitionen mit SPD und Grünen müssen Ausgangspunkt dieser Kritik sein. Davon ausgehend kann dann eine Debatte über Inhalte und Strategien für eine Parteilinke stattfinden. Eine Parteilinke, die aber die Verwaltung des kapitalistischen Elends in Kooperation mit den Hartz IV-Parteien als eine Möglichkeit sozialistischer Politik betrachtet, bringt einen schweren Geburtsfehler mit, der sie daran hindern wird, eine wirkliche Alternative zum jetzigen Kurs der Partei zu formulieren.

Die einzige Bundesarbeitsgemeinschaft in der LINKEN, die eine solche Kritik formuliert und Koalitionen mit SPD und Grünen konsequent ablehnt ist die Antikapitalistische Linke (AKL).

Sascha Staničić ist Mitglied des AKL Länderrats und Bundessprecher der Sozialistischen Organisation Solidarität (Sol).

akl - Antikapitalistische Linke


Grafikquellen      :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt

Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons


Unten         — 

Sophia Leonidakis (* 27. April 1984 in Überlingen) ist eine bremische Politikerin (Die Linke) und Abgeordnete der Bremischen Bürgerschaft.

Abgelegt unter Berlin, Bremen, P. DIE LINKE, Saarland, Überregional | Keine Kommentare »

DIE LINKE. St. Johann:

Erstellt von DL-Redaktion am 7. Dezember 2019

Umbenennung der Neikesstraße muss auf die Tagesordnung des Bezirksrates Mitte

Lichtsignalanlage Busanforderung Johanneskirche Saarbrücken.jpg

Quelle        :        Scharf  —  Links

Von DIE LINKE. Saarbrücken

Der Ortsverband St. Johann der Partei DIE LINKE fordert die Umbenennung der Neikesstraße. Der Namensgeber war bis zu Machtergreifung der Faschisten an der Saar Oberbürgermeister der Landeshauptstadt.

Unabhängig davon, dass er sich massiv für den Anschluss an das nationalsozialistische Deutschland einsetzte, verlieh er 1934 Adolf Hitler die Ehrenbürgerschaft. Dies drückt in einem eindeutigen Maße die Gesinnung Hans Neikes‘ aus.

Einen Vorschlag, wer neuer Namensgeber dieser Straße werden könnte, macht DIE LINKE. St. Johann bewusst nicht. Nach Auffassung der Partei DIE LINKE gäbe es zahlreiche Saarbrücker Persönlichkeiten mit herausragenden Biographien. Wichtig ist, dass die schrecklichen Jahre der Saarbrücker Geschichte nicht verklärend als Straßenschilder herausgehoben werden.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle        :    Lichtsignalanlage mit aktivem zusätzlichem Lichtsignal „Weißes A“ als Indikator für eine registrierte Busanforderung, mit der Johanneskirche Saarbrücken und der Saarbahnhaltestelle „Johanneskirche“ im Hintergrund

Abgelegt unter P. DIE LINKE, Positionen, Saarbrücken, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 7. Dezember 2019

Alter? Ist doch ganz egal

File:Maischberger - 2016-12-14-7439.jpg

Von Bettina Gaus

Jüngere sind nicht automatisch doof, weil sie jünger sind. Und Ältere nicht, weil sie älter sind. Widmen wir uns also der Sache – und ziehen keine Schlüsse aus Geburtsdaten.

Junge Leute haben gemeinsam, dass sie jung sind, und das ist weder eine tolle Eigenschaft noch eine schlechte. Überzogene Hoffnungen, die Ältere oft mit ihnen allein wegen des Geburtsdatums verbinden, sind vor allem eines: Kitsch. Während Kritik an ihrer mangelnden Erfahrung meist ohne weitere Argumente auskommt, sondern sich lediglich nörglerisch und schlecht gelaunt präsentiert.

Thomas Mann war etwas jünger als Rezo, der erfolgreichste deutsche YouTuber dieses Jahres, als er die „Buddenbrooks“ veröffentlichte. Gerade das Bildungsbürgertum sollte nicht panisch reagieren, wenn sich Leute mit Mitte 20 oder Anfang 30 zu Wort melden und gehört werden. Sonst ist es mit der Bildung offenbar nicht weit her. Das Video „Die Zerstörung der CDU“, mit dem Rezo die Union in Not brachte, ist inzwischen mehr als 16 Millionen Mal geklickt worden. Damit lässt sich kein Nobelpreis gewinnen. Aber durchaus der Anspruch ableiten, ernst genommen zu werden.

Sebastian Kurz wurde im Alter von 31 Jahren österreichischer Bundeskanzler. Gegen seine Politik fällt mir vieles ein. Sein Alter ist mir egal. Übrigens hat er sein ganzes bisheriges Leben als Erwachsener in der Politik verbracht und sein Studium nie abgeschlossen. Genau wie der deutsche Juso-Vorsitzende Kevin Kühnert, 30. Viele der Argumente, die in den letzten Tagen gegen diesen ins Feld geführt wurden, sagen mehr über die – meist männlichen – Leserbriefschreiber und Nutzer sozialer Medien aus als über ihn. Der hat doch noch nie gearbeitet, der soll mal früh um sechs auf den Bau gehen müssen.

Ich wünsche all denen, die so etwas schreiben, dass sie einmal mit der Führung einer Organisation betraut werden, die etwa 80.000 Mitglieder hat. Wie die Jusos. Kevin Kühnert hat es nicht nur geschafft, den Laden zusammenzuhalten, sondern sogar, ihn wieder zu einer wichtigen politischen Kraft zu machen. Kompliment.

2018-02-23 Kevin Kühnert 0087.JPG

Das ändert allerdings nichts daran, dass seine Öffentlichkeitsarbeit in den letzten Tagen überraschend dämlich war. Wer sich mit ihm solidarisieren wollte, hatte es nicht leicht. Zwei Saltos rückwärts, einige Ausfallschritte und ein Purzelbaum nach vorne lösten Ratlosigkeit aus. Was will er denn nun? Groko ja, Groko nein – oder hat er in diesem Zusammenhang niemals eine Forderung gestellt? Auch nicht die, den Koalitionsvertrag neu verhandeln zu wollen?

Quelle         ;       TAZ         >>>>>         weiterlesen


Grafikquelle          :Oben     — 

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: © Raimond Spekking / CC BY-SA 4.0 (via Wikimedia Commons)


Unten        —     Kevin Kühnert, deutscher Politiker (SPD) und Bundesvorsitzender der Jusos. Hier während seiner Tour durch Deutschland in Sachen #NoGroKo am 23.02.2018 in München (TV-Interview). Titel des Werks: „Kevin Kühnert (2018 in München)“

Abgelegt unter Kultur, Medien, Mensch, Überregional | Keine Kommentare »

Wo nicht die Banane,

Erstellt von DL-Redaktion am 6. Dezember 2019

 sondern die Republik matschig ist

2017-01-09-Rainer Wendt-hart aber fair-9613.jpg

Eine Kolumne von

In Sachsen-Anhalt wollte die CDU Rainer Wendt zum Staatssekretär machen und fragte wohl nicht nach seiner Kompetenz. In Frankfurt will sie dafür alles über die Frau des Oberbürgermeisters wissen.


Was ist eine Bananenrepublik? Die DDR war bekanntlich keine. Metaphorisch ist eine Bananenrepublik zu Hause, wo nicht die Banane, sondern die Republik matschig ist. Das klassische Modell sieht vor, dass ein ganz normales Unternehmen der Südfrüchte-Industrie in einem warmen Land eine ausreichende Zahl von Generälen und Staatssekretären mit Luxusvillen, Luxusautos und Luxusweibern ausstattet, damit die zum Fortbestand der Welt erforderlichen Geschäfte des Obst-, Kupfer- oder Gold-Exports ohne nennenswerte Störungen durch eingeborene Veganer abgewickelt werden können. Infolge der allgemeinen Modernisierung wirken die entsprechenden Filme aus den Fünfzigern und Sechzigern allerdings inzwischen etwas verstaubt.

Im deutschen Bundesland Sachsen-Anhalt wachsen bislang aus Klimagründen keine Bananen. Da sich das schnell ändern kann, muss die Polizei vorbereitet sein, bevor es losgeht mit dem bananenrepublikmäßigen Niedergang. Genau hier setzte der mutige Plan an, Deutschlands härtesten Polizeihauptkommissar a.D., Rainer Wendt, zum für die Polizei des ganzen Bundeslandes zuständigen Innenstaatssekretär zu machen. Das wäre für den etwas überstürzt pensionierten Beamten der durch Nicht-Dienst errungenen Besoldungsgruppe A 12 (entsprechend: Amtsrat in der Verwaltung), der auf eine Verwaltungserfahrung als Dienstgruppenleiter im Schichtdienst bei der Schutzpolizei zurückblicken kann, eine schöne Herausforderung in der zwölf Stufen höheren Besoldungsgruppe B 9 gewesen.

Es stellt sich hier nicht die Frage, ob man das Herrn Wendt persönlich gönnen mochte: Auch im Lotto muss ja schließlich irgendwer gewinnen, und wenn man eigentlich jeden nehmen kann, kann’s ja auch ein pensionierter Schutzmann aus der Versicherungsbranche sein. Mit etwas Verantwortungsbewusstsein könnte einem zwar die Frage kommen, ob einem ganzen Bundesland ein oberster Verwaltungsbeamter zu gönnen ist, dessen Verwaltungskompetenz sich auf eine Dienstgruppenleitung bei der Duisburger Schutzpolizei beschränkt. Diese Frage wurde aber ausdrücklich selbst dann nicht diskutiert, als die „große Freude“ in der Staatskanzlei verebbt war. Man wandte sich vielmehr der Frage zu, ob PHK Wendt als Innenstaatssekretär eher eine Lachnummer oder ein Appetithäppchen für die AfD hätte sein sollen. Und ob sich ein großmächtiger Innenminister in seine durchdachte Personalpolitik hereinreden lassen mögen darf.


Szenenwechsel: Auf der Suche nach dem Bananenunwesen in der Metropole Frankfurt am Main hat der Kolumnist einer dortigen Zeitung am 30.11. den ortsansässigen „Marxismus-Feminismus“ in den Fokus genommen, womit er selbstverständlich nicht die hessische CDU meinte, sondern die Brutstätte des Nepotismus im proletarisch-türkischen Sumpf, wie er seit jeher im Schatten des blitzsauberen Bankenviertels gedeiht. Während sich die Rest-SPD hinter ihren neuen Speerspitzen versammelt, behauptet nämlich ein ihr angehörender 61-jähriger Wahlbeamter der Besoldungsstufe B 11, er wisse nicht, wieviel seine 32-jährige Ehefrau als Kita-Leiterin bei der Arbeiter(!)-Wohlfahrt verdient: Es handelt sich, wie „FAZ“, „Welt“ und „Bild“ erfahren haben, um die unerhörte Summe von monatlich etwa 4200 Euro brutto (in Lohnsteuerklasse V kommen ca. 2200 Euro netto heraus). Solche Ahnungslosigkeit kann nur glauben, wer es auch nicht verdächtig findet, dass der Altersunterschied bei Bürgermeisters größer als bei Macrons ist, der Vorname der Frau türkisch und die von ihr geleitete Kita „deutsch-türkisch“, wie wir lesen durften. Und so blöd ist man weder bei diesen Zeitungen noch in der Frankfurter CDU.

Die Sozialdezernentin (CDU) der Stadt Frankfurt hat angesichts des Abgrunds gleich mal die „Zuschüsse eingefroren“ (die an die AWO), und im Halbtagesrhythmus lesen wir, dass sich „die Affäre ausweitet“ („FAZ“). Es fehlt nicht mehr viel, und „Bild“, „Welt“, „FAZ“ und HR rufen gemeinsam die Schlecker-Frauen oder die Bewohner des Ostends gegen den Feldmannschen Dienstwagen (Ford Focus!) in den Straßenkampf: Hongkong ist überall! Der Baudezernent (CDU) macht sich Sorgen um das Klima, weil der Dienst-Ford, wie er herausgefunden hat, CO2 ausstößt. Und die „FAZ“ fragt zum ersten Advent basisdemokratisch ihre Leser: „Wie soll es weiter gehen mit Peter Feldmann?“.

Wie die „Bunte“ zu der Sache steht, ist noch offen, da Frau Feldmann vor noch nicht langer Zeit dort als „wunderschöne Braut“ lief, was vermutlich die alten Säcke bei der „FAZ“ und der CDU echt neidisch gemacht hat. Wir würden natürlich gern wissen, wie sich das Gehalts- und Dienstwagengefüge bei ihren eigenen Bräuten darstellt, aber das ist super geheim und nur den Eliteforschern von der AfD bekannt.

Ja, es geht bergab in der Bananenrepublik! Der Herr Professor Meuthen und die Frau Doktor Weidel haben es schon immer gesagt, und die verstehen etwas davon. An dem ganzen Desaster ist aber die CDU Sachsen-Anhalt völlig unschuldig. Schuld sind ist erstens und im Allgemeinen das Kanzleramt, zweitens und im Besonderen der Duzfreund des Innenministers, Terminator Wendt, der bei seinem Anstellungsgespräch glatt vergessen hat zu erwähnen, dass eine Disziplinarmaßnahme gegen ihn verhängt wurde, weswegen er leider gar nicht eingestellt werden dürfte. So etwas Geheimes konnte natürlich ein Innenminister weder wissen noch ahnen!

Wäre Herr Wendt ein Volkspolizei-Kommissar in der DDR gewesen und hätte er sich im Jahr 1990 ähnlich schusselig um eine Anstellung als Staatssekretär (die Hoffnung stirbt zuletzt) oder Schichtleiter bei der Schutzpolizei Wernigerode beworben, hätte man ihn vermutlich wegen versuchten Anstellungsbetrugs verfolgt oder wegen Geschäftsunfähigkeit unter Betreuung gestellt. Aber das ist lange her. Die Mauer ist verschwunden und mit ihr die Arbeiterklasse, die jetzt „die Menschen“ heißt. Die Linke hat zwar gegen den Versicherungs-Fachmann Strafanzeige erstattet, aber wir ahnen, dass der Kommissar a.D. sich im berufstypisch unvermeidlichen Verbotsirrtum befunden haben könnte.


Apropos DDR: Geschichte wiederholt sich nicht. Deshalb ist es auch ziemlich egal, ob man Herrn Höcke „Faschist“ nennen darf, was jetzt manche Antifaschisten gerne tun, vor allem im Fernsehen, in der kindlichen Hoffnung, dann würden „die Menschen“ sagen: Ja wenn das so ist!, und wieder SPD wählen oder wenigstens AKK. Dabei übersehen sie, dass Herr Höcke nicht gewählt wird, obwohl er Faschist ist, sondern weil er es ist. Und dass Herr Höcke sich nicht wie Rumpelstilzchen in der Luft zerreißt, wenn man seinen geheimen Namen herausgefunden hat. Die heutige Jugend jeden Alters glaubt leider an Zauberwörter und denkt, „Faschismus“ sei, wenn man Juden hasst, albern spricht und Antifaschisten zusammenschlägt. Das täuscht.

Quelle     :          Spiegel-online            >>>>>             weiterlesen


Grafikquellen         :

Oben         —          Rainer Wendt in der WDR-Sendung „hart aber fair“ am 9. Januar 2017

Autor    —     „© Superbass / CC-BY-SA-4.0 (via Wikimedia Commons)“

File:2017-01-09-Rainer Wendt-hart aber fair-9613.jpg


Unten           —        Systemkritische Protestfahne „BananenRepublik Deutschland“

Abgelegt unter Hessen, Justiz-Kommentare, Sachsen-Anhalt, Überregional | Keine Kommentare »

Linke lässt Mandat prüfen

Erstellt von DL-Redaktion am 6. Dezember 2019


Gruppenbild der Kandidat*innen Landesliste für die Landtagswahl 2019

Von dpa

Die Brandenburger Linke hat das von Ex-CDU-Landeschefin Saskia Ludwig beabsichtigte Doppelmandat in Bundestag und Landtag prüfen lassen. Der Parlamentarische Beratungsdienst (PBD) sei in seinem Gutachten zu dem Ergebnis gekommen, dass die Funktionsfähigkeit des Landtages durch die beiden Mandate beeinträchtigt sein könne, da nach Bundesrecht die Ausübung des Mandates im Mittelpunkt der Tätigkeit des Bundestagsmitgliedes stehe, zitierten die Linken am Dienstag aus dem Gutachten. Halte sich das Mitglied daran, könne das Landtagsmandat nur noch „am Rande“ ausgeübt werden, hieß es weiter.

Ludwig will für Brandenburgs Innenminister Michael Stübgen (CDU) als Abgeordnete in den Bundestag nachrücken. Stübgen hatte sein Mandat wegen seines Ministerpostens niedergelegt. Ludwig kündigte an, vorerst parallel auch Landtagsabgeordnete bleiben zu wollen.

Portrait saskia ludwig.jpg

„Wir halten dieses Doppelmandat und auch das, was Frau Ludwig hier verkündet hat, für einen handfesten Skandal“, sagte Linken-Fraktionschef Sebastian Walter. Die Linken wollen kommende Woche einen Änderungsantrag einbringen, der Doppelmandate in Zukunft ausschließt.

Quelle         :      Berliner – Morgenpost          >>>>>       weiterlesen


Grafikquellen        :

Oben       —         Die Linke LV Brandenburg


Unten       —           Offizielles Portraitfoto der Politikerin Saskia Ludwig.

Abgelegt unter Brandenburg, P. DIE LINKE, P.CDU / CSU, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 3. Dezember 2019

Schöffe am Amtsgericht in Euskirchen

File:1031616 Amtsgericht Euskirchen.jpg

Quelle       :         untergrund-blättle     CH.

Von   Richard Albrecht

Im letzten Jahrzehnt war ich vor einigen Jahren einige Jahre lang ehrenamtlicher Richter. Genauer: (Hilfs-) Schöffe an einem Amtsgericht in der Rheineifel.

Euskirchen, historisch Oiskirchn, ist das Tor der Eifel. Aber nicht alle Euskirchner sind Eifler Toren. Es hat auch dort einige Autoren.

Das dortige Amtsgericht ist baulich neu und liegt zentral für alle, die mit dem Zug oder dem Auto anreisen. In den Kleinen Saal wurde in Handschellen reingebracht ein Angeklagter, den ich gut ein Jahrzehnt vor der Verhandlung einmal beobachtete wie er am Bach Frösche fing und mit dem ich über die Jahre auch zwei, drei Sätze irgendwas sprach.

Was er getan haben sollte Jahre bevor er als Angeklagter befragt wurde fiel unters Jugendstrafrecht.

Merkwürdig war, dass Monate vergingen bevor er nach erster polizeilicher Auffälligkeit vor seinen ersten Richter kam. Ich fragte nach. Der Berufsrichter am Amtsgericht war lange Jahre lang Direktor des nahegelegenen Hauses, in dem ich später 15 Tage als Busse für die angebliche „Beleidigung“ eines Rechtsadvokaten abbüssen sollte. Er liess als Vorsitzender pausieren und erklärte im Beratungsraum wortreich, warum´s so war damit das wirken konnte, was Pädagogik genannt wird.

Ob der – nun – junge Mann, den ich – wieder´n paar Jahre später – noch einmal zwischen Regalen in einem Supermarkt sah und den ich an seinen so hellen wie wachen Augen wiedererkannte, nun schlussendlich wegen seines ersten Altdelikts verurteilt wurde oder auch nicht, kann ich nicht wissen.

Die Verhandlung, an der ich laienrichterlich teilnahm, musste aus formalen Gründen vertagt werden.

Die letzte Gerichtsverhandlung, an der ich, ehrenamtlich überhöht sitzend, teilnahm, war geheim: „aus Gründen“ des Jugendschutzes wurde was „die Öffentlichkeit“ heisst ausgeschlossen.

Der alte Mann war das erste Mal in seinem Leben öffentlich angeklagt. Er fühlte sich unschuldig und schämte sich nicht. Sondern hatte Angst vor seiner Frau. Denn er sollte, so staatsanwaltschaftliche Ermittlungen, von hinten eine Minderjährige begrapscht haben.

Diese erschien gross und prall. Die Gutachterin wissend und eifernd.

Der Mann war nicht nur ein alter, sondern auch ein kleiner Mann. Würde er wie allseits beredt behauptet die Titten nicht nur von hinten, sondern auch von oben begrabscht haben, hätte er auf einer kleinen Leiter oder auf einigen Telefonbüchern der Kreise Bergheim-Düren-Euskirchen stehen müssen.

Als ich dies, ehrenamtlich-richternd und gutachterlich-kritisch, anmerkte – herrschte sekundenlang so kundiges wie beredtes Schweigen.

Was den Vorsitzenden trotz Advokatenprotest nicht hinderte, wie Basta durchzuziehen. Und den kleinen alten Mann, der seine Unschuld beteuerte und den die Angst vor seiner Frau schwitzen machte, zu einer milden Geldstrafe zu verurteilen.

Die Verhandlung wurde weder zur Beratung unterbrochen noch später ausgesetzt.

Diesen Berufsrichter sah ich erst Monate später in anderem Zusammenhang im selben Amtsgericht während meines eigenen, von ihm beförderten, Prozesses wegen angeblicher „Beleidigung“ eines Bonner Rechtsadvokaten ebendort wieder – in der Gerichtskantine, nachdem der gegen mich als Angeklagten veranlasste Prozess wegen Besorgnis berufsrichterlicher Befangenheit vertagt wurde.

Seitdem ward er von mir nimmer gesehen.

Und das war und das ist auch nur gut so.

Diese Kurzerzählung erschien zuerst im Sammelband des Autors HELDENTOD. Kurze Texte aus Langen Jahren (Aachen: Shaker Media, 2011).


Grafikquelle          :         Amtsgericht Euskirchen, Sept. 2007

Author Wikoli       —        Source  :  Own work

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Justiz-Kommentare, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 3. Dezember 2019

Die Welt als Wunder

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ariane Lemme

Dialektik der Aufklärung 2.0. Die Woche hat mal wieder gezeit, wie eng Diskurse geführt werden. Eine gute Party funktioniert anders.

Ein bisschen befremdlich finde ich es ja immer, wenn Erwachsene andere Erwachsene (meist auf Buchrücken oder in schlecht geschriebenen Rezensionen) dafür loben, „noch staunen zu können wie ein Kind“. Der Welt nicht gleichgültig, sondern mit Liebe und Aufmerksamkeit begegnen kann man auch, ohne dass man fallenden Blättern hinterhertaumelt und bei jeder Äußerung, die nicht dem eigenen Weltbild entspricht, die Kinnlade fallen lässt. Diese Woche aber war die Welt mal wieder derart Freakshow, dass ich, trotz déformation professionelle, sprich: zum Zynismus erzogen, aus dem Staunen nicht herausgekommen bin.

Dabei fing alles ganz harmlos an. Ich war nach Hannover gefahren, um mal etwas Schönes zu machen. Ein Baby angucken. Über Babys, das gebe ich zu, konnte ich schon immer staunen, so viel Persönlichkeit auf so wenig Kubikzentimetern zusammengefaltet.

Dann aber ging’s los: Massen an Polizisten, die meisten zu Pferd, als wollten sie Game of Thrones reenacten. Tatsächlich aber wollten sie 120 NPD­lern (Sie erinnern sich – diese Partei, die zu irrelevant war, um sie zu verbieten) ihr Recht auf Demonstrationsfreiheit sichern. Na gut, dachte ich, der Rechtsstaat funktioniert, wer nicht verboten ist, darf eben demonstrieren. Auch wenn er, anerkanntermaßen, verfassungsfeindlich ist. Bitte sehr.

Über genau diesen funktionierenden Rechtsstaat hab ich mich dann aber, kaum zurück in Berlin, doch sehr gewundert. Nämlich als er dem Verein VVN-BdA, kurz für Vereinigung der Verfolgten des Naziregimes – Bund der Antifaschistinnen und Antifaschisten, die Gemeinnützigkeit aberkannte.

Grund: Der Landesverband in Bayern sei im bayerischen Verfassungsschutzbericht wiederholt als „linksextremistisch beeinflusst“ bewertet worden. Eigentlich ist zu dem Thema alles gesagt, namentlich hier in dieser Zeitung von ­Jagoda Marinić.

Sprachlos bin ich trotzdem noch angesichts der kognitiven Dissonanz, die bei denen grassieren muss, die nach dem antisemitischen Anschlag in Halle gerade erst allerlei Dinge im Kampf gegen den Antisemitismus gefordert haben. Mehr Gesetze, mehr Zivilgesellschaft, mehr Blabla. Ganz nach dem Motto: Wie soll ich wissen, was ich denke, bevor ich höre, was ich sage?

Quelle         :          TAZ         >>>>>       weiterlesen


Grafikquellen       :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Berlin, Kultur, Positionen, Überregional | Keine Kommentare »

NRW / Sagel verläßt Linke

Erstellt von DL-Redaktion am 2. Dezember 2019

NRW – Leitlinien und ein Austritt in Bielefeld

Rüdiger Sagel.jpg

Von Sebastian Weiermann, Bielefeld

Der Landesparteitag der LINKEN in Nordrhein-Westfalen hat die Kommunalwahl 2020 vorbereitet.

Für die Linkspartei in Nordrhein-Westfalen ist es nicht leicht, auf sich aufmerksam zu machen. Zwar kommen zu ihrem Parteitag am Wochenende in Bielefeld prominente Bundestagsabgeordnete aus dem Bundesland und mit Özlem Alev Demirel sitzt nun eine fest in der nordrhein-westfälischen LINKEN verankerte Politikerin im Bundestag, aber der Partei fehlt die Präsenz im Landtag.

Ein bisschen Glanz brachte der Parteivorsitzende Bernd Riexinger in den Parteitag. In seiner Rede sprach er sich gegen die AfD und für Solidarität mit der antifaschistischen Organisation VVN-BdA aus. Das neue Vorsitzendenduo der SPD aus Esken und Walter-Borjans kommentierte Riexinger wohlwollend. Es sei zwar fraglich, ob es wirklich eine Erneuerung der SPD gäbe, aber die abstimmenden Mitglieder hätten sich für eine »sozialdemokratischere« Partei ausgesprochen. Das sei kein Grund, von Zusammenschlüssen zu träumen. Die LINKE habe ihren Platz links von der SPD. Sie kämpfe für »demokratischen Sozialismus«. Über Saskia Esken wusste Riexinger noch zu berichten, dass er sie im Jugendzentrum »zum Teil mit politisiert« habe. Das habe offensichtlich nur für die SPD gereicht – aber »immerhin linker Flügel«, wie er anmerkte.

Zentrales Thema des Parteitags war allerdings nicht die SPD, sondern die Vorbereitung auf die Kommunalwahlen, die im September 2020 stattfinden. Dass die Themen dafür in den Städten gesetzt werden, war den Delegierten klar. Aber man wollte mit den »Kommunalpolitischen Leitlinien« einen »Steinbruch« entwickeln, aus dem die Kreisverbände sich bedienen können, wie Landessprecher Christian Leye erklärte. Es sei wichtig, sich auf Landesebene über gewisse Positionen verständige. Man sende damit ein »Signal«, wo man stehe. Die Leitlinien, die er Parteitag beschlossen hat, umfassen mehr als 100 Seiten und bilden das ganze Spektrum der Politik ab. Darin geht es sowohl um größere Fragen, wie der Positionierung der LINKEN gegen Hartz-IV-Sanktionen, als auch um Details, etwa ob man für oder gegen Kunstrasenplätze sei. Diskutiert wurde, ob in den Leitlinien von »Arbeitslosigkeit« oder »Erwerbslosigkeit« die Rede sein solle. Für den ersten Begriff spreche dessen Allgemeingültigkeit, für den zweiten, dass Lohnarbeit damit nicht überhöht würde, worauf die Delegierten sich dann einigten.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Laut und leidenschaftlich wurde es nur selten. Etwa bei der Frage danach, ob der Energiekonzern RWE »verstaatlicht« oder »zerschlagen« werden sollte oder beim Thema Prostitution, bei dem es eine Bandbreite an Positionen gibt, die von einer Liberalisierung bis zum Sexkaufverbot reicht. Man einigte sich auf Grundsätzliches wie Beratungsangebote und die Stärkung von Hilfsmöglichkeiten für die Menschen in der Branche.

Quelle          :          ND         >>>>>           weiterlesen


Grafikquellen       :

Oben       —         Rüdiger Sagel


Unten        —       Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:


  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Eine Schifffahrt, die ist …

Erstellt von DL-Redaktion am 1. Dezember 2019

Die Binnenschifffahrt könnte dabei helfen die Klimaziele zu retten

SophienhafenHalle WSA.JPG

Von Annette Jensen

Die Binnenschifffahrt könnte dabei helfen, die deutschen Klimaziele zu erreichen. Doch die marode Infrastruktur und der Trend zu immer schnelleren Lieferungen erschweren das.

Warten. Am Kai nebenan quietscht seit Stunden ein Kran, der Getreide in ein Schiff schaufelt. Auf der „MS Catharina“ aber ist es still. Ab und zu fegt eine Sturmböe über das flache Schiff und das eingezäunte Gelände im Magdeburger Hafen, auf dem plastikverpackte Rotoren und andere Bauteile für Windräder lagern. Bei diesem Wetter ist es zu gefährlich, 68 Meter lange Flügel zu verladen.

Für Kapitän Klaus Hohenbild, seinen Bruder Karl Georg und seinen Sohn Christoph war das Wochenende am Sonntag schon vorbei. Da sind sie knapp fünf Stunden mit dem Auto von ihrer Heimatstadt Emmerich am Rhein nach Magdeburg an der Elbe gefahren. Sie wollten unbedingt rechtzeitig auf ihrem Schiff sein, wenn der Lkw mit ihrer Ladung eintrifft. Doch jetzt müssen sie erst mal warten.

Zweimal hat Klaus Hohenbild oben am Kai schon nachgefragt. Dann kam der Anruf: Heute nicht. Morgen, vielleicht. Der 65-Jährige brummt und schaut aus dem Fenster. Das Schiff bewegt sich kaum. Vom Sturm merkt man im Bauch der 100 Meter langen „MS Catharina“ so gut wie nichts.

Wenn es nach der Bundesregierung geht, sollen Familie Hohenbild und ihr Schiff dabei helfen, die deutschen Klimaziele zu erreichen. Sie will den Gütertransport von der Straße auf Schienen und Flüsse verlagern. Das Bundesverkehrsministerium unter Andreas Scheuer will die „Attraktivität für Industrie und Logistik steigern“, heißt es im Klimaschutzprogramm.

Denn der Transport auf dem Wasser ist deutlich klimafreundlicher als mit dem Lkw, die in Deutschland gegenwärtig über 70 Prozent des Transports abwickeln. Die Binnenschifffahrt dümpelt bei gerade mal 8 Prozent vor sich hin. Laut Umweltbundesamt werden bei Gütertransporten mit dem Lkw Treib­haus­gase der Menge 103 Gramm pro Tonnenkilometer ausgestoßen, mit der Binnenschifffahrt sind es nur 32 Gramm. Noch in den 1960er Jahren teilten sich Bahn, Laster und Schiff die Transporte zu etwa gleichen Teilen – danach ging es mit der Schifffahrt ab- und mit dem Straßentransport aufwärts. Wie kam die Schifffahrt in die Krise? Und kann man das Ruder wieder rumreißen?

Karl Georg will jetzt etwas tun, um die Wartezeit zu überbrücken. Bekleidet mit Blaumann und ausgebleichtem Stoffhütchen steigt er die steile Treppe in den Maschinenraum hinunter, um dort ein bisschen aufzuräumen und Werkzeuge und Farbtöpfe zu sortieren. Alles ist gut ausgeleuchtet hier, Boden und Bleche sind rot und gelb lackiert, die Rohre grün. Es riecht nach Diesel, obwohl nirgendwo ein Tröpfchen Öl zu sehen ist. Nach einem Kohletransport schrubben sie den Frachtraum sechs bis sieben Stunden lang, bis dort bedenkenlos die nächste Ladung Korn, Dünger, Streusalz oder Windradflügel gelagert werden können. „Schrott transportieren wir nicht. Das gibt zu viele Beulen“, erzählt Karl Georg.

Die drei Hohenbilds hoffen, dass die Fahrt nach Bremen am nächsten Tag beginnen kann. Am Freitag sollen sie dort abladen, anschließend werden die Windradflügel in die Türkei verschifft. Jetzt ist es ist Montag. Sie haben also fünf Tage Zeit, um von Magdeburg nach Bremen zu kommen. Fünf Tage für 385 Kilometer. Das sollte schaffbar sein – oder?

Die Probleme der Schifffahrt

Wartezeiten gehören für Binnenschiffer zum Geschäft. Lade- und Löschzeiten sind Teil der Verträge. Und so werden die Hohenbilds auch für die Verzögerung in Magdeburg ein Ausfallgeld vom Auftraggeber bekommen. Das decke die laufenden Kosten aber kaum, sagt Klaus Hohenbild. Seine Familie ist auch Mitglied in einem Netzwerk, in dem er und seine Kollegen anonym ihre Frachtpreise einstellen, um einem Unterbietungswettbewerb entgegenzuwirken.

„Als ich anfing, war es eine Sensation, wenn eine Schleuse mal zwei Wochen lang nicht funktionierte“, erinnert sich Klaus Hohenbild, während er es sich auf dem Steuer­mannsitz im Führerhaus bequem macht und die Füße hochlegt. Fast 50 Jahre liegt seine Lehrzeit zurück; genau wie sein Sohn Christoph sein Azubi war, so hat auch er auf dem Schiff seines Vaters gelernt.

Klaus Hohenbild holt sein Handy raus, er möchte zeigen, was in der Binnenschifffahrt schief läuft. Auf einem Foto sieht man einen Mann in einem neongelben Anzug, der sich an einem Betonklotz festgekettet hat und an einem Seil zieht. „Das ist im Weser-Datteln-Kanal. Da setzen sie jetzt sogenannte Festmacher ein“, empört er sich. Sein Bruder Karl Georg kichert. Die Innenwände dieser Schleusen sind so marode, dass die Schiffe ihre Taue nicht mehr um die Poller legen dürfen. Obwohl es sich um eine der am meisten befahrenen Wasserstraßen handelt, erließ das Amt vergangenes Jahr auch die Anweisung, dass immer nur ein Schiff auf einmal einfahren darf.

Hohenbild wischt über den Bildschirm und zeigt eine unscharfe Aufnahme: ein winziges Sportboot, das in die über hundert Meter lange Schleusenkammer tuckert. Es ist klein genug, um gemeinsam mit anderen Schiffen durchgeschleust zu werden. Das geht aber nicht – wegen der Anweisung. So entstehen lange Warteschlangen. „Vier, fünf, sechs, sieben Stunden Wartezeit“, sagt Kapitän Hohenbild. Weil die verladende Industrie protestierte, setzt die Schifffahrtsverwaltung jetzt Männer im Dreischichtbetrieb ein, die den Schiffen beim Festmachen helfen. Wie lange dieses Provisorium weitergehen soll? „Weiß keiner. Wir wissen es jedenfalls nicht.“

Auf dem Weg bis nach Bremen müssen sie elfmal in eine Schleuse einfahren, um Staustufen zu überwinden. Auch hier heißt es häufig warten. Da ist die Schleuse Drakenburg, die seit Monaten klemmt. In Minden gibt es seit zwei Jahren eine neue Anlage, die aber nur von großen Schiffen genutzt werden darf. „Sie soll wohl geschont werden“, mutmaßt Kapitän Klaus Hohenbild. Die „MS Catharina“ muss hier oft stundenlang an der Anlage für kleinere Schiffe ausharren. Beide Schleusen werden aus der Ferne gesteuert – und eine parallele Bedienung ist offenbar nicht möglich oder vorgesehen. „Behörde“, stöhnt der sonst so gelassen wirkende Mann.

Zuständig für den Zustand der Schleusen und der Binnenschifffahrt ist die Wasser- und Schifffahrtsverwaltung (WSV). „Da ist kein Zug drin, das System ist krank, keiner will da die Verantwortung übernehmen“, sagt der Kapitän. Jeder Anruf bei der WSV sei schwierig. Oft erreiche er dort niemanden oder er müsse betteln, um zu einer zuständigen Person durchgestellt zu werden.

Erst ein paar Tage alt ist die Meldung, dass der Nord-Ostsee-Kanal für große Schiffe vorübergehend nicht passierbar ist, weil eine Schleuse in Brunsbüttel gewartet wird und sich die andere nicht vollständig öffnen lässt. In der Nische des Schleusentors hat sich Schlick angesammelt. Angesichts solcher Zustände findet es Klaus Hohenbild „zum Lachen“, dass dauernd von Digitalisierung und selbstfahrenden Binnenschiffen als Zukunftsvision die Rede ist.

Ruhrmündung Duisburg Luftaufnahme 2014.jpg

Doch lustig finden die Hohenbilds die Lage der Binnenschifffahrt nicht. Es hapert überall. Und seit Frühjahr nehmen die Frachtanfragen auch wieder ab, die Preise geraten unter Druck. „Die Kohle ist seit Langem auf dem absteigenden Ast, auch Sand und Kies sind rückläufig“, benennt Hohenbild ganz nüchtern die Probleme seiner Branche. Aufgeben aber ist für die Familie Hohenbild keine Option – und auch der 29-jährige Christoph geht fest davon aus, dass er sein gesamtes Berufsleben auf Flüssen und Kanälen verbringen wird. Seit mindestens 1850 gehört die Schifffahrt zur Familientradition der Hohenbilds.

Hört man den Männern zu, könnte man den Eindruck bekommen, dass die Krise der Binnenschifffahrt vor allem ein Ergebnis mangelnder Finanzierung von Schleusen und Technik ist. Die Bundesregierung will das mit einer Verdopplung ihrer Investitionen ändern. Aber die Probleme liegen gerade für das Familienunternehmen Hohenbild tiefer, oder besser: flacher. Fuhr der Vater von Klaus und Karl Georg noch mit einem 300-Tonnen-Frachter, so kann die „MS Catharina“ sechsmal so viel laden. „Das entspricht 74 Lkw“, rechnet Klaus Hohenbild vor. Damit gehört das Schiff heute eher zu den Kleinen: Fast alle neuen Schiffe sind inzwischen 135 Meter lang und für 3.500 Tonnen Last oder Containertransport vorgesehen – sie schippern fast ausschließlich auf dem tiefen Rhein, wo acht von zehn Transporten auf Flüssen stattfinden.

Quelle          :          TAZ          >>>>>          weiterlesen


Grafikquellen        :

Oben        —         Einfahrt zum Sophienhafen, Gebäude des Wasserstraßen- und Schifffahrtsamtes Magdeburg, Halle (Saale)


Unten           —       Aerial shot of mouth of the Ruhr (River) River at Duisburg-Ruhrort into the Rhine

Abgelegt unter Nordrhein-Westfalen, Sachsen-Anhalt, Überregional, Wirtschaftpolitik | Keine Kommentare »

Rebellisch und sozialistisch

Erstellt von DL-Redaktion am 28. November 2019

Meine Vision der LINKEN 2020


Quelle      :    AKL

von Lucy Redler, Berlin

Lucy Redler ist aktiv im Kampf für mehr Personal im Krankenhaus und für die Enteignung von Deutsche Wohnen & Co, Mitglied des Parteivorstands, Bundessprecherin der AKL, aktiv im Bezirksverband DIE LINKE Neukölln und in der SAV.

Wer Visionen hat, sollte zum Arzt gehen, meinte Helmut Schmidt. Churchill wird das Zitat zugeschrieben, demzufolge jemand, der mit vierzig noch Sozialist*in sei, keinen Verstand habe. 2019 bin ich vierzig geworden, erfreue mich geistiger Gesundheit als Sozialistin und sehe darin einen guten Anlass, meine Vorstellungen im Rahmen der bundesweiten Strategiedebatte zu formulieren. Was kann DIE LINKE 2020 tun? Ein paar – unvollständige – Gedanken und Anregungen zur gemeinsamen Revolutionierung der Partei.


DIE LINKE startet mit einem gemeinsamen Neujahrsauftakt von Partei und Fraktion, bei dem Aktivist*innen von Aufständen aus Chile, Iran, Irak, Hongkong und Bolivien zu Wort kommen und mit ihnen eine internationale Strategie gegen Kapital und Repression diskutiert wird. Das eingesparte Geld für den Extra-Jahresauftakt der Fraktion wird den Bewegungen in diesen Ländern gespendet.
DIE LINKE beteiligt sich am Treffen der Initiative zur Vernetzung einer kämpferischen Gewerkschaftslinken am 25./26. Januar in Frankfurt/Main.


Die Landesverbände organisieren Ratschläge zum Mietendeckel und zur Enteignung von Vonovia und Co. DIE LINKE Hamburg und Bayern integrieren dies in bewegungsorientierte Wahlkämpfe. DIE LINKE Berlin startet eine große Aufklärungskampagne zum Mietendeckel und den Lügen der Immobilienkonzerne.
Beim politischen Aschermittwoch der LINKEN in Bayern steht die Maut-Korruption von Verkehrsminister Scheuer (CSU) im Zentrum. Die Redner*innen fordern Scheuers sofortigen Rücktritt und seine persönliche Haftung. Sie präsentieren die Eckpunkte einer grün-sozialistischen Verkehrspolitik und verbinden dies mit einer Kundgebung vor der CSU-Zentrale.
DIE LINKE bringt zur Strategiekonferenz 29.2./1.3. 400 Mitglieder der Basis zusammen und diskutiert über die politische, ökonomische und ökologische Krise, innerimperialistische Spannungen, neue Kriege, den Zulauf für die AfD, mögliche Angriffe im Rahmen einer nächsten Krise und die daraus abgeleiteten Aufgaben der LINKEN. Sie lädt Aktive aus Kliniken, Mieteninis, Klimabewegung,  antirassistischen Bündnissen, Frauen*kampftag und Gewerkschaften ein. Aus diesen Diskussionen leitet sie ab, welche Aufgaben der LINKEN, ihren Abgeordneten und dem Apparat zukommen. Sie bespricht, wie sie diese Kampagnen nutzt, um sozialistisches Bewusstsein in der Gesellschaft zu verankern. Konkretes Ergebnis der Konferenz ist, dass jeder Kreisverband die Kampagnen zu Wohnen und Pflege vor Ort umsetzt.
Ein weiteres zentrales Thema ist die Stärkung der innerparteiliche Demokratie und die Herstellung des Primats der Partei gegenüber der Fraktion.


DIE LINKE beteiligt sich an der Mobilisierung zum Frauen*streiktag. Sie erklärt, warum der Kampf für Frauen*rechte auch im Interesse von Männern aus der Arbeiter*innenklasse und warum der Antisexismus der LINKEN antikapitalistisch ist. DIE LINKE ist mit eigenen Lautsprecherwagen vor Ort und lässt Frauen aus Rojava, Betrieben, Gewerkschaften und sozialen Bewegungen zu Wort kommen.
Die Zeichen in der Autoindustrie und bei den Zulieferern stehen auf Stellenabbau und Werksschließung. DIE LINKE nimmt die Tarifrunde der Kolleg*innen in der Metall- und Elektroindustrie zum Anlass, um die Forderungen und Aktionen der Kolleg*innen zu unterstützen und offensiv die Konversion und Vergesellschaftung der Autoindustrie bei Erhalt aller Arbeitsplätze und geltenden Tarife zu fordern.


Bei der bundesweiten Kreisvorsitzenden- und Aktionskonferenz werden die Erfahrungen der Ratschläge zur Mietenpolitik in eine bundesweite Strategie gegossen. Unter Beteiligung von Beschäftigten in Krankenhaus und Altenheimen wird diskutiert, an welchem Punkt die ver.di-Entlastungskampagne steht, welche Erfahrungen mit den Deep Organizing- und Whole-Worker-Ansätzen gemacht wurden, welche politischen Vorschläge DIE LINKE unterbreitet und wie eine starke gewerkschaftliche Linke aufgebaut werden kann. Ein bundesweiter Pflegeratschlag wird für Oktober vorbereitet.
Die neuen Fraktionsvorsitzenden besuchen die politischen Gefangenen in Katalonien und der Türkei und beteiligen sich an mehrtägigen Kundgebungen vor den Gefängnissen und dem Flüchtlingslager Moria auf der griechischen Insel Lesbos.


DIE LINKE nutzt den Maifeiertag, um in einer Pressemitteilung anzukündigen, dass der Parteivorstand dem Parteitag vorschlägt, alle Abgeordnetengehälter auf ein Gehalt der mittleren Entgeltstufe im öffentlichen Dienst bzw. von Automobil-Facharbeiter*innen zu begrenzen. Dieser Vorschlag dominiert die politischen Debatten unter Kolleg*innen bei den DGB-Demos.
DIE LINKE beteiligt sich im Rahmen der Pflegekampagne mit Aktionen am Tag der Inklusion am 5. Mai und/oder dem Tag der Pflege am 12. Mai.
Die Bundestagsfraktion führt am 23. Mai, dem Tag des Grundgesetzes, eine Veranstaltung zu Artikel 15 durch und stellt die Vorschläge der LINKEN zur Enteignung von Vonovia und Co vor.


DIE LINKE mobilisiert an der Seite der Bündnisse für mehr Personal im Krankenhaus zu den Protesten gegen die Gesundheitsministerkonferenz und Spahns Politik in Berlin.
Der Bundesparteitag beschließt Eckpunkte für die Arbeit der Bundestagsfraktion: Alle Mandatsträger*innen erhalten neben der Erstattung ihrer sich aus dem Mandat ergebenden Extra-Ausgaben als Gehalt „nur noch“ einen durchschnittlichen Facharbeiter*innenlohn. Die darüber hinausgehenden Beträge werden an soziale Bewegungen, internationale Bündnispartner*innen und den Parteiaufbau gespendet.
Dazu folgt eine Plakatkampagne unter dem Motto: „DIE LINKE: Die einzige nicht käufliche Partei. Unsere Abgeordneten verdienen nicht mehr als ein durchschnittliches Arbeitnehmer*innen-Gehalt.” In Umfragen gewinnt DIE LINKE drei Prozentpunkte dazu.
Die neu gewählten Parteivorsitzenden kündigen an, 2021 nicht für den Bundestag zu kandidieren und schließen sich der Forderung von Trennung von Amt und Mandat für den neuen Parteivorstand an.
Der Parteitag diskutiert unter Ausschluss der Medien eine Bilanz der Arbeit der rot-rot-grünen Landesregierungen und beschließt Eckpunkte, zu denen die Arbeit zugespitzt fortgesetzt oder perspektivisch beendet werden soll. Dies wird durch Landesparteitage in den betreffenden Ländern konkretisiert. Die Eckpunkte sind u.a.: Die Weigerung, die Schuldenbremse umzusetzen, Ablehnung jeglicher Privatisierungen und Kürzungen, Rekommunalisierung privatisierter Betriebe der öffentlichen Daseinsvorsorge, Stopp aller Abschiebungen, Gesetze zur bedarfsgerechten landesweiten Personalbemessung im Krankenhaus, Gesetze zu Mietendeckel, Mietsenkung und Enteignung der Immobilienkonzerne, Einführung der 35-Stunden-Woche im Öffentlichen Dienst bei vollem Lohn und Personalausgleich, Einführung des Nulltarifs im ÖPNV, Auflösung der Landesämter für Verfassungsschutz.
Der Parteitag diskutiert über Programm und Strategie der Partei zum sozial-ökologischen Umbau der Wirtschaft, der Vergesellschaftung und Konversion der Autoindustrie und beschließt ein Tempolimit von 30/80/120, ein Konzept für den Nulltarif im Nahverkehr, eine Kampagne zur Enteignung der Klimakiller und entwirft eine Vision einer sozialistischen, ökologischen Demokratie. Der Parteitag erteilt dem Konzept einer CO2-Steuer eine Absage und richtet eine Arbeitsgruppe aus Kolleg*innen aus der Autoindustrie, linken Gewerkschafter*innen der IGM, Naturwissenschaftler*innen und Umweltverbänden ein, um über Alternativen zu Verbrennungsmotor und E-Auto zu diskutieren.
Die Beschlüsse bestimmen tagelang die öffentliche Debatte und Talkshows. Claus Wagner und Max Uthoff rufen öffentlich dazu auf, in DIE LINKE einzutreten


Im Juli startet die Tarifrunde TV-N (Nahverkehr). DIE LINKE unterstützt die Forderungen der Kolleg*innen und bringt die Forderung nach Nulltarif im ÖPNV prominent in die Debatte ein. Die Fraktionen bringen Anträge in ihren Landesparlamenten ein mit dem Ziel, Kommunen die Erhebung einer Nahverkehrsabgabe von Unternehmen zu ermöglichen. Die Partei beteiligt sich an lokalen Bündnissen für den Nulltarif und ruft die Mitglieder auf, sich an gemeinsamen Schwarzfahr-Aktionen zu beteiligen (massenhaft in Wellen, vernetzt über Social Media). Für den Fernverkehr schlägt DIE LINKE vor: Die BahnCard 100 soll es nicht nur für Bundestagsabgeordnete, sondern kostengünstig für alle geben. Statt den Kauf eines E-Autos durch Bund und Hersteller mit 4000 Euro zu subventionieren, wird dieses Geld für eine kostengünstige BahnCard 100 bereitgestellt.


Eine Senatorin der LINKEN geht für einen Monat ins Gefängnis, weil sie einen Abschiebeflug blockiert hat.


Zum Start der Tarifrunde Bund und Kommunen ist jeder Kreisverband aktiv beim Warnstreik dabei. Die BAG Betrieb und Gewerkschaft gibt eine Zeitung für Kolleg*innen von Kolleg*innen im Streik heraus. DIE LINKE NRW verbindet ihren Kommunalwahlkampf mit der Auseinandersetzung.

Zum 20. Jahrestag des ersten Mordes des NSU an Enver Simsek unterstützt DIE LINKE antirassistische Initiativen, Organisationen von Migrant*innen und Gewerkschaften dabei, einen öffentlichen und demokratischen Untersuchungsausschuss einzurichten, um die bis dato nicht erfolgte Aufklärung zu erzwingen. Als erste Zeugen werden der ehemalige hessische Innenminister Bouffier, alle Spitzenbeamten des hessischen Verfassungsschutzes und Andreas Temme vorgeladen. Die Verhandlungen werden live gestreamt.


Fraktion und Partei führen einen bundesweiten Ratschlag mit dreihundert Kolleg*innen aus Krankenhäusern, Altenheimen und häuslicher Assistenzpflege zur Pflegekampagne durch. Die Ergebnisse des Ratschlags werden in allen Landes- und Kreisverbänden in Bezug auf ihre konkrete Umsetzung diskutiert.


Der Bundesausschuss beschließt Kriterien zur Aufstellung der Landeslisten zur Bundestagswahl. Neben der Frauenquote wird als Vorschlag an die Vertreter*innenversammlung 2021 eine Lohnabhängigen-Quote beschlossen, um in der  Fraktion die eigene Klasse stärker abzubilden.


DIE LINKE verteilt Wiederaneignungs-Adventskalender: Hinter jedem Türchen wird ein konkretes Projekt der Wiederaneignung von Zeit, Würde, Rechten und Eigentum der Arbeiter*innen und ihrer Familien präsentiert.
Zusammen mit unabhängigen linken Medienschaffenden startet DIE LINKE einen Youtube-Nachrichten-Kanal, der zunächst wöchentlich und später täglich über soziale Kämpfe im In- und Ausland berichtet.

Feedback erwünscht: Ihr seid der Meinung, dass sei alles zu viel auf einmal? Es geht in meinem Vorschlag weniger darum, all dies genau so umzusetzen, sondern um eine Vision, was die Partei mit einer anderen Strategie erreichen könnte. Wie sähe die Arbeit einer Partei aus, für die der Kampf für eine sozialistische Gesellschaft ein in täglichen Kämpfen verankertes Ziel ist und nicht nur ein papiernes Bekenntnis?
Anregungen, Ideen und Kritik an:

akl - Antikapitalistische Linke


Grafikquelle          :        Lucy Redler, * 17. awgusta 1979, Hann. Münden

CC BY-SA 2.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms

  • File:Redler.jpg
  • Created: ‎24‎ ‎March‎ ‎2007

Abgelegt unter Berlin, P. DIE LINKE, Sozialpolitik, Überregional | Keine Kommentare »

Stadtgespräch aus München

Erstellt von DL-Redaktion am 28. November 2019

Mir san Sommer –
Änderung des Ferienbeginns in Bayern

Fitxer:Starnberger See mit Steg und Alpenblick.jpg

Von Ambros Waibel

Früher in die Ferien? Markus Söder will die Ferienzeiten bewahren. Das ist identitätspolitisch clever, preußisches Rumgenöle wirkt da eher kontraproduktiv.

„Das bayerische Abitur bleibt bayerisch“, hat Bayerns Ministerpräsident Söder den Ausstieg Bayerns und Baden-Württembergs aus dem geplanten nationalen Bildungsrat kommentiert – „übrigens genauso, wie die Ferienzeiten bleiben, wir wollen auch die nicht angleichen.“

Das sind gleich zwei inhaltliche Nullaussagen. Denn dass ein bayerisches Abitur einen im Leben irgendwie weiter brächte als ein beliebiges anderes, ist genauso Unsinn – ich kann hier mitreden – wie das trotzige Bestehen auf dem späten Sommerferientermin in Zeiten des Klimawandels; der ja insbesondere den Juli auch in Nürnberg oder in München zu einem Monat macht, in dem sinnvoller Unterricht in den zumeist nicht klimatisierten Lehranstalten kaum mehr möglich ist.

Politisch, also identitätspolitisch hingegen sind beide Aussagen wirkmächtig. Ich brauchte mindestens zehn Jahre, um mich daran zu gewöhnen, dass die Sommerferien in nördlichen Gefilden nicht mehr oder weniger am 1. August beginnen und am 15. September enden. Es erschien mir grausam, ein Kind, wie in diesem Jahr in Berlin, am 5. August nicht in die Sonne, sondern in die Schule zu schicken.

Logisch lässt sich das nicht begründen. Dem Kind ist es auch wurscht. Pfingstferien, die als Argument für den späten süddeutschen Sommerferienbeginn inzwischen vorgeschoben werden, sind etwas sehr Schönes – insbesondere weil da oft noch Vorsaisonpreise gelten und keine Preußen am Gardasee rumhängen. Aber auch sie taugen letztlich nicht zur Rechtfertigung der bajuwarischen Reservat­rechte. Und wer im Sommer und damit eben auch im September schlicht kein Geld übrig hat, um in den Süden zu fahren, der kann in Bayern die letzten beiden Ferienwochen oft genug damit verbringen, in einen zähen Landregen zu schauen.

Das ganze folkloristische Repertoire

Nehmen wir mal eine andere Perspektive ein. In seinem leider nicht auf Deutsch vorliegenden Reisebuch „La leggenda dei monti naviganti“ (etwa „Die Legende der reisenden Berge“, 2007) erkundet der italienische Journalist Paolo Rumiz die Alpen und macht dabei auch einen Abstecher nach München.

Veitshöchheim Haus der Fastnacht 06.jpg

Seine Gesprächspartner klären ihn darüber auf, dass die CSU in Bayern für immer regieren werde, weil letztlich niemand ein anderes Bayern wolle, auch die CSU-Gegner nicht. Die Gleichsetzung von Staat, Partei und Heimat überlebt jeden CSU-Skandal und konnte bislang nur von der CSU selbst beziehungsweise von noch rechteren Gruppierungen – mit noch mehr „Mir san mir“ – herausgefordert werden: wie aktuell von den „Freien Wählern“.

Quelle             :         TAZ       >>>>>         weiterlesen


Grafikquellen        :

Oben          —            Starnberger See: Steg mit Ausflüglern und Alpenblick von Starnberg aus

Font Treball propi
Autor MAx59

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.


Unten         —         Veitshöchheim, Haus der Fränkischen Fastnacht, Fassadenmalerei (2015) mit Motiven aus der Fernsehsendung „Fastnacht in Franken“: Links im Gefängnis Markus Söder, der sich 2014 für die Fernsehsitzung als Shrek verkleidet hatte.

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 Deutschland“ lizenziert.

Abgelegt unter Bayern, Kommunalpolitik, P.CDU / CSU, Überregional | Keine Kommentare »

Die letzten Mieter

Erstellt von DL-Redaktion am 27. November 2019

Verkaufen, sanieren, Miete erhöhen:

Protest banner at the Karl-Marx-Allee during Mietenwahnsinn demonstration 06-04-2019 10.jpg

Eine Reportage von , München

In der Münchner Isarvorstadt wehren sich Bewohner eines Hauses gegen Gentrifizierung. Eine Künstlerin gibt auf, ein Läufer bleibt.

Der Weg zu Hausnummer 80 riecht nach toten Ratten. Nach Verwesung, nach den Abfällen des Schlachthofs, der die Straße runter liegt und seit Sommer Probleme mit der Abwasseranlage hat. Vielleicht passt dieser Geruch ganz gut zu dem vierstöckigen Altbau mit der Nummer 80 an der Thalkirchner Straße in München, der seit mehr als zwei Jahren stirbt.

Maria Ploskow läuft durch die Einfahrt vorbei am Vorderhaus, einem rostroten Altbau mit Fassadenstuck, und auf das unauffälligere Hinterhaus zu. 30 Jahre lang war das hier ihr Zuhause. Der Weg in den dritten Stock, wo ihre Wohnung und zwei Türen weiter ihr Atelier waren, ist gepflastert mit den Zeichen der Entmietung, wie es die Bewohner nennen. Auf den alten massiven Holzstufen liegen Pressspanplatten, an der Wand lehnen große Rollen Abdeckvlies.

Und es gibt Zeichen des Widerstands. Vom Geländer baumelt ein knallgelbes Banner mit der Aufschrift „ausspekuliert“, am schwarzen Brett hängen Zeitungsartikel und Flyer von Mieterdemos, eine Trophäensammlung der Gentrifizierungsgegner, die hier noch leben. Mit Blick auf die verschlossene grüne Tür ihrer alten Wohnung sagt Ploskow: „Das hat auf die Psyche gedrückt, hier zu leben.“

Die Wohnung war ihre erste. 30 Jahre lebte sie hier allein auf 40 Quadratmetern. Kinder hat sie keine, ihr Freund wohnt in der Nähe. Sie brauche ihre Freiheit, sagt Ploskow. Ihre Miene ist entschlossen, ihre Stimme fest. Umgekrempelte Jeans, Sneaker, goldene Kreolen.

Die Nummer 80 wurde verkauft. Fast drei Jahre ist das her. Die neuen Besitzer gaben bekannt, dass saniert und die Mieten erhöht werden würden. Und sie kündigten Ploskow den Pachtvertrag für ihr Atelier, genauso wie den Mietern der anderen vier Ateliers im Haus. Pächtern von Gewerbeflächen kann man leichter und ohne besonderen Grund kündigen als Mietern von Wohnungen. Die Kündigungen waren das erste Zeichen der Veränderung im Haus – und der Kampf dagegen begann.

Nirgends ist Mieten so teuer wie in München

In den vergangenen Jahren sind die Mieter der Thalkirchner Straße 80 zu den lautesten Gegnern der steigenden Mietpreise in München geworden. Im September 2018 ging von diesem Haus die größte Mieterdemonstration aus, die es in München je gegeben hat. 10.000 Menschen gingen auf die Straße. Nirgends in Deutschland ist Mieten so teuer wie in München, in manchen Vierteln zahlt man inzwischen 25 Euro kalt pro Quadratmeter – im Durchschnitt. Lange hatte die Bevölkerung die steigenden Preise geduldet, aber mittlerweile ist der Unmut groß in der Stadt.

Auch Ploskow ging anfangs in den Widerstand. Gemeinsam mit den anderen Bewohnerinnen und Bewohnern organisierte sie den Protest gegen die Luxussanierung in ihrem eigenen Haus. Sie wehrte sich. Sie demonstrierte. Aber dann kapitulierte sie doch.

Nach der Kündigung gab sie zunächst das Atelier auf, vergangenes Jahr auch die Mietwohnung. „Ich liebe das Haus und mein Viertel“, sagt sie, aber die Unsicherheit sei ihr zu groß geworden. Was, wenn die Eigentümer das Haus fertig sanieren und die Mieten, wie angekündigt, wirklich mehr als verdoppeln würden? Als freiberufliche Künstlerin und Grafikdesignerin ist schon ihr Einkommen Monat für Monat unsicher genug. Dazu noch eine unvorhersehbare Miete, das kann sie sich nicht leisten.

Goetheplatz Muenchen 01.jpg

Der Bezirk Isarvorstadt, in dem die Thalkirchner Straße liegt, hat in den vergangenen Jahren einen Mietenanstieg von über 30 Prozent erlebt. 2012 musste man dort pro Quadratmeter noch weniger als 15 Euro zahlen, 2018 lagen die Mieten im Schnitt schon bei 20 Euro netto. Dabei ist die Gegend alles andere als edel und prachtvoll. Einen Schlachthof gibt es hier und einen Friedhof, eine Krebsklinik, die Arbeitsagentur in einem ziegelroten Zweckbau und das Kafe Marat, das selbstverwaltete Zentrum der linken Szene in München. Am Beginn der Straße aber, ganz im Norden, nah am Stadtzentrum, lässt sich erkennen, warum Wohnen hier so teuer geworden ist: Hier reihen sich Burgerläden an Tapasbars an Phở-Imbisse, hier grenzt die Thalkirchner Straße an das hippe Glockenbachviertel.

Quelle        :         Zeit-online         >>>>>        weiterlesen


Grafikquellen      :

Oben       —             Protestbanner an Häusern in der Karl-Marx-Allee während der Mietenwahnsinn Demonstration am 6. April 2019 in Berlin.


Unten    —      Goetheplatz München

Abgelegt unter Bayern, Opposition, Sozialpolitik, Überregional | Keine Kommentare »

Landtagswahl in Thüringen

Erstellt von DL-Redaktion am 27. November 2019

Fast eitel Sonnenschein

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Aus Erfut Michael Bartsch

So könnte eine Minderheitsregierung klappen: In der ersten Sitzung nimmt der Thüringer Landtag seine Arbeit auf – und hält gegen rechts zusammen.

Warum sollen in Thüringen nicht Regierungsmodelle jenseits klassischer Koalitionsmehrheiten möglich sein? Die konstituierende Sitzung des Landtags vier Wochen nach der Wahl jedenfalls war nicht von Konfrontationen geprägt. Die Linke Birgit Keller wurde im ersten Wahlgang zur neuen Landtagspräsidentin gewählt.

Sie erhielt zehn Stimmen mehr, als von der bisherigen rot-rot-grünen Koalition zu erwarten waren, mit hoher Wahrscheinlichkeit aus der CDU. Gegen die Änderung der Geschäftsordnung, die künftig jeder der sechs Fraktionen einen Vizepräsidenten zubilligt, stimmte nur die AfD.

Seit jeher geht es im Thüringer Landtag freundlicher und verbindlicher zu als beispielsweise in Sachsen. Angesichts der uneindeutigen Mehrheitsverhältnisse mag die Überlegung mitschwingen, dass man womöglich aufeinander angewiesen sein könnte. Alterspräsident Karlheinz Frosch von der AfD eröffnete mit dem hehren Appell, bei Meinungsverschiedenheiten „fair, sachlich und vorwurfsfrei“ miteinander umzugehen. Auch AfD-Landeschef Björn Höcke, der im Moment ohnehin Kreide gefressen hat, redete länger auf Birgit Keller ein.

Die ging über die üblichen Antrittsformeln einer Präsidentin des gesamten Landtages hinaus, als sie an den Herbst 1989 und ihre eigene Rolle als hauptamtliche Funktionärin der FDJ und der SED in der DDR erinnerte. Fast auf den Tag genau vor 30 Jahren war der Aufruf „Für unser Land“ veröffentlicht worden, der auf einen demokratischen Sozialismus zielte. Sie habe sich 1990 dennoch nicht für einen Rückzug ins Private, sondern für das Engagement entschieden, sagte die bisherige Infrastrukturministerin. „Und ich habe mich nie der Verantwortung entzogen, SED-Unrecht klar zu benennen.“

Streit um die Vizepräsident*innen

Den einzigen Dissens trug die AfD als zweitstärkste Fraktion in die Eröffnungssitzung. Der parlamentarische Geschäftsführer Stefan Möller lehnte die Erweiterung des Landtagspräsidiums auf fünf Vizepräsidenten ab. Darauf hatten sich alle anderen Fraktionen verständigt. Das Argument der Chancengleichheit für alle Fraktionen sei nur vorgeschoben, wenn zugleich die Weigerung angekündigt werde, einen AfD-Vizepräsidenten zu wählen.

Quelle           :            TAZ             >>>>>              weiterlesen

Neue Landtagspräsidentin in Thüringen

Gesellschaftliche Brückenbauerin

Birgit Keller by Stepro 01.JPG

Ein Portrait von Michael Bartsch

In Erfurt wurde am Dienstag zum bundesweit ersten Mal eine Linken-Politikerin zur Landtagspräsidentin gewählt. Wer ist Birgit Keller?

In Thüringen übernimmt die Linke einen weiteren Erbhof der CDU. Auf der konstituierenden Sitzung des am 27. Oktober neu gewählten Landtages hat die bisherige Infrastruktur- und Landwirtschaftsministerin Birgit Keller das Amt der Landtagspräsidentin von Birgit Diezel (CDU) übernommen. Das Vorschlagsrecht steht nach der bisherigen Geschäftsordnung des Thüringer Landtags der stärksten Fraktion zu, und das ist seit der Wahl mit deutlichem Vorsprung die Linke. Keller wurde nun am Dienstag mit 52 Ja-Stimmen gewählt. Das sind sechs mehr als nötig gewesen wären.

Die 60-Jährige ist die erste von der Linken gestellte Landtagspräsidentin in Deutschland. Das passt Politikern wie dem Thüringer FDP-Chef Thomas Kemmerich nicht, der an alten Feindbildern festhält und die Entwicklung der gewendeten PDS seit 1989 ignoriert. Er hatte angekündigt, seine kleine FDP-Fraktion werde sich bei der Wahl der Stimme enthalten.

Denn die gelernte Elektromonteurin Birgit Keller trat bereits 1977 als 18-Jährige der SED bei und stieg über die Jugendorganisation FDJ bis zur Mitarbeiterin der SED-Kreisleitung in Nordhausen auf. Zu allem Überfluss erwarb sie über ein Fernstudium 1988 noch ein Diplom als Gesellschaftswissenschaftlerin.

Quelle         :         TAZ         >>>>>           weiterlesen


Grafikquellen        :

Oben       —          Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37


Unten            —       Birgit Keller

Abgelegt unter L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

CDU und die Frauenquote

Erstellt von DL-Redaktion am 25. November 2019

Dröhnendes Schweigen

2018-12-07 Annegret Kramp-Karrenbauer CDU Pateitag in Hamburg-2568.jpg

Vom schrumpfeb der  Personen in der Verantwortung

Aus Leipzig von Anja Maier

Mit ihrem Antrag für eine Quote wollte die Frauen-Union als Tiger die CDU antreiben. Sie landet als Bettvorleger. Was ist da passiert?

Am Samstagmorgen ist Kristy Augustin spät dran. „Das Taxi kam nicht“, sagt sie und eilt auf ihren schwarzen Highheels Richtung Sitzungssaal in der Leipziger Messe. Dort sitzen die Brandenburger Delegierten. Augustin ist eine unter fünf Frauen und zwölf Männern. Dieses Geschlechterverhältnis umreißt recht anschaulich ein Problem der gesamten CDU, mit dem sich der 32. Bundesparteitag in Leipzig an diesem Wochenende befassen muss: dem Frauenanteil in der Partei und deren Zugang zur Macht.

Kristy Augustin, 40 Jahre und gerade wiedergewählte Landtagsabgeordnete, ist Landesvorsitzende der Frauen-Union, sie will eine Lösung. Der Parteitag aber wird die Frage erneut vertagen. Auch weil die Frauen so nett sein werden und der direkten Debatte ausweichen. Warum? Dazu später. Aber noch ist es Samstagmorgen, noch hat Kristy Augustin, die CDU-Familienpolitikerin aus dem Oderbruch kurz vor Polen, es eilig. Noch sagt sie: „Wir brauchen hier auf dem Parteitag eine deutliche Botschaft. Die Frauen-Union muss hier zeigen, was sie will.“

Was will sie denn, die Frauen-Union mit ihren 150.000 Mitgliedern? Kurz gesagt: endlich neue Regeln, um mehr Frauen an die Schaltstellen der Politik zu bringen und so die gesamte Partei anschlussfähiger, attraktiver für Wählerinnen zu machen, für die Chancengleichheit nicht nur eine Floskel ist. Anderen ist das egal oder sie sind strikt gegen Quoten – überraschenderweise nicht nur die Männer, sondern auch der Parteinachwuchs. Sie finden, die Frauen sollten einfach mitmachen, dann würde sich das Problem schon von selbst erledigen.

Es ist das alte Henne-Ei-Problem: Erfüllt die CDU ihre selbst gesetzte, eigentlich verpflichtende 30-Prozent-Quote nicht, gerade weil oder eben obwohl Frauen fehlen, die bereit sind, mitzutun, Verantwortung zu übernehmen? Die Frauen-Union findet, erst müssten die Strukturen geschaffen werden. Ihre KritikerInnen meinen, die Partei sei offen für jeden und jede. Kristy Augustin sagt es so: „Wir sind eine Volkspartei, also brauchen wir auch eine Repräsentanz von Frauen.“

Radikale Töne für eine konservative Partei

An diesem Samstag soll der Parteitag deshalb über einen mit viel Aufmerksamkeit bedachten Antrag der Frauen-Union im Bereich Struktur- und Satzungsfragen abstimmen. Auf Seite 166 des 363 dicken Buches findet sich Antrag C63: „Mehr Frauen in der CDU, in Ämtern und Mandaten“. Der Ton des Textes klingt für diese immer noch große bürgerliche Partei erstaunlich genervt. Die CDU, steht da, habe frauenpolitisch „ein Umsetzungs- und Durchsetzungsproblem“. Allen sei das bewusst, über verbindliche Zielvorgaben für mehr Frauen in Ämtern und Mandaten werde seit anno 1985 diskutiert. Gefasste Beschlüsse wie das 30-Prozent-Quorum würden nicht umgesetzt, sondern – im Gegenteil – permanent unterlaufen. Fraktionen der CDU in Kommunen, Kreistagen und Ländern zählten regelmäßig zu denen mit dem geringsten Frauenanteil.

So weit die Problembeschreibung. Nun zu den Lösungsvorschlägen. Das Quorum, fordern die Frauen, müsse endlich verbindlich werden. Wahllisten sollen künftig nach dem Reißverschlussprinzip besetzt werden. Dies müsse „mindestens für die Anzahl der Kandidatinnen und Kandidaten gelten“, wie es der Zahl der Abgeordneten entspricht. Das hieße: Parität. Und: Über den parteiinternen Finanzausgleich sollen außerdem Verbände belohnt werden, die das Paritätsprinzip tatsächlich durchsetzen. „Das Ziel ist die Erhöhung des Frauenanteils in der Mitgliedschaft, in allen Funktionen und auf allen Ebenen bis hin zur hälftigen Teilhabe.“ Das klingt nach Revolution, jedenfalls für eine konservative Partei. Doch noch bevor es an die Debatte über den Antrag geht, gilt als ausgemacht, dass der Parteitag nicht darüber abstimmen wird.

„Wir brauchen hier eine deutliche Botschaft. Die Frauen-Union muss hier zeigen, was sie will“

Denn die Antragskommission hat einen Kompromiss gefunden: Der Vorschlag der Frauen wird in eine – noch zu bildende – Struktur- und Satzungskommission verwiesen. Annette Widmann-Mauz, die Vorsitzende der Frauen-Union und Staatsministerin für Integration im Kanzleramt, sagte vor dem Parteitag der taz: „Wir ­geben unsere Ziele nicht auf. Es gibt unterschiedliche Wege, aber es muss klar sein: Beim Parteitag 2020, da wird die CDU sich entscheiden müssen.“

Dahinter steht auch die Einsicht, dass die Frauen in der Union ihrer Spitzenfrau Annegret Kramp-Karrenbauer in schwierigen Zeiten nicht auch noch eine Geschlechterdebatte ans Bein binden wollen. Ein Thema, bei dem es um verbriefte, nicht nur freundlicherweise zugestandene Beteiligung für Frauen geht, kommt in Zeiten der aufgebrachten Jungs nicht gut an. Die Truppen gegen Kramp-Karrenbauer werden für alle sichtbar von Männern angeführt; sie heißen Friedrich Merz, Tilman Kuban, Carsten Linnemann. Eine Fokussierung auf ihr Geschlecht, gar eine gönnerhafte Erzählung kann Annegret Kramp-Karrenbauer in Leipzig gar nicht gebrauchen. Die Abstimmung darüber würden ihre Gegner sie mit Freuden verlieren sehen. Ob sie eine Frau ist, soll dabei keine Rolle spielen.

Die Pointe: Dass sie eine ist, wird gerade von ihren Kritikern gern als Beweis dafür hergenommen, dass bei der CDU alle was werden können. Merkel, Kramp-Karrenbauer, von der Leyen – da sehe man es doch. Wozu also noch Quoten, die hier gern „Verbote“ genannt werden. Gemeint sind damit Verbote für Männer. Man kann das als typische CDU-Haltung verstehen, die Frauenfrage in diese extra zu bildende Strukturkommission zu verweisen. Intern strittige Themen werden nicht gern öffentlich debattiert – in der Hoffnung, dass man auf diese Weise einen Kompromiss finden möge, dem die Mehrheit zustimmen kann. Das Problem: Eine Quote für Frauen kann kein Kompromiss sein. Entweder es gibt sie oder eben nicht. Insofern ist nur zu verständlich, dass die ohnehin nur 26 Prozent der Mitgliedschaft ausmachenden Frauen die Faxen dicke haben und eine Entscheidung erzwingen wollen. Und wenn sie das schon nicht hinkriegen – diesmal nicht –, dann wollen sie wenigstens für Öffentlichkeit sorgen. Und Öffentlichkeit bedeutet bei der CDU: Streit. Unangenehm. Kristy Augustin sagt: „Jetzt wollen wir mal sehen.“

Wiebke Winter belässt es bei „Ich will #MehrMädels“

Extra zur Abstimmung ist Wiebke Winter nach Leipzig gereist. Winter ist 23 Jahre alt und seit diesem Jahr Vorsitzende der Jungen Union in Bremen. Sie ist eine Gegnerin der Frauenquote. Ihre Überzeugung: „Wir brauchen keinen Kampf der Geschlechter, sondern ein Miteinander.“ Winter ist außerdem für eine gewisse Leichtigkeit bei diesem hart umkämpften Thema, das in CDU und CSU gern als zweit- bis drittrangig beiseite gewischt wird. Im Oktober, beim Deutschlandtag der Jungen Union in Saarbrücken, haben Wiebke Winter und andere junge Frauen Sticker verteilt: „Ich will #MehrMädels (in der JU)“. „Das klingt nicht so aggressiv und verbissen, ist aber eine klare Message“, sagt Winter.

Überhaupt findet sie, dass jedeR was werden kann in der Union, egal welchen Geschlechts. Wenn ältere Frauen in der Partei ihr erzählen, auch für sie werde es einen Punkt geben, an dem sie in der Partei als Frau nicht weiterkommt, ist sie leicht genervt. „Meine Generation ist anders. Es ist nicht alles perfekt, aber schon deutlich besser als für die Frauen damals.“

Jetzt steht sie am Rande des Plenums, den Schal hat sie locker um den Blusenkragen geschlungen, am linken Arm trägt sie eine Handtasche. Sie ist bereit zur Auseinandersetzung. Mit anderen Aktiven der Jungen Union hat sie schon besprochen, wer für den Parteinachwuchs ans Rednerpult gehen soll, wenn die Frauen-Union ihre Plädoyers für ihren weitreichenden Antrag hält. Wiebke Winter rechnet mit mehreren Wortwechseln in der Sache.

Quelle       :      TAZ           >>>>>          weiterlesen


Grafikqiellen       :

Oben        —       Annegret Kramp-Karrenbauer: 31 Parteitag der CDU Deutschlands in Hamburg, Messe Hamburg

Annegret Kramp-Karrenbauer: 31 Parteitag der CDU Deutschlands in Hamburg, Messe Hamburg


Unten        —       Diana Kinnert, 2019

Abgelegt unter P.CDU / CSU, Positionen, Sachsen, Überregional | Keine Kommentare »

Der Griff nach Ackerland

Erstellt von DL-Redaktion am 25. November 2019

Kommt die Inflation auf Umwegen?

File:Moorenweis, FFB - Römertshofen südl Ri SO.jpg

Quelle        :      untergrund-blättle CH.

Von Peter Samol

In Deutschland sind die Preise für Ackerland von 2008 bis heute auf das 2,5-fache angestiegen. Zur Zeit kostet ein Hektar (100 mal 100 Meter) im Durchschnitt 25.500 Euro. Spitzenpreise gehen bis zu 65.000 Euro.

Ganz ähnlich sieht es in Österreich aus. Hier liegt die Spitze bei ca. 50.000 Euro. Der Grund für diese Entwicklung liegt darin, dass das Finanzkapital über enorme Geldmengen verfügt und verzweifelt nach Anlagemöglichkeiten sucht. Neben bebautem Land greift es dabei zunehmend auch auf landwirtschaftliche Flächen zu. Dadurch könnten sich mittelfristig die Lebensmittel verteuern.

Der Ursprung dieser Entwicklung liegt in der Finanzkrise, die im Jahr 2008 ihren Anfang nahm und bis heute andauert. Um die damals drohenden Bankenpleiten zu bekämpfen, senkten die Zentralbanken ihre Leitzinsen auf nahezu Null und kaufen ausserdem bis heute regelmässig für viele Milliarden Euro Anleihen auf. Dadurch entstehen laufend neue Geldmengen, für die verzweifelt nach Anlagemöglichkeiten gesucht wird. Weil die Kreditzinsen aufgrund des horrenden Geldüberschusses gegen Null tendieren, wichen die Investoren zunächst auf die Aktienmärkte aus, die einen entsprechenden Boom verzeichnen. Das reicht aber noch lange nicht aus, um all das Geld zu absorbieren.

Befürchtungen, dass der Geldüberschuss zu einer Inflation führen könnte, bestätigten sich bisher allerdings nicht, denn das Geld verbleibt weitgehend in der Sphäre der Finanzmarktgüter. Nur relativ geringe Mengen gelangen in die Sphäre der Gebrauchsgüter, wo sie den Absatz von Waren ermöglichen, die sonst keinen Käufer finden würden. Ohne diesen Mechanismus stünde das herrschende Wirtschaftssystem vor dem gravierenden Problem, seinen enormen Warenüberschuss nicht in ausreichendem Masse absetzen zu können. In diesem Sinne kann man auch von einem finanzmarktgetriebenen Kapitalismus sprechen.

Wie gesagt verbleibt das meiste Geld brav in der wolkigen Sphäre der Finanzmärkte, wo die Investoren – neben Aktien und deren Derivate – vermehrt auf Edelmetalle und Immobilien zugreifen. Letzteres ist allerdings ein Problem. Im Unterschied zu Aktien und Edelmetallen sind Immobilien nämlich zugleich auch Gegenstände des täglichen Gebrauchs. Sie sind gewissermassen Zwittergüter, die sowohl den Güter- wie auch den Anlagemärkten angehören. Daher sind Wohnungen bisher die einzigen lebenswichtigen Gebrauchsgüter, bei denen sich die riesige Menge an Zentralbankgeld in Form merklich steigender Mieten und Kaufpreise bemerkbar macht. Das hat in vielen deutschen Grossstädten zu massenhaften Protesten und ersten politischen Gegenmassnahmen geführt. In Österreich befinden sich zahlreiche Wohnungen in öffentlicher oder genossenschaftlicher Hand, was eine ähnliche Entwicklung hier bisher verhinderte.

Eine durch den Immobilienpreis ausgelöste Verteuerung täglicher Gebrauchsgüter kann sich aber auch noch auf einem anderen Weg ereignen. Durch den zunehmende Griff von Investoren nach Ackerland und die daraus resultierenden Preissteigerungen kann es nämlich mittelfristig zu einer Verteuerung der Nahrungsmittel kommen. Infolgedessen steigen die Reproduktionskosten der Arbeitskräfte und die Löhne müssten entsprechend erhöht werden, was dann alle anderen Waren entsprechend verteuern würde.

Die Alternative wären unveränderte Löhne, wodurch es jedoch zu einem massiven Rückgang der Absatzmöglichkeiten des Industriekapitals käme. Die Menschen würden ihr Geld dann zunehmend für ihre Grundbedürfnisse ausgeben, während sie für andere Warensorten immer weniger übrig hätten. Damit wäre wiederum eine massive Absatzkrise vorprogrammiert. Das würde zwar eher eine Deflation bedeuten, die allerdings in ihren Folgen noch gravierender wäre als eine allgemeine Verteuerung.

Um diese Gefahr abzuwenden, müsste der Staat entschieden in den Bodenmarkt eingreifen. Da Boden keine produzierte Ware, sondern eine Naturressource ist, ist sein Wert nicht in menschlicher Arbeit begründet. Stattdessen wird sein Wert abgeleitet festgelegt. Dabei spielt der Staat vermittelt über die Rechtsform eine entscheidende Rolle. Hinzu kommt, dass es sich bei Böden um ein vollkommen unbewegliches Gut handelt; seine Eigentümer können sich nicht einfach vom Acker machen und mit dem Gang Ausland drohen. Beides verschafft der Politik einen enormen Handlungsspielraum, den sie nutzen sollte.

Zur Zeit halten politische Akteure allerdings noch stur an der aberwitzigen Grundannahme fest, wonach der Markt sich von selbst reguliert. Das ist jedoch gerade im Zusammenhang mit Immobilien und Ackerflächen ein unfassbarer Unsinn. Kurzfristige administrative Beschränkungen, wie etwa eine gesetzliche Deckelung der Bodenpreise, wären relativ problemlos zu bewerkstelligen. Auf lange Sicht wäre es erstrebenswert, Boden in Gemeineigentum zu überführen. Dafür würde sich wohl am ehesten eine Verwaltung durch Genossenschaften anbieten.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikquellen       :        Sanftwelliges Ackerland bei Römertshofen, Moorenweis

Author Flodur63

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

Abgelegt unter Bundestag, Redaktion, Überregional, Wirtschaftpolitik | Keine Kommentare »

Aufgestanden + gegangen?

Erstellt von DL-Redaktion am 25. November 2019

German Angst vor dem Aufstehen

Bunte Westen 03.jpg

Von Arnim H. Krüger,

Jahrgang 1952, arbeitet als Psychoanalytiker in Berlin

Rückblick:  Warum ist das Sammlungsprojekt von Sahra Wagenknecht und anderen gescheitert? Ein Psychoanalytiker und Mitglied der ersten Stunde auf der Suche nach den tieferen Gründen.

Sie sollte eine Bewegung werden, die SPD, Grüne und die Linke außerparlamentarisch unter Druck setzt: die Sammlungsbewegung Aufstehen, initiiert von Sahra Wagenknecht. Deren Amtszeit als Vorsitzende der Linksfraktion endete am Dienstag. Was aber wird aus Aufstehen? Der Berliner Psychoanalytiker Arnim H. Krüger war bei der Gründung dabei – und resümiert für sich, warum er nicht mehr an Aufstehen als Bewegung glauben kann. Es liegt an der Debattenkultur, an der Vereinsstruktur. Es liegt an der Angst vor einer Bewegung.

Ich bin es leid, immer wieder nur lamentierend zu konstatieren, welche „Erfolge“ der neoliberale Elitenkapitalismus wieder gegen uns errungen hat. Mich regt weniger das Erstarken der AfD auf, als mehr die eklatante Schwäche und Spaltung der Linken, die nun schon über 100 Jahre währt. Die Partei Die Linke etabliert sich als parteipolitische Elite. Einmal in der „Regierungsverantwortung“ in einem Bundesland, macht sie jeden Scheiß mit, den der Turbokapitalismus vorgibt (so wurden im Land Brandenburg wegen des ungebremsten Braunkohleabbaus weiter Landschaftszerstörung und Vertreibung der Bewohner betrieben). Die SPD ist seit Gerhard Schröder und der Agenda 2010 zum Vorreiter neoliberaler Ungerechtigkeit geworden. Bei Bündnis 90/Die Grünen kann man die „Restlinken“ mit der Lupe suchen. Die Partei ist in der Bürgerlichkeit angekommen und kann aus dieser bequemen Perspektive heraus nichts weniger fordern als die ökologische (Er-) Rettung der Welt.

Da ertönt aus Berlin der Aufruf zu(m) „Aufstehen“. Sahra Wagenknecht initiiert mit einigen Getreuen und UnterstützerInnen eine linke Sammlungsbewegung. Ich bin dabei. Ich werde Gründungsmitglied von Aufstehen in meinem Landkreis. Vergessen (?) sind meine Ressentiments gegenüber der Partei Die Linke. Hatte mich doch die Vorgängerpartei SED einst 1984 wegen „bürgerlich pazifistischer Grundhaltung“ ausgeschlossen, was damals gleichzeitig mit einem dreijährigen Berufsverbot in der DDR einherging. Auf dieser Gründungsveranstaltung sind nun etwa 60 Prozent der TeilnehmerInnen von der Linkspartei; ein ehemaliges SPD-Mitglied, der gerade aus seiner Partei ausgetreten ist; der Rest parteilos (wie sich später herausstellt, vor allem ehemalige SED-GenossInnen). Der Altersdurchschnitt der Aufstehenden beträgt ca. 60 Jahre (+/- zehn).

Erste Phase: Auf der Suche nach Inhalten

Unsere Treffen sind anfangs gut besucht, oft bis zu 25 TeilnehmerInnen aus unserem Landkreis. Die weltanschauliche Bandbreite reicht von Grundgesetzverteidigern („Man müsste nur das durchsetzen, was im Grundgesetz der BRD verankert ist“), über Friedensaktivisten bis hin zu „Weltrevolutionären“, die sich selbst so vorstellen („Ohne einen grundlegenden Systemwechsel geht gar nichts!“). Selbst ein ehemaliger „hoher Genosse“ des FDJ-Zentralrats der DDR erscheint in unserer Runde. Es wird offen und vehement diskutiert, was „Aufstehen“ verkörpern soll. Die GenossInnen der Linkspartei versuchen, richtungsweisend zu wirken: „Sahra hat gesagt …“, „Sahra hat gemeint …“.

Aber, es gibt nicht wirklich Richtungsvorgaben „von oben“, „Top-down“ funktioniert nicht. Die „Vorgaben“ aus Berlin sind verschwiemelt: „Man müsse in die anderen Parteien aus einer linken Position heraus einwirken“. Aufstehen als „fünfte Kolonne“, die jetzt mal das tut, was SPD, Grüne und Linke verschlafen? Es erscheint ein „Leitfaden“ für Aufstehen-Treffen, darin, man wolle „keine stundenlangen Fachdebatten“. Ich werfe mich natürlich auch in die Diskussion um die Sinnsuche für Aufstehen. Hier ein exemplarischer Dialog: Eine Genossin der Linkspartei: „Wir sind hier, um einen Auftrag zu erfüllen! Wir müssen die Jugend erreichen und politisch mitnehmen!“. Ich: „Ich erfülle von niemandem einen Auftrag. Ich bin hier um mitzuwirken, die Spaltung der Linken zu verstehen und langfristig zu überwinden. Es geht um die Suche nach einer linken Position, die verbindet“. Sie: „Dann bist Du hier wohl fehl am Platz und solltest besser gehen“.

Zweite Phase: Der Aktionismus obsiegt

Die erhofften Vorgaben aus „Berlin“ bleiben aus. Ein ominöser „Trägerverein“ in Berlin sondert undurchsichtige Botschaften ab. Der Handlungsdruck an der „Basis“ nimmt zu. Man entschließt sich zu den hinlänglich bekannten Agitprop-Maßnahmen: Vorbereitung und Organisation eines Standes zum 1. Mai, Teilnahme an einer AfD-Gegendemo und ähnliches.

Ich teile Sahra Wagenknecht im Dezember 2018 meine Bedenken in einem Brief mit. „In der Psychotherapie gibt es den guten Dreischritt Fühlen – Denken – Handeln“, schreibe ich ihr. Wird bereits ein Schritt dieser drei vernachlässigt oder vereinseitigt, gerät unser seelischer Apparat in die Schieflage: „Die dann entstehenden Pole sind wohlbekannt: „Gefühlsduselei“ auf der einen Seite, „Aktionismus“ auf der anderen Seite und die „Oberschlauies“ (Denken) können dann weder das eine noch das andere verhindern.“ Ich teile ihr meine Befürchtung mit, dass zur Zeit der Aktionismus befeuert werde. Dass das Nachdenken deklassiert werde durch das Abraten von „stundenlangen Fachdebatten“. Sie antwortete mir, allerdings nur sehr allgemein: mit Gedanken zum Verhältnis von Demokratie und Pflege (-notstand).

Dritte Phase: Ein bisschen „Graswurzelbewegung“

Quelle      :        Der Freitag           >>>>>         weiterlesen


Grafikquellen          :

Oben       —         „Bunte Westen“ protest in Hanover, 16th february 2019

 Unten      —            Rechte Tasche – linke Tasche – übrig blieb die leere Flasche /  Screenshot  YOUTUBE

Abgelegt unter Allgemein, APO, Kultur, Opposition, Überregional | 2 Kommentare »

Möllner Rede im Exil

Erstellt von DL-Redaktion am 19. November 2019

Idil Baydar: Rede trotz Drohungen

Jilet 1.jpg

Von Doris Akrap

Die Comedian, bekannt als Jilet Ayse, hat Angst, Wut – und Kraft. Damit will sie des Heldenmuts der Überlebenden von Mölln gedenken.

Am 23. November 1992 ermordeten Neonazis drei Menschen durch einen Brandanschlag auf das Haus der Familie Arslan in Mölln. 27 Jahre später erhält die Comedian Idil Baydar folgende SMS-Nachricht: „Wenn du am 17.11.2019 die Möllner Rede im Exil hältst, knalle ich dich ab.“ Unterzeichnet ist die Nachricht mit „SS Obersturmbannführer“.

Es sei bereits die achte Morddrohung in diesem Jahr gewesen, sagt Baydar, die sich nicht davon abbringen ließ, ihre Rede zu halten. Allerdings unter Polizeischutz. „Ich habe Angst, ich habe Wut, aber am allermeisten habe ich Kraft“, sagte sie.

Und dass sie nicht der „feigen Morde“ von Mölln gedenke, sondern des Heldentums von Bahide Arslan, die ihren Enkel in nasse Tücher gewickelt und vor dem Feuer gerettet hatte.

Die Möllner Rede wird jährlich vom Freundeskreis und den Familienangehörigen der Opfer des rassistischen Mordanschlags organisiert. Weil die Stadt Mölln die Angehörigen nicht mehr in die Planung einbezogen, Angehörige nicht mehr eingeladen hatte, organisieren diese seit 2013 die „Möllner Rede im Exil“, an anderen Orten. In diesem Jahr war es Frankfurt.

Scharf wie eine Rasierklinge

Idil Baydar wurde mit ihrer Figur „Jilet Ayse“ bekannt. Sie ist eine junge Göre mit Goldklunker und Trainingsanzug, türkisch-deutscher Geschichte und derb-poetischem Zungenschlag. Daneben hat Baydar aber auch die Figur „Gerda Grischke“ erfunden, eine etwas ältere Göre mit Dauerwelle und Kittelschürze, deutsch-deutscher Geschichte und derb-poetischem Zungenschlag.


Baydars Bühnenshows heißen zum Beispiel „Deutschland, wir müssen reden“ und in der Regel geht es um Rassismus in den diversen Milieus dieser Republik. In einem Interview mit der taz 2015 erzählte Baydar, dass sie ihre Jilet-Figur eigentlich „Massaker-Fatma“ nennen wollte. Aber ihre Mutter hatte einen besseren Einfall: Jilet Ayse, weil die Zunge ihrer Tochter so scharf wie eine Rasierklinge sei.

Quelle       :           TAZ            >>>>>           weiterlesen


Grafikquellen       :

Oben          —         Jilet Ayşe bei einem Auftritt im August 2016


Unten            —     Demonstration NichtMitUns (Not with us) – Muslims and Friends against violence on June, 17th, 2017 in Cologne

Abgelegt unter APO, Feuilleton, Kultur, Überregional | Keine Kommentare »

Abbruch oder Aufbruch

Erstellt von DL-Redaktion am 19. November 2019

Zwischen Abbruch und Aufbruch

DIE LINKE Bundesparteitag 10-11 Mai 2014 -118.jpg

Quelle       :        Scharf  —  Links

Von René Lindenau

An einem trüben Novemberwochenende (15.-17.11 2019) traf sich die sächsische LINKE in Dresden zu ihrer 2. Tagung des 15. Parteitages. Neben Trauerarbeit nach den aus Sicht der Partei dramatisch verlustreichen Landtagswahlen,vom 1. September, war ein neuer Landesvorstand, im Besonderen, ein neuer Vorsitz zu wählen. Bei allem stand Fehlerdiskussion, Ursachenforschung für die Wahlniederlagen des Jahres 2019 (Europa, Kommunal, Land) auf dem Programm, ohne jedoch auch den Blick nach vorn nicht zu vergessen.

Als „Ausländer“, der eigentlich im brandenburgischen Landesverband organisiert und angesichts eines nicht besseren Wahlergebnisses, immerhin verlor Rot-Rot die Regierungsmehrheit, genug eigene Sorgen hätte, zog es es mich wenigstens für einen Tag in die sächsische Hauptstadt. Aber was soll man machen: Wenn man sich persönlich mit einigen sächsischen Genossen verbunden fühlt und damit auch diesem Landesverband als Ganzes. Ohne Zweifel, trotz allem bleibt die sächsische LINKE ein ganz wichtiger Teil der Bundespartei. Auch wenn sie der Wähler jetzt geschrumpft hat, die Bedeutung der sächsischen LINKEN ist geblieben, ihre Verantwortung ist eher gestiegen. Jetzt erst Recht! Sachsen´s LINKE muss der Leuchtturm in Dunkel-Sachsen sein!

„Leuchtturm Wärter“ haben die Delegierten an diesem Wochenende gewählt.Wie gut und effizient ihre Strahlkraft in Partei und Gesellschaft sind, wir werden sehen; Stefan Hartmann und Susanne Scharper. Geben wir ihnen und der neuen genossenschaftlichen Führung eine Chance! Aber hatten die, die Genossen Feiks und Dudzak als (im doppelten Sinne?) abgetretene Landesvorsitzende und nicht wiedergewählte Landesgeschäftsführer? Will sagen, mir tut es persönlich um beide Genossen leid. Nichts (!) gegen ihre Nachfolger, im Gegenteil, ihnen sei im Interesse der Partei aller nur denkbarer Erfolg gewünscht. Mussten Feiks und Dudzak als Sündenböcke für die Wählereinbußen herhalten? Sündenböcke sollten jedoch lieber im bezahlten Fußball verortet bleiben, aber nicht in einer linken Partei mit solidarischen Antlitz – zumal ihr Spitzenkandidat Rico Gebhardt als Fraktionsvorsitzender weiter machen kann… Fragen auf Fragen.

Fragen zu stellen, Antworten zu suchen, was denn nun zu den Einbrüchen in der linken Wählerschaft führte und wie es weiter gehen soll, dazu hatten die Delegierten schon am ersten Tagungstag bis gegen 22 Uhr Zeit. Aber sie nutzten sie nicht! Über eine Stunde Redezeit; des Austausches, der Suche nach Antworten und neuen Wegen wurde verschenkt. Ich erlebte das jüngst auch auf einem Bundesparteitag. Aber die „Kaffee-Sachsen“ hätte ich für redseliger gehalten – insbesondere im Angesicht zwischen Abbruch und Aufbruch, habe ich da mehr erwartet: Wo sind die Ursachen für die Niederlagen, wie kommen wir da wieder raus? Wie gehen wir mit den Niederlagen um, lernen daraus und organisieren uns neue Erfolge? Alles schon klar? Vielmehr begann und endete die Debattenzeit mit einem Missbrauch. Eröffnet wurde mit NATO Manövern und Bedrohungen Richtung Russland statt diese nicht unwichtigen Gedanken in der üblichen Antragsdebatte einzubringen sowie ein verspätetes Parteilehrjahr, wo uns der Referent mit unbestritten den nach wie vor richtigen und wichtigen marxschen ökonomischen Grundrissen u.a. kam. Der aktuellen Situation in Sachsen und der Tagesordnung des Parteitages wurden diese Beiträge jedenfalls nicht gerecht.

Wenn man mich als brandenburgischen Zaungast nach möglichen Gründen für die krachende landtägliche Wahlniederlage befragt, meine ich, wesentlich Schuld trug das – plakative – Bekenntnis zum demokratischen Sozialismus. Nichts dagegen, deshalb ist man schließlich in dieser Partei. Aber in einem Landtagswahlkampf, auf Wahlplakate? Überfordern wir da nicht viele Bürger, einschließlich des alten und neuen CDU Ministerpräsidenten, Michael Kretschmar , wenn er geradezu reflexartig ablehnend oder einfach nur unwissend, nicht vom real existierenden gescheiterten DDR Sozialismus für den die SED stand, und einem demokratischen Sozialismus, für den ihre Nachfolgepartei, DIE LINKE heute kämpft, zu unterscheiden weiß. Die Idee des Sozialismus, wie auch immer sie in ihrer Geschichte bisher daher kam, ist nach der verheerenden Niederlage der Wendejahre von 1989/91 bis heute diskreditiert. Linke, sozialistische Ideen haben es bis in die Gegenwart schwer, öffentliche Räume zu erobern, geschweige denn Diskurs bestimmend in Prozesse einzugreifen und entsprechende Entwicklungen voranzutreiben. Die Linke als Partei und Bewegung ist halt immer noch in der gesellschaftlichen Defensive. Wo Veränderungen gelingen sind sie nur kleinteilig und gehen manchem nicht weit genug. Wenn Erfolge gelingen, Dinge schon längst von der Partei aufgeschrieben oder umgesetzt wurden und eigene Genossen nichts davon wissen – dann wird es ganz böse.In einem Landtagswahlkampf erwartet der Bürger zuerst Antworten auf landespolitische Fragestellungen. Dann hätte Sachsens LINKE möglicherweise mehr gepunktet. Programmatische Zielvorgaben einer Partei gehören meines Erachtens nicht in so einen Wahlkampf, auch nicht auf Plakate.

In einer Zeit, da die linksseitig ohnehin nie einfache sächsische Großwetterlage noch komplizierter geworden ist, hat der Dresdner Parteitag das Feld neu bestellt. Nun gilt es für den neuen Landesvorstand gemeinsam mit der geschwächten Landtagsfraktion neu zu säen und zu ernten. Sachsen ist ein zu schönes und ein politisch zu wichtiges Land, als dass es den schwarzen und blau – braunen Block allein überlassen werden darf. Dazu bedarf es einer starken LINKEN, die sich nicht nur in Mandatszahlen ausdrückt. Darüber hinausgehende Bündnisse in alle gesellschaftlich relevanten demokratischen Kräfte der Zivilgesellschaft werden in dieser Situation von noch größerer Bedeutung sein. Im Übrigen wäre das doch ein Weg, um verlorenes Terrain zurück zu erobern. Oder?

Cottbus, den 18.11. 2019  René Lindenau

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle       :          Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor      —      Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -118.jpg
  • Created: 2014-05-21 17:36:47

Abgelegt unter P. DIE LINKE, Positionen, Sachsen, Überregional | Keine Kommentare »

Das Spiel mit Mitgliedern

Erstellt von DL-Redaktion am 17. November 2019

Wie „wahr“ sind veröffentlichte Mitgliederzahlen der Partei DIE LINKE. in der Realität?

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Quelle        :    Scharf  —   Links

Von Wolfgang Gerecht

Werden die Öffentlichkeit, die Links-Partei-Wähler und die Mitglieder der Links-Partei durch den 44-köpfigen Bundesvorstand (BuVo) und die Landesvorstände (LaVo) der Partei DIE LINKE durch irreale Mitgliederzahlen getäuscht?

Kann eine Partei, in der ein Landesverband den anderen Landesverband, mittels satzungswidrigen (unrichtigen) Mitgliederzahlen täuscht „demokratisch“ oder gar „solidarisch“ sein?

Ein zentraler Punkt der demokratischen Verfassung einer Partei ist die satzungskonforme Mitgliedschaft eines  j e d e n  Partei-Mitglieds.

Ein wesentlicher Punkt einer satzungskonformen Mitgliedschaft ist die satzungskonforme Zahlung des Mitgliedsbeitrages gemäß Beitrags-Tabelle bzw. die satzungskonforme Beitragsbefreiung eines Mitglieds.

  • Nur satzungskonforme Mitgliedsbeiträge ergeben satzungskonforme Mitgliederzahlen,
  • Nur satzungskonforme Mitgliederzahlen ergeben satzungskonforme Delegierten-Schlüssel.
  • Nur satzungskonforme Delegierten-Schlüssel ergeben eine legale Delegierten-Wahl.
  • Nur eine legale Delegierten-Wahl ergibt eine legale Parteitags-Delegierten-Versammlung
  • Nur eine legale Delegierten-Versammlung ergibt einen legal gewählten Partei-Vorstand.

Das gilt für alle Wahlen einer Partei, so auch für die Partei DIE LINKE.

Egal ob Bundesebene, Landesebene, Kreisebene, Stadt- oder Gemeindeebene.

Egal ob Vorstands-, Kommissions- oder z.B. LAG oder BAG Wahlen u.s.w..

Beispiel Saarland:

Ende 2016 wurden  2.395, für 2017  2.465 und 2018  2.124 Mitglieder ausgewiesen.

Von dort aus berichtet der Landes-Schatzmeister Schmidt gem. ND v. 26.9.19, dass er nach Abschluss der Mahnverfahren mit noch etwa 1800 Mitgliedern rechne.

In 2017 noch 70 Mitglieder dazu, in 2018  dann 341 Mitglieder weniger, dann wird in 2019 gemeldet es sind wahrscheinlich nur noch ca. 1800, also ca. 324 weniger.

Der Saarland-Schatzmeister beklagt zudem, dass die Beiträge viel zu niedrig seien. 30 bis 40 Prozent der Genossen zahlten nur den Menschen ohne Einkommen vorbehaltenen Mindestbetrag von 1,50 Euro monatlich, die meisten von ihnen auch den nicht einmal regelmäßig.

Es ist bei dieser o.g. Sachlage offensichtlich, dass ein Großteil der Genoss Innen im Landesverband Saarland Kenntnis von dieser rechtswidrigen Faktenlage gehabt haben müssen.

Bei der Korrektur der satzungswidrigen und damit rechtswidrigen Mitgliederzahlen aus denen normalerweise auch die Delegierten-Anzahl eines jeden Landesverbandes abgeleitet bzw. errechnet werden, muss um satzungskonform zu werden, folgendes berücksichtigen:

Die Streichung/Löschung der Mitgliedschaft bei den Mitgliedern, die nach dem Mahnverfahren ihre satzungskonform ermittelten Beiträge nicht entrichtet haben.

Die zur Streichung der Mitgliedschaft von LaSchatzMstr geschätzten 300 Mitglieder entsprechen etwa 14% der zum 31.12.2018 von ca. 2.100  (2.124) Mitglieder.

Nach Angaben des Landes-Schatzmeisters im ND zahlen 30 bis 40 Prozent der Genossen nur den Menschen ohne Einkommen vorbehaltenen Mindestbetrag von 1,50 Euro monatlich, die meisten von ihnen auch den nicht einmal regelmäßig. Mindestens 30% der Linken-Mitglieder im Saarland also ca. 630 Mitglieder wären demnach Empfänger von Grundsicherung sei es durch Hartz IV oder durch Sozialhilfe. Das wäre durch Vorlage der Bewilligungs-Bescheide leicht nachzuprüfen. In der Regel wissen die Linken-Mitglieder der Gemeinden- und Stadtverbände ja, wer wirklich satzungskonforme Beiträge zahlt, d.h. ggfs. zu Recht den „Mini-Beitrag“ zahlt oder nicht.

Also diese „Beitrags-Verweigerer“ haben ebenfalls keine Mitgliedsrechte und sind deshalb ebenfalls in das Mahnverfahren einzubeziehen, was bei erfolglosem Abschluss ebenfalls zur Streichung/Löschung der Mitgliedschaft solcher Mitglieder führen muss.

Diese Maßnahme wird zur Reduzierung von 630 Mitgliedern (bei 30%), von 420 Mitgliedern bei (20%) satzungswidrigen Beitragszahlern führen.

Wie heißt es so schön bei der LINKEN permanent: Solidarität, Demokratie u.s.w.

Einige Fragen lauten:

Ist der LV Saarland nur der berühmte Einzelfall?

Wusste der Bundesvorstand, gerade auch die beiden Vorsitzenden Kipping und Riexinger, der Bundesgeschäftsführer Schindler, der Bundes-Schatzmeister Harald Wolfvon alledem überhaupt nichts? Was hat der Bundes-Schatzmeister Wolf und der Bundes-Geschäftsführer Schindler für eine Wiederherstellung einer satzungsgemäßen Mitglieder- und Kassenführung im Landesverband Saarland konkret unternommen? Gibt es weitere Landesverbände mit gravierenden Unregelmäßigkeiten bei der Erhebung eines satzungsgemäßen Beitrags?

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen        :

Oben        —     Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor      —     Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg


Unten     —        Ein bunter Scherbenhaufen von rot  bis braun – ein Scherbenhaufen

Abgelegt unter P. DIE LINKE, Positionen, Saarland, Überregional | 29 Kommentare »

Demokratieförderung Bund

Erstellt von DL-Redaktion am 17. November 2019

Geld allein macht nicht glücklich

Unteilbar Dresden 2019 026.jpg

Von Pia Stendera und Simon Schramm

Wie wir zusamenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Deshalb investiert der Staat viel Geld in Großprogramme zur Demokratieförderung. Was können diese überhaupt leisten?

Demokratie, die Herrschaft des Volkes, bedeutet in Deutschland für die meisten Volljährigen, regelmäßig frei und geheim ihre Re­prä­sen­tan­t*in­nen wählen zu können. Gerade Jüngere halten das für selbstverständlich, sie kennen kein anderes politisches System. Und Demokratie bedeutet, die eigene Meinung frei äußern zu dürfen, auch wenn einige dabei gern weiter gehen würden, als es das Grundgesetz erlaubt. Doch demokratisches Leben ist noch viel mehr als wählen gehen und Meinungsfreiheit.

Wie wir zusammenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Und manchmal braucht es eine Erinnerung, wie sehr wir von unserem politischen System profitieren. Es braucht Überzeugungsarbeit – ob im Betrieb oder in der Kneipe. Um diese Arbeit zu fördern, hat der Staat 2001 beschlossen, Geld zu verteilen. Zusammengefasst hat er das mit dem Begriff Demokratieförderung.

Was heißt das? Konkret geht es um Fördergroßprogramme des Familienministeriums, wobei Geld an Organisationen und Bür­ge­r*in­nen verteilt wird, die sich um die Demokratie kümmern. Unterstützt werden zum Beispiel Bildungsprojekte für Schü­le­r*in­nen, Schulungen für Leh­re­r*in­nen, Projekte zur präventiven Extremismusbekämpfung, aber auch Aus­stei­ge­r*in­nen­pro­gram­me für Ex­tre­mis­t*in­nen.

In den vergangenen 20 Jahren hat die Regierung konstant immer mehr Geld dafür bereitgestellt, Kritik gab es trotzdem. Das Problem: Bisher liefen diese Großprogramme maximal fünf Jahre. Somit waren auch die Förderungen der Projekte immer begrenzt, ihre weitere Existenz stets bedroht. Nun wird mit „Demokratie leben“ zum ersten Mal ein solches Großprogramm verlängert.

Natürlich kann ein Förder-programm nicht alles heilen, was falsch läuft

„Weil Demokratieförderung Planungssicherheit braucht“, begründete Familienministerin Franziska Giffey (SPD) diese Entscheidung. Mit dem Jahr 2020 beginnt dann der zweite Förderzeitraum. Jährlich sollen bis 2024 115,5 Millionen Euro in demokratiefördernde Projekte fließen. Die Entfristung allein schafft aber keine Planungssicherheit.

Unteilbar Dresden 2019 006.jpg

Die Kritik an Großprogrammen zur Demokratieförderung ist so alt wie die Programme selbst. Jedes Mal, wenn diese Programme auslaufen, sagen Ver­tre­te­r*in­nen bisher geförderter Projekte, dass das Geld nicht reicht. Mit „Demokratie leben“ wurden aber allein 2019 115 Millionen Euro verteilt. Das ist mehr als in jedem vergleichbaren Programm in Europa.

Viel Unmut gab es wegen der neuen Verteilung der Fördergelder. Besonders ein offener Brief an das Familienministerium sorgte für Aufsehen. Der Brief wurde von Joseph Blank und Martin Nanzig von der Deutschen Gesellschaft für Demokratiepädagogik initiiert und von 315 Organisationen und Personen unterzeichnet. Wo genau ist das Problem?

Quelle         :     TAZ         >>>>>        weiterlesen


Grafikquellen      :

Oben         —          Unteilbar Dresden 2019

Abgelegt unter APO, Kultur, Sachsen, Überregional | Keine Kommentare »

Die LINKE in Thüringen

Erstellt von DL-Redaktion am 16. November 2019

Für ein sozialistisches Regierungsprogramm der LINKEN in Thüringen

Quelle       :     AKL

Beschluss der AKL Berlin vom 14.11.2019

Angesichts des Wahlergebnisses in Thüringen, aus dem DIE LINKE als stärkste Partei hervorgeht, fordern wir Bodo Ramelow und DIE LINKE-Fraktion in Thüringen auf, keine Koalition oder Tolerierungsabkommen mit der CDU oder anderen im thüringischen Landtag vertretenen Parteien einzugehen. Stattdessen sollte DIE LINKE jetzt das Wahlergebnis zum Anlass nehmen, ein sozialistisches Regierungsprogramm zu verabschieden, dessen Umsetzung einerseits die Lebensbedingungen in Thüringen verbessert und andererseits aufzeigt, dass sich DIE LINKE von allen anderen Parteien unterscheidet. Dieses Programm kann nicht im Bündnis mit bürgerlichen Parteien umgesetzt werden, sondern nur im Bündnis mit der arbeitenden und erwerbslosen Bevölkerung und den Gewerkschaften und sozialen Bewegungen.

Da laut Landesrecht der jetzige Ministerpräsident im Amt bleibt, solange keine neue Regierung gebildet ist, sollte DIE LINKE jetzt die Chance nutzen, als Minderheitsregierung Maßnahmen zur Abstimmung zu stellen wie zum Beispiel: Einführung eines kostenlosen ÖPNV und massiver Ausbau des Schienenverkehrs in Stadt und Land; Beschlagnahmung von spekulativem leerstehendem Wohnraum, Enteignung von Immobilienkonzernen unter demokratischer Kontrolle und Verwaltung, Mietsenkung und Deckelung der Mieten auf Kostenmiete, Bau von kommunalen Wohnungen; Einführung der 35-Stundenwoche bei vollem Lohn- und Personalausgleich im öffentlichen Dienst als Einstieg in weitere Arbeitszeitverkürzung; Rekommunalisierung und massiver Stellenaufbau in Krankenhäusern, Verkehrsbetrieben sowie allen Bereichen der Daseinsvorsorge unter demokratischer Kontrolle und Verwaltung durch demokratisch gewählte Räte von Beschäftigten, Nutzer*innen, Gewerkschaften und Landesvertreter*innen; Unternehmen, die mit Entlassungen oder Kürzungen drohen, in Landeseigentum unter demokratischer Kontrolle und Verwaltung zu überführen; das Nutzen aller Möglichkeiten von Besteuerung der Reichen und Gewinne durch das Land und die Kommunen; massive Investitionen in Infrastruktur und Soziales; Abschaffung aller Gebühren und Kosten im Bildungswesen, Aufsetzen eines Programms zur vollständigen Deckung offener Stellen in den Schulen, Auflösung des Landesamtes für Verfassungsschutz und Einsetzung eines unabhängigen NSU-Untersuchungsausschusses unter Beteiligung von antirassistischen Organisationen, Migrant*innenverbänden und Gewerkschaften.

Für die Durchsetzung und Verteidigung dieser Maßnahmen muss DIE LINKE die arbeitende und erwerbslose Bevölkerung demokratisch einbeziehen. Dazu sollte eine Informationskampagne einschließlich Massenversammlungen durchgeführt werden, die die Basis für Demonstrationen und Streiks in Thüringen und bundesweit sein können. Es darf der LINKEN dabei nicht um Stellvertreter*innenpolitik gehen: Alle diese Maßnahmen aus dem Parlament heraus müssen zu einer Selbstermächtigung derer führen, die vom Kapitalismus ausgestoßen und erniedrigt sind. Die Enteignung der großen Mehrheit der Menschen muss beendet werden – dazu bedarf es der Rückaneignung von dem, was den Menschen unter dem Stichwort „Sachzwänge“ Jahrzehnte lang genommen wurde: Geld, Perspektiven, Würde, Gerechtigkeit. Eine Politik im Sinne dieser Rückaneignung würde auch die Erfolge der AfD unter Arbeiter*innen und Jugendlichen untergraben, welche diese mit rechtspopulistischer Politik, Rassismus und Nationalismus in die Irre führt. Ein solches Programm könnte der LINKEN bundesweit Unterstützung bei denjenigen sichern, die nach einer Alternative Ausschau halten. So wäre garantiert, dass dieser Wahlerfolg keine Eintagsfliege, sondern einen Schritt auf dem Weg der LINKEN zu einer sozialistischen Massenpartei markiert.

akl - Antikapitalistische Linke


Grafikquelle         :            –Blogsport

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | 3 Kommentare »

Alkoholverbot an Bahnhöfen

Erstellt von DL-Redaktion am 15. November 2019

Zweifel an Wirksamkeit eines Alkoholverbots am Bahnhof

Ravensburg Bahnhof 2011.jpg

Von Ben Heisch

In der Diskussion über ein Alkoholverbot am Ravensburger Bahnhof häufen sich Beschwerden der Passanten bei der Stadtverwaltung. Auch die Polizei berichtet immer wieder von Konflikten der Betrunkenen und Drogenkonsumenten. SZ-Mitarbeiter Ben Heisch hat sich am Bahnhof bei Passanten umgehört. Zwar sprechen sich viele Bahnreisende für ein Alkoholverbot am Bahnhof aus, bezweifeln aber, dass ein Verbot durchzusetzen wäre.

Ein älteres Ehepaar, das für eine Zugfahrt an den Ravensburger Bahnhof gekommen ist, findet es in Ordnung, Alkohol am Bahnhof zu trinken – solange die Trinker niemanden stören. Außerdem waren sich die Ehepartner einig, dass die Idee, mutmaßlich alkoholabhängigen Menschen das Trinken in der Öffentlichkeit zu verbieten, nicht umsetzbar wäre.

Junge Frau stört sich abends an Betrunkenen

Quelle     :       schwäbische-Ravensbur           >>>>>         weiterlesen

Zu Obigen Artikel erhielten wir folgende Zuschrift

Kommentar von Stefan Weinert zum Bericht der „Schwäbischen“ :

da muss ich doch erst einmal an die Diskussion um ein mögliches Verbot von alkoholischen Getränken an der „blauen Tanke“ (Südstadt) nach 22 Uhr erinnern … Daraus wurde nichts. Wie hat sich die Situation da eigentlich entwickelt? Bitte liebe SZ, berichte mal. – 

Was den Bahnhof anbetrifft, bin ich wohl immer zur falschen Zeit mit der BOB nach FN gefahren. Habe nie irgendwelche Promille-Sünder gesehen … aber selbst wenn: Ein Verbot verlagert das Problem lediglich, löst es aber nicht. (Alte Stadtindianer-Weisheit) Eine andere Weisheit besagt: Was Akademiker, Stadträte, Großkopferte und Honorige und andere Krawattenhalter hinter verschlossenen Türen und opaken, getönten Scheiben saufen, tun die „Penner“ und „Nichtsnutze“ öffentlich. Und das weiß auch (fast) jeder. Abgesehen natürlich vom „Rutenfest“, wo das „öffentliche Besäufnis für alle“ von oben abgesegnet ist und diese Tradition dem „Narrensamen“ mit der Muttermilch eingeflößt wird. 

Das alles ist eine ziemliche Heuchelei. Ein „Nichtsnutz“ kann sich nun mal ein Kneipenbier (die Halbe für 3,30 €; auch in der „Räuberhöhle“) und einen Schnaps (2 cl = 2,50 €) nicht leisten. Für den Preis (plus Trinkgeld) bekommt er im Supermarkt eine ganze Kiste „Oettinger“ oder 1 Liter Wodka. Und da nun auch mal der „Nichtsnutz“ ein soziales Wesen ist (!!), sucht er sich seine „Kneipe“, wo er nicht alleine ist und alleine trinken muss. Erfährt man alles, wenn man sich mit den „Pennern“ auf  Augenhöhe unterhält.#

Ravensburg Rutenfest 2005 Festzug Burg Ravensburg.jpg

Die verlorene Ehre des  Landraubenden Adel wurde doch lange von  Hochstapelnden Politikern – Innen übernommen !

Bereits vor 15 Jahren schrieb ich in einem Leserbrief zum Thema „Säufer am Grünen Turm“, dass jene, die wir gerne „Penner“ nennen, das Spiegelbild unserer angeblich „heilen“ Gesellschaft sind. Weder Streetworker noch das Verbot helfen wirklich, sondern die Veränderung der Gesellschaft insgesamt ist die beste und auch kostengünstigste Lösung. Dazu gehört an erster Stelle, endlich damit aufzuhören, pharisäerhaft auf die öffentlichen Trinker einzuschlagen. Denn wer mit einem Finger auf den „Sünder zeigt“, zeigt gleichzeitig mit den restlichen Fingern auf sich selbst. Und welche die nächsten Schritte sein sollten/könnten … dürfte jedem klar sein.

Ach ja – als Theologe erlaube ich mir, einen der wichtigsten Sätze aus der Bibel in den Kontext der Moderne und in das Ravensburg im 21. Jahrhundert  zu übertragen: WER VON EUCH OHNE BIER IST, DER WERFE DIE ERSTE FLASCHE. Blasphemie? Mitnichten! Bevor Jesus auf der berühmt gewordenen Hochzeit zu Kana 600 Liter (!) Quellwasser in den besten Wein verwandelte, waren die Hochzeitsgäste bereits „trunken“ (nachzulesen in Johannes Kapitel 2 ab Vers 1 und folgende). Selbst wenn diese Geschichte nur eine symbolische Geschichte a la Bultmann sein sollte – wer wir sie heute wohl wie interpretieren ..?

MfG, Stefan Weinert, Ravensburg


Grafikquellen        :

Oben       —      Ravensburg, Bahnhof (westliche Seite)



Abgelegt unter Baden-Württemberg, Feuilleton, Kultur, Überregional | Keine Kommentare »

Thüringer Regierung

Erstellt von DL-Redaktion am 15. November 2019

Thüringen – Minderheitsregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–09.jpg

Von Tom Strohschneider

Minderheitsregierung, das klingt erst mal doof. Dabei bietet sie viele Chancen.

Vor ein paar Tagen sorgte eine Meldung auf Twitter für Aufsehen: „CDU führte konkrete Gespräche mit der AfD“, so die Schlagzeile. Und das, so las man weiter, obwohl CDU-Fraktionschef Mike Mohring „zuvor jede Kooperation ausgeschlossen hatte“. Passiert da etwas Heimliches, Ungeheuerliches hinter den Kulissen der Erfurter Nachwahlpolitik? Eine Kooperation mit den Rechtsradikalen gegen Rot-Rot-Grün? Einige Politiker und Journalisten verbreiteten die irritierende Kunde weiter. Bis es jemandem auffiel: Die Meldung ist von 2014. Ein Kollege schrieb: „Geschichte wiederholt sich hoffentlich nicht.“

Was hätte sein können

Es gibt das berühmte Diktum von Karl Marx, dass so etwas eben doch passiert, „das eine Mal als Tragödie, das andere Mal als Farce“. Aber was, wenn es nach der Landtagswahl anders gekommen wäre, nur ein kleines bisschen anders, aber mit großen Wirkungen?

Vielleicht so: Es ist der 28. Oktober 2019, Mike Mohring macht sich am frühen Montagmorgen auf den Weg ins Fernsehstudio, eine schwere CDU-Klatsche im Nacken, unklare Mehrheitsverhältnisse, die Frage einer Kooperation mit der Linkspartei liegt wie ein zwei Tonnen schwerer Stein auf dem Tisch, man kann ihn nicht mal eben mit dem Handrücken wegfegen. „Die CDU in Thüringen ist bereit für Verantwortung, wie auch immer die aussehen kann und sollte“, sagt Mohring. „Deswegen muss man bereit sein, nach diesem Wahlergebnis auch Gespräche zu führen. Ohne was auszuschließen.“ Im Übrigen liege die Hoheit für den weiteren Erfurter Weg „alleine in Thüringen“.

Danach fährt Mohring in die CDU-Bundeszentrale, die Gremien tagen, zerknirschte Gesichter ob des Wahlausgangs – aber der Geist von Altmeister Bernhard Vogel ist in allen Köpfen: Man könne sich doch „Gesprächen nicht versagen“, keine Koalition mit der Linkspartei, das ist klar, aber daneben geht ja auch was. Auch die Thüringer Wirtschaft sieht das so: „Neue Situationen erfordern neue Maßnahmen“, heißt es vom Unternehmensverband. In der CDU-Bundeszentrale stimmt man zu, es wird eine Sprachregelung gesucht, Mohring bekommt sein Mandat. Nur eines nicht: irgendwelche Offenheit zur AfD zeigen. Und Mohring weiß auch: Selbst wenn er so denken würde, sollte er in dieser Runde nie und nimmer Sätze sagen wie: „Ramelow ist inhaltlich leer. Und wir werden als Union alles mit ihm machen können.“

Denn natürlich haben auch die Gegner der „neuen Maßnahmen“ Ohren, SMS-fähige Telefone und sie wissen, an wen sie sich wenden müssen. In der Bild-Zeitung wetzen sie ohnehin schon die Tastaturen, ein Gespräch mit Mohring wird als „Verhör“ verkauft, die alte Leier: Eine Zusammenarbeit mit der Linkspartei sei Verrat der CDU an einem „ihrer letzten heiligen Werte“, der „Markenkern der Partei der Wiedervereinigung“ sei bedroht. Doch Mohring bleibt aufrecht, die CDU bleibt es fast ausnahmslos auch, keine Heckenschützen, kein verbales Störfeuer.

Eine neue Situation erfordert auch neues Verhalten. Hier wird es geliefert. Zumal alle wissen: Wer jetzt gegen Gespräche mit der Linkspartei auftritt, macht jene lauten Minderheiten stark, die am liebsten über die Brandmauer zur AfD hinüberklettern wollten. Ortsfunktionäre aus der vierten Reihe. Ein paar Anhänger der Werte-Union, die von der Frankfurter Allgemeinen Zeitung als „eine kleine Gruppe am rechten Rand der CDU“ beschrieben wird. Auch ein früherer Verfassungsschutzpräsident treibt dort gern sein Wesen.

Aber die CDU im ganzen bleibt stabil. Der Generalsekretär der CDU wehrt einen Vorstoß von der Vorgestern-Fraktion ab, die ihn zu einem Gastbeitrag gegen die Linkspartei drängen wollen. Stattdessen gibt Paul Ziemiak einen Text heraus, in dem er CDU und AfD „wie Feuer und Wasser“ nennt, eine Zusammenarbeit wäre „Verrat an der Christdemokratie“. Mohring sieht sich bestätigt und unterstützt, er nimmt das vertrauliche Angebot von Bodo Ramelow ganz vertraulich an. SMS werden ausgetauscht, aber nicht weitererzählt. Es wird jetzt eine Weile dauern, das wissen alle Beteiligten. Und es wird kompliziert. Der Erfurter Weg ist eine ziemlich steinige und steile Straße.

Mohring wird tags darauf natürlich auf seine Kanäle zu Ramelow angesprochen. Er reißt sich am Riemen: „Private Kommunikation ist aus gutem Grund vertraulich.“ Als sich der Moderator einer Talkshow später nachfragend an ihn heranlanzt, lächelt der CDU-Politiker bloß. Er denkt an das Bild-Interview, Schweigen ist in dieser Situation eine „Frage des Anstands“.

2019-10-27 Wahlabend Thüringen by Sandro Halank–83.jpg

Apropos Anstand, dass das Blatt das Gespräch zum „Verhör“ erklärt hat, wurmt Mohring. Ein Bonmot von Max Goldt kommt ihm in den Sinn: „Diese Zeitung ist ein Organ der Niedertracht.“ Auch dagegen muss man nun aufrecht bleiben. Drei Tage ist die Wahl erst her, der junge CDU-Fraktionschef blickt in eine ungewisse aber auch spannende Zukunft. Ja, eine neue Situation ist das. Thüringen, die politische Landschaft, CDU und Linkspartei – er erinnert sich an den Morgan am Tag nach der Wahl, an seine Worte: „Ruhe und Besonnenheit“.

Was wirklich war

Hätte, hätte, Fahrradkette – die ersten drei Tage nach der Wahl sind in Wahrheit anders verlaufen. Die Lage ist dadurch nicht einfacher geworden, sondern komplizierter. Mike Mohring hat daran großen Anteil, taktisch unsicher, strategisch unvorbereitet, machtpolitisch ungeschickt. Hat er mit dieser Lage etwa nicht gerechnet? In der Talkshow, in der er in Wahrheit auch die Vertraulichkeit Ramelows herumplappernd brach, sagt Mohring: Es sei ein Wahlergebnis „mit dem man nicht rechnen konnte. Vielleicht wollte ich auch nicht damit rechnen.“ Markus Lanz darauf: „Aber damit musste man doch rechnen.“ Mohring: „Klar, konnte man.“

Konnte? Und doch lässt sich die verfahrene Kiste nicht allein auf Mohring schieben. Sein Versuch, unmittelbar nach der Wahl die Tür zur Linken entgegen vorheriger Absagen ein kleines bisschen offenzuhalten, ist vor allem von Politikern der Union vereitelt worden, die Thüringen nur zum Spielball ihrer eigenen Machtlogiken gemacht haben.

Die Mohring-Debatte in der CDU war nicht zuletzt eine um den Kopf der Vorsitzenden Annegret Kramp-Karrenbauer und gegen den Einfluss Angela Merkels. Nicht wenige haben nach dem Motto „Mohring schlagen, AKK und Merkel treffen“ agiert und dabei, man musste das ahnen können, jene angefeuert, die tatsächlich mit Rechtsradikalen reden wollen. Wie ein ausgerollter brauner Teppich für die, die glauben, man müsse die CDU noch weiter nach rechts abbiegen lassen.

Quelle         :     Der Freitag          >>>>>         weiterlesen


Grafikquellen              :

Oben       —           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Oskars letzter Versuch ?

Erstellt von DL-Redaktion am 13. November 2019

Ganz, ganz viel zu tun

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Von Anna Lehmann

Amira Mohamed Ali wird Nachfolgerin von Sahra Wagenknecht. Das Erbe wird schwer. Denn die Fraktion ist nach der Wahl gespaltener denn je.

Es gab da dieses Bild, kurz nachdem Amira Mohamed Ali am Dienstagnachmittag gegen halb vier zur Fraktionschefin der Linken gewählt worden war. Sie stand im Clara-Zetkin-Saal der Linksfraktion im Reichstagsgebäude, umringt von zwei Herren: zum einen Co-Fraktionschef Dietmar Bartsch und zum anderen Diether Dehm, einst Vorsitzender ihres niedersächsischen Landesverbandes und bis heute einflussreicher Strippenzieher in der Partei. Mohamed Ali lächelte in eine Kamera, Dehm und Bartsch neben ihr reckten die Fäuste. Gewonnen!

Die Szene war eigentlich nicht für die Öffentlichkeit bestimmt, der Fraktionssprecher scheuchte Neugierige schnell wieder aus dem Saal. Diether Dehm veröffentlichte es dennoch auf Facebook. Danach gingen Mohamed Ali und Bartsch aus dem Raum und vor die Presse und sie stand im Rampenlicht. Das erste Mal so richtig, seitdem sie vor zwei Jahren in den Bundestag eingezogen war.

2017 war Mohamed Ali auf Platz 5 der niedersächsischen Landesliste und als fünfte Niedersächsin für die Linke gerade noch in den Bundestag gerutscht. Zwei Jahre später ist sie Fraktionschefin, Nachfolgerin der bekanntesten Linken-Politikerin Sahra Wagenknecht. Eine Traumkarriere als Politikerin. Oder doch eher ein Knochenjob als Trümmerfrau?

Wie tief die Fraktion nach dieser knappen Wahl mit zwei Wahlgängen gespalten ist, zeigte sich im weiteren Verlauf des Nachmittags. Caren Lay, die ihre Kandidatur für den Fraktionsvorsitz als Erste angekündigt hatte, hätte als erfahrenere und bekanntere Kandidatin eigentlich die besseren Karten haben müssen. Die Vizefraktionvorsitzende und mietenpolitische Sprecherin sitzt seit 2009 im Bundestag.

Der Frust entlädt sich

Mohamed Ali ist nun mit Unterstützung des sogenannten Hufeisens ins Amt gekommen, jenes machttaktischen Bündnisses aus Reformern und Partei-Linken, das vier Jahre lang eine knappe Fraktionsmehrheit gesichert hatte. Doch der Groll gegen diese Machtbündnis war in den letzten Jahren gewachsen. Nun bekamen die übrigen Kandidat:innen für den Fraktionsvorstand den geballten Frust über diesen knappen Wahlsieg und das Wirken des Hufeisens zu spüren.

Sahra Wagenknecht and Dietmar Bartsch. Hannover Parteitag 2017.jpg

Vom Winde verweht

Der erste parlamentarische Geschäftsführer Jan Korte erhielt nur 39 von 68 möglichen Ja-Stimmen. Und das, obwohl er im Bundestag souverän auftritt und ohne Gegenkandidat:in angetreten war. Von den sechs potenziellen Arbeitskreisleiter:innen, die sich auf sechs Stellen bewarben, fielen zwei im ersten Wahlgang durch, Fabio de Masi und Heike Hänsel. De Masi wurde im zweiten Anlauf gewählt, Hänsel fiel erneut durch. Bartsch wird drei Kreuze gemacht haben, dass er mit 64 Prozent in einem Rutsch zusammen mit Mohamed Ali gewählt wurde. In einem anderen Wahlprozedere wäre er wohl genauso abgestraft worden.

Quelle          :         TAZ         >>>>>          weiterlesen

Neue Fraktionsspitze der Linken

Der Verfeindungskomplex

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Kommentar von Stefan Reinecke

Politische und persönliche Fehden sind in der Linksfraktion eng verwoben. Genau das kann für die unverbrauchte Mohamed Ali eine Chance sein.

Amira Mohamed Ali, Muslimin und Juristin aus Hamburg, wird zusammen mit Dietmar Bartsch die Linksfraktion führen. Das ist eine erstaunliche Umkehrung des Prinzips demokratischer Elitenauswahl. Eigentlich wird an die Spitze gewählt, wer sich als besonders robust, vertrauenswürdig oder taktisch versiert erwiesen hat. Mohamed Ali ist eine sympathische, eher nachdenkliche denn agitatorische Parteilinke. Doch sie ist erst seit vier Jahren in der Partei und nicht nur in der Öffentlichkeit ein unbeschriebenes Blatt.

Auch in der Fraktion kann sich niemand an wegweisende Beiträge erinnern. Manche behaupten, sie solle Wagenknecht bloß den Sessel warm halten, bis die wieder Lust hat auf den Job. Gewissermaßen das Modell Putin/Medwedjew. Das ist eines jener bösartigen Gerüchte, die ziemlich typisch sind für die giftige Atmosphäre bei den GenossInnen. Die Wahrheit ist: Der linke Flügel hat schlicht niemand anderen gefunden.

Ein Sieg des Bündnisses von Reformern und linkem Flügel, von Bartsch und Wagenknecht gegen Caren Lay und Katja Kipping also? So sieht es aus. Aber die Sache ist komplexer. Die Grenzen zwischen den drei Lagern sind ausgefranst und überlagert von persönlichen Animositäten.

Quelle         :         TAZ         >>>>>          weiterlesen


Grafikquellen           :

Oben      —      Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Hamburg, P. DIE LINKE, Überregional | Keine Kommentare »

Rennen um SPD-Vorsitz

Erstellt von DL-Redaktion am 12. November 2019

Denkt nach, Genossen!

File:Olaf Scholz, August 2009-1 - by SPD-Schleswig-Holstein.jpg

Ex – Bürgermeister oder Politiker ?

Von Pascal Beucker

Wenn die SPD noch eine Chance haben will, muss sich die Basis dem Parteiestablishment widersetzen und für Walter-Borjans und Esken stimmen.

Für das Parteiestablishment ist es offenkundig keine Frage, wem es in der zweiten Runde des großen SPD-Vorsitzendencastings die Stimme geben wird. Wer auch immer sich aus diesem Kreis in den vergangenen Tagen berufen fühlte, ein Votum zugunsten eines der beiden zur Wahl stehenden Duos abzugeben, stets fiel es zugunsten von Olaf Scholz und Klara Geywitz aus. Besser lässt sich ein Realitätsverlust kaum dokumentieren. Wenn die SPD noch eine Perspektive haben soll, wird die Parteibasis dem Werben ihrer Oberen widerstehen müssen. Daran ändert auch der theaterreif inszenierte und perfekt getimte Grundrente-Kompromiss nichts.

Die SPD-Mitglieder sollten selbstbewusst genug sein, sich nicht davon beeindrucken lassen, dass die veröffentlichte Meinung mehrheitlich ganz unverhohlen für den 61-jährigen Bundesfinanzminister aus Hamburg und die 43 Jahre alte Ex-Landtagsabgeordnete aus Potsdam trommelt. Wobei Letztere nicht ausschlaggebend für ihre Präferenz ist: Es geht um Scholz als vermeintlichen Stabilitätsgaranten. Eine vergiftete Empfehlung: So wie Medien, allen voran der Spiegel, Scholz gerade promoten, genauso schrieben sie einst auch Steinmeier, Steinbrück und Schulz in die Kanzlerkandidatur – um sie dann kurz vor der Wahl mit der gleichen Verve fallen zu lassen.

In was für einer Situation befindet sich die SPD? Bundesweit erreicht sie in den aktuellen Umfragen Zustimmungswerte zwischen 13 und 16 Prozent. Vom Wahlsieg Gerhard Schröders 1998 bis zur Schlappe von Martin Schulz 2017 hat die Partei mehr als 10,6 Millionen Wähler verloren. Seitdem hat sie nur noch eine einzige Landtagswahl ohne Einbruch in der Wählergunst überstanden. Das war die Wahl in Niedersachsen, in jener kurzen Zwischenperiode, in der die SPD-Führung großmäulig tönte, unter keinen Umständen die Koalition mit der Union fortzusetzen. Seit auch das Geschichte ist, ist es weiter bergab gegangen. In Bayern und Hessen im vergangenen Jahr sowie bei der Europawahl im Mai musste die SPD sogar zweistellige Verluste hinnehmen.

File:2013-09-22 Bundestagswahl 2013 Wahlparty SPD 11.jpg

Eine kleine Auswahl Geisterbahn fahrender SPD Mitglieder

Das Ausmaß des Niedergangs ist dramatisch. Die Partei sitzt mittlerweile in drei Bundesländern nur noch mit einem Wählerstimmenanteil von weniger als 10 Prozent im Parlament, in zwei weiteren liegt sie gerade mal knapp über der 10-Prozent-Marke.

Für die SPD gibt es noch Luft nach unten

Niemand sollte darauf wetten, dass die Talfahrt der SPD schon an ihr Ende gekommen ist. In früheren Zeiten wurde sie noch mit einem – schwer beweglichen – Tanker verglichen, heutzutage scheint der Vergleich mit der „Titanic“ passender: Das Schiff ist am Sinken, aber das Bordorchester spielt unverdrossen in der Erste-Klasse-Lounge weiter. Die Beispiele ihrer Schwesterparteien in Frankreich, Griechenland oder den Niederlanden zeigen: Für die SPD gibt es nicht nur Luft nach oben, sondern auch noch nach unten. Die Krise der Sozialdemokratie ist wesentlich existenzieller als jene Ende der siebziger bis Mitte der achtziger Jahre, die damals den liberalen Vordenker Ralf Dahrendorf dazu verleitete, etwas voreilig das Ende des sozialdemokratischen Zeitalters auszurufen. Jetzt könnte es wirklich so weit sein.

Quelle         :           TAZ           >>>>>          weiterlesen


Grafikquellen      :

Oben        —         Olaf Scholz bei einer Wahlkampfveranstaltung der Bundestagsabgeordneten Bettina Hagedorn in Kellenhusen.

Author SPD Schleswig-Holstein      /      Source  —     IMG_3928
This file is licensed under the Creative Commons Attribution 2.0 Generic license.


Unten         —

Deutsch: Wahlparty der Bundes-SPD zur Bundestagswahl 2013.
English: The federal election party SPD for the parliamentary election in 2013
Source Own work
Author Jonas Rogowski


Abgelegt unter Feuilleton, HARTZ IV, P.SPD, Überregional | Keine Kommentare »

Die Linke Niedersachsen

Erstellt von DL-Redaktion am 12. November 2019

Die Causa Perli…   Potemkin

Landtag Niedersachsen DSCF7719.JPG

Quelle      :   Potemkin

Von    jpsb

Zu den geliebten Aufgaben eines Blogs wie Potemkin gehört es Meinungen und Standpunkte in den politischen Prozess des linken Politbetriebes einzupflegen. Dabei kann es dazu kommen, dass Adressaten von Kritik sich als Opfer von Angriffen oder gar Kampagnen wähnen. Schnell ist dann von Mobbing und Hetze die Rede. All das dient nur einer einzigen Strategie: Den Inhalten von Textbeiträgen ihrer Stoßrichtung zu berauben, jeder Debatte eine rein persönliche Note zu geben und sich schlussendlich der Verantwortung für eine mitgliederöffentliche Klärung von ungelösten Machtfragen zu entziehen.

Denn der letzte Blogbeitrag auf Potemkin hat im Landesverband Niedersachsen eine Kontroverse darüber ausgelöst, welche Kritik an Mandatsträgern, namentlich dem Bundestagsabgeordneten Victor Perli,  erlaubt sein soll und welche nicht. Unlängst wurde das Thema sogar im Landesvorstand behandelt. Natürlich hinter dem Rücken derjenigen, die für eine Verrohung der parteiinternen Umgangsformen verantwortlich gemacht werden.

Eine Verrohung der Umgangsformen? Bei den Linken? Dies klingt wie ein Treppenwitz der Geschichte. Denn in der öffentlichen Meinung ist längst und völlig zu Recht eingepreist, das Links der Mitte immer mit ganz besonders harten Bandagen Machtkämpfe ausgefochten werden. Die Partei war, ist und wird immer ein Ort bis aufs Messer geführter Diadochenkriege sein. Ein Landesvorstand der da eine andere Erzählung zum Besten geben will ist per se handlungsunfähig, da er die Realitäten im eigenen Verband schlichtweg nicht zur Kenntnis nehmen will.

Auch Perlis Aufstieg folgt den Mustern einer Mobilisierung gegen Andere. Auf der letzten Listenaufstellung forderte er erfolglos auf Platz 2 der Landesliste den niedersächsischen Abgeordneten Dehm heraus und hoffte dabei, nach Einschätzung etlicher Beobachter der Aufstellungsversammlung,  auf die Unterstützung des damaligen Abgeordneten Herbert Behrens. Als der Angriff auf Dehm misslang, wendete er sich umgehend gegen Behrens selbst und beerbte dessen Bundestagsmandat. Wer zielstrebiges Personal wie Perli unterschätzt, kann auch bei den offensichtlichsten Manövern schnell ins Hintertreffen geraten. Eine Lektion, die für Behrens zu spät kam.

Perli verkauft sich dabei gerne als eine Mischung aus junger Hoffnung und Schwiegersohnsliebling. Die von ihm versprochene Modernsierung des Landesverbands oder gar eine stärkere Profilierung in Strategiefragen blieb aus. Perli ist ein höchstens mittelmäßiger Redner, hat keinerlei Netzwerksarbeit im Bundestag vorzuweisen und in den von ihm bearbeiten Themen ist nicht die Spur von Erneuerung erkennbar. Der Genosse ist ein klassischer Hinterbänkler, der aber im Landesverband Niedersachsen ein Gespür für Machtpolitik entwickelt hat.

Dazu gehört auch die Beherrschung  finanziell wichtiger Aggregate eigener Machtpolitik. Zum Beispiel des Rosa-Luxemburg-Bildungswerkes in Niedersachsen, dessen erster Vorsitzender er ist. An sich unscheinbar, wird diese Institution durch Steuergelder finanziert und kann somit über die Vergabe von Bildungsaufträgen und die Organisation politischer Veranstaltung auch zu internen Machtzwecken mit Wirkung auf den Parteiapparat eingesetzt werden. Da im Bildungswerk auch Arbeitsplätze eingerichtet wurden, ist es Teil der internen Humanressourcen mit Wirkung auf den Landesverband der Partei.

2019-04-11 Diether Dehm MdB by Olaf Kosinsky-9591.jpg

Gebrauchte er nicht früher die Hände zum halten der Flöte, wenn er musizierend durch Hameln lief?

Wie dann durch die Hintertür politische Fakten geschaffen werden, zeigt eine Posse aus dem abgelaufenen Wahlkampf zum Amt der OberbürgermeisterIn in Hannover. Dort hatte eine im Kreisverband Hannover völlig isolierte Gruppe um die ehemalige linke Stadträtin Helga Nowak, eine Gegenkandidatin zur Nominierung des eigenen Kreisverbandes aktiv im Wahlkampf unterstützt. Dass Ergebnis war eine Kanibalisierung der Stimmen im linken Lager und ein schlechtes Wahlergebnis sowohl für die Gegenkandidatin Kaczmarek, als auch für die Kandidatin der Linken Jessica Kaußen

Quelle         :           Potemkin            >>>>>           weiterlesen


Grafikquellen         :

Oben      —           Victor Perli, Landtagsabgeordneter Niedersachsen, 16. Wahlperiode (Fotoprojekt Landtagsabgeordnete Niedersachsen am 24. und 25. November 2009)


Unten         —          Diether Dehm, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Bundestag, Niedersachsen, P. DIE LINKE, Überregional | 2 Kommentare »

Linker Krieg oder Frieden

Erstellt von DL-Redaktion am 11. November 2019

Die Linke vor der Wahl:

Wagenknecht, Sahra, 2013.JPG

Sekt oder Selters ?

Aus Berlin Anna Lehmann

Am Dienstag wählt die Fraktion eine Nachfolgerin für die scheidende Fraktionschefin Sahra Wagenknecht. Doch es geht um mehr: Gelingt der zerstrittenen Fraktion ein Aufbruch?

Sahra Wagenknecht geht es anscheinend gerade richtig gut. Die Fraktionschefin wirke entspannt und gut gelaunt, berichten Abgeordnete. Als die Linksfraktion am vergangenen Dienstag über den Klimaaktionsplan stritt und sich die Sprit-Junkies und die Auto-Hasser in der Fraktion gegenseitig Ignoranz vorwarfen, habe Wagenknecht vermittelt: Es sei doch klar, dass man die Akzeptanz des Klimaschutz stärken müsse, auch bei denen, die nicht bei Fridays for Future mitmarschierten.

Wagenknecht hat, so scheint’s, endlich in ihre Rolle als Fraktionsvorsitzende gefunden. Und das in den Tagen ihres Abgangs. Am Dienstag wird die Fraktion Wagenknecht nach vier Jahren an der Spitze als Fraktionschefin verabschieden. Bereits im März hatte sie angekündigt, dass sie den Posten abgeben wird, wegen Stress und Überlastung.

Es zog sich länger als geplant, Wagenknecht absolvierte noch pflichtgemäß Wahlkampftermine für die Europawahl sowie in Sachsen, Brandenburg und Thüringen. Bis zu dieser letzten Wahl hatte sich die Partei strikte innerparteiliche Ruhe verordnet.

Ab Dienstag darf Wagenknecht endlich wieder einfaches Fraktionsmitglied sein und die Linke wählt eine neue Fraktionsspitze.

Es geht um viel, um viel mehr als die Nachfolge der populären und polarisierenden Spitzenfrau. Die Neuwahl ihres Führungspersonals wird für die Linke auch zu einer Bewährungsprobe: Versinkt die Fraktion erneut im Machtkampf der verfeindeten Lager – grob umrissen in die Truppen um Parteichefin Katja Kipping und die Getreuen von Sahra Wagenknecht und Dietmar Bartsch. Oder nehmen die Linken nach zwei zerstrittenen Jahren und drei verlorenen Wahlen den kleinen Aufschwung der Thüringer Landtagswahl mit und zeigen, dass sie interne Auseinandersetzungen solidarisch und zivilisiert klären können. In Thüringen ist die Linke Ende Oktober erstmals in ihrer Geschichte stärkste Partei geworden. Das Grundrezept: ein überaus beliebter Ministerpräsident und eine Partei, die geschlossen hinter ihm stand.

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–103.jpg

Leicht wird es nicht, diesen Schwung mitzunehmen. Wagenknecht hinterlässt eine zerrüttete Fraktion. Sie ließ kaum eine Gelegenheit aus, die Migrationspolitik der Partei und den Kurs der Parteiführung öffentlich in Frage zu stellen. Innerparteiliche Diskussionen mied sie, lieber gründete sie die Sammlungsbewegung „Aufstehen“, die Menschen zusammenbringen und den etablierten Parteien Druck machen sollte. Das scheiterte.

Die Parteivorsitzenden Kipping und Bernd Riexinger wiederum ließen sich auf einen Dauerstreit mit Wagenknecht und ihren Fans ein und damit zu, dass die Linke sich öffentlich zerlegte. Eine Fortsetzung dieses Dramas ist nicht ganz ausgeschlossen.

Leicht wird es nicht: Sahra Wagenknecht hinterlässt eine zerrüttete Linksfraktion

Zwei Frauen haben ihre Kandidatur für den weiblichen Part der Doppelspitze angekündigt: Caren Lay und Amira Mohamed Ali. Lay, die Vizefraktionsvorsitzende und mietenpolitische Sprecherin ist, stammt aus Rheinland-Pfalz, ihr Wahlkreis aber ist seit Langem Bautzen in Sachsen. Sie zählte mal zur „Jugendbrigade“ um Katja Kipping. Vielen gilt sie wegen ihrer Nähe zur Parteichefin als Teil des Konflikts. Lay bemüht sich jedoch gerade um Distanz zu Kipping und betont gern, dass sie sich nicht als deren Anhängsel verstehe.

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Mohamed Ali ist in Hamburg geboren und lebt seit vielen Jahren in Oldenburg. Sie arbeitete als Rechtsanwältin, bevor sie vor zwei Jahren über die niedersächsische Landesliste in den Bundestag einzog. Als verbraucherpolitische Sprecherin hielt sie dort engagierte Reden für die Kennzeichnung von Nahrungsmitteln und gegen falsche Subventionen an Landwirte, denen allerdings nicht mal ihre eigene Fraktion vollzählig beiwohnte. Mohamed Ali soll von Diether Dehm, der Wagenknecht verehrt und Kipping verteufelt, zur Kandidatur überredet worden sein.

Quelle          TAZ          >>>>>           weiterlesen


Grafikquellen           :

Oben     —         Sahra Wagenknecht während einer Wahlkampfveranstaltung zur Bundestagswahl 2013 auf dem Friedensplatz in Bonn

2.)  von Oben      —             Bundesparteitag Die Linke 2018 in Leipzig

———————————–      — 

Unten         —             Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

Die Falschen Freunde ?

Erstellt von DL-Redaktion am 9. November 2019

Stolz und Einzelkämpfertum

File:Bremen, Loriotplatz, Parkbank mit Sitzfigur nach Loriot (2).jpg

Von Robert Misik

Viel wird über die sogenannten einfachen Leute gesprochen. Wer sind sie und was sind ihre Werte? Eine Spurensuche.

urz nach dem Wahlsieg von Donald Trump schrieb die amerikanische Rechtswissenschaftlerin Joan C. Williams einen großen Essay mit dem Titel „What so many people dont’t get about the U.S. working class“. Lange habe man die Bedrängnisse der Arbeiterklasse igno­riert, nun schleiche sich eine Art gutmenschliche Besorgnis ein. „Diese Haltung“, so Williams später in ihrem Buch „White Working Class“, in das weitere Recherchen und unzählige Zuschriften eingeflossen sind, „wird sie aber noch wütender machen und die ungesunde Klassenspaltung nur vergrößern“.

Williams weiter: „Sie wollen anerkannt werden für die Beiträge, die sie leisten – und für ihre Art zu leben.“ Anders gesagt: Die Arbeiterklasse will eben „nicht wie ein Stamm in einem Land behandelt werden, das weit entfernt ist“.

Von den USA bis ins Ruhrgebiet, von Mittelengland bis zu den Wiener Vorstädten, überall wird derzeit die Frage diskutiert, warum sich die „einfachen Leute“ als Verlierer fühlen und beklagen, keine Stimme mehr zu haben. Wobei es gleich mit der Frage beginnt, wer das denn überhaupt sein mag, diese viel besprochenen „einfachen Leute“.

Das sind einmal, grob gesagt, jene, die im Leben nicht auf die Butterseite gefallen sind – also eher Kleinverdiener, aber nicht nur. Es sind Arbeiter und Arbeiterinnen, bis hin zur Mittelschichts­familie im Einfamilienhaus mit zwei Autos vor der Tür. Leute, die sich als „die Normalen“ ansehen. Oft ist das auch eine stolze Selbstzeichnung. „Da, wo ich lebe, bedeutet ‚einfacher Mensch‘ ‚anständiger Mensch‘, weil bescheidenes (oder weniger bescheidenes) Auskommen mit ehrlicher Arbeit (meist körperlich) erschaffen“ wurde, so beschreibt das eine Frau aus dem österreichischen Mühlviertel.

Die „real existierenden“ Werte der arbeitenden Klassen sind über Jahrhunderte entstanden, hatten ihre Quellen teilweise noch in der vorindustriellen Handwerkskultur, mit ihrem Stolz auf die eigenen Fertigkeiten, den Vorstellungen von einem gerechten Lohn und einem fairen Preis. Hinzu kam ein Gemeinschaftsgeist mit einer starken Trennung in Insider und Outsider. Man kann auch die heutigen Werthaltungen der „populären Klassen“ nicht verstehen, ohne diese Geschichte zu verstehen.

Die alte Arbeiterklasse, so Joan C. Williams, habe einen Stolz gehabt und sie habe sich Anerkennung verschafft – bis sie gewissermaßen als zentrale soziale Schicht angesehen wurde oder sich zumindest so fühlen konnte. Diese Arbeiterklasse habe aber auch bestimmte Werte hochgehalten: den Stolz darauf, harte Arbeit zu leisten; die Vorstellung, dass man niemandem auf der Tasche liegen darf; dass man es mit eigener Tüchtigkeit schafft; dass man mit Handarbeit die Wirtschaft am Laufen hält, dass man zupackt, nicht zu verkopft ist. Dass man einfach „normal“ ist. Zugleich war dieser Stolz sehr verletzlich. Dafür, respektlos behandelt zu werden, hatte man immer ein feines Sensorium. Ein egalitärer Geist prägte die Arbeiterklassenmoral, und wer sich für etwas Besseres hielt, war schnell unten durch. Die Angehörigen der Arbeiterklasse schätzen rigide Selbstdisziplin, weil sie nötig ist, um einen harten Job, den man hasst, vierzig Jahre lang machen zu können.

Weniger solidarisch, als romantisierende linke Intellektuelle gerne glauben würden, ist die Arbeiterklasse mit „den Armen“, also mit jenen, die ihr Einkommen aus staatlichen Sozialtöpfen beziehen, weil sie mit Arbeit nicht über die Runden kommen, weil sie keine Jobs finden oder aus anderen Gründen am Arbeitsmarkt keine Chance haben. Die sieht man schnell als Leute an, die es sich leichtmachen, während man selbst jeden Tag aufstehen und rackern muss, einem nichts geschenkt wird.

Genau das klingt bei Lorraine, einer Gabelstaplerfahrerin, an, die im Zuge einer großen britischen Studie interviewt wurde. Sie ist alleinerziehend, Mutter zweier Buben, wohnt zur Miete, kennt die Stereotypisierungen, denen sie ausgesetzt ist, und sagt: „Ich bin unten, klar.“ Fügt dann aber hinzu: „Ich nenne mich Arbeiterklasse, aber ich glaube nicht, dass ich mich in der gleichen Klasse sehe wie jemand, der sich krallt, was er kann […]. Verstehst du, ich bin stolz auf das, was ich tue, ich stehe jeden Morgen auf […]. Ich kann mir nichts Ärgeres vorstellen, als jeden Tag daheim zu sein und nichts zu tun zu haben. Weißt du, die werden dann fett, oder? Und wundern sich, warum. Aber darf man das überhaupt sagen?“

Die weiße Arbeiterklasse habe das Gefühl, „aus dem Zentrum an den Rand des Bewusstseins ihres Landes gerückt worden zu sein“, formuliert auch der US-Politikwissenschaftler Justin Gest. Viele, so sagt er, fühlten sich außerstande, dagegen irgendetwas zu unternehmen. Gest hat für eine große Studie mehrere Monate erst in einem Arbeiterklassenbezirk in East London und danach eine Zeit in Youngtown, Ohio verbracht, Dutzende lange Gespräche geführt und die Ergebnisse in seinem Buch „The New Minority“ zusammengefasst.

Auch wenn hier bisher provisorisch von der „weißen Arbeiterklasse“ gesprochen wurde, ist dieser Begriff eher behelfsmäßig und unpräzise. Man sollte sich möglichst konkret vor Augen führen, wer eigentlich alles gemeint sein könnte, wenn man heutzutage, im postindustiellen Zeitalter, von Arbeiterklasse spricht

Quelle      :            TAZ            >>>>>        weiterlesen       


Oben         —          Parkbank mit Skulptur (geschaffen 2016 von Roman Strobl, bemalt von Patrick Przewloka) nach der Titelfigur von „Loriots großer Ratgeber“ am Loriotplatz in Bremen

Author Karl432      / Sourcr    — Own work

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.


Unten        —        Bpb      Bundeszentrale für politische Bildung

Abgelegt unter Kultur, Medien, Mensch, Überregional | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.


Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.


2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.


3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.


Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

AKL – Thüringen-Wahl:

Erstellt von DL-Redaktion am 7. November 2019

Linke Positionen in Gefahr

2019-10-27 Wahlabend Thüringen by Sandro Halank–54.jpg

Quelle      :     AKL 

Von Steve Hollasky, Dresden

Keine Kooperation mit den bürgerlichen Parteien – für ein sozialistisches Regierungsprogramm!

Drei Dinge zeigen die Landtagswahlen in Thüringen: Dreißig Jahre nach der Revolution gegen die in der DDR herrschende stalinistische Bürokratie befinden sich die bürgerlichen “Volks”parteien SPD und CDU weiterhin in ihrer tiefsten Krise seit 1945; die gesellschaftliche Polarisierung schreitet fort und der Anpassungskurs eines Teils der LINKEN erreicht zu einer Zeit, in der linke Positionen wie zum Beispiel die Forderung nach Enteignung der Immobilienhaie oder kostenlosem öffentlichen Personennahverkehr Zuspruch in größeren Teilen der arbeitenden Bevölkerung bekommen, eine neue Qualität. Und es stellt sich die Frage, was man mit der jetzigen Situation anfangen solle. Die Regierungsbildung gestaltet sich schwierig und in den Führungskreisen der LINKEN wird offen über ein Bündnis oder Kooperation mit der CDU schwadroniert.

Krise der Etablierten

SPD und CDU haben in Thüringen erneut Verluste hinnehmen müssen. Die Sozialdemokrat*innen büßten 4,2 Prozentpunkte ein und stürzten auf ein Thüringer Allzeittief von 8,2 Prozent. Weit dramatischer fielen die Verluste der CDU aus. Mit 11,7 Prozentpunkten minus im Vergleich zu 2014 fiel sie noch hinter der AfD auf Platz drei und landete bei 21,8 Prozent der Stimmen.

Abgestraft wurden bei der Wahl am Sonntag die Regierungsparteien im Bund – und zwar unabhängig davon, ob sie sich in Thüringen aktuell in der Regierung befinden, wie die SPD, oder aber in der Opposition, wie die CDU. Damit setzte sich augenscheinlich der Trend der letzten Landtagswahlen in Sachsen und Brandenburg fort.

Mehr noch, die schleichende Krise den Unionsparteien scheint nun auch offen auszubrechen. Bislang konnten sich die in Wahlumfragen geschwächten CDU und CSU mit Blick auf die SPD als gesund präsentieren. Anders als die SPD fuhr man keine einstelligen Ergebnisse ein. Dass diese Zeiten nun aber vorbei sein könnten, meint auch Ursula Münch, Politikwissenschaftlerin an der Akademie für politische Bildung in Tutzingen und Mitglied im Wirtschaftsrat der Bundesregierung. Im Interview mit der tagesschau erklärte sie am 29.10., der CDU drohe aus ihrer Sicht „das gleiche Schicksal wie der SPD“. Auch vorgezogene Neuwahlen im Bund schloss Münch in diesem Interview nicht aus.

Die Zerschlagung der Industrie durch die Treuhand nach 1990, die Wiedereinführung kapitalistischer Verhältnisse und die anhaltende Perspektivlosigkeit in ganzen ostdeutschen Landstrichen, hat die Menschen in den neuen Bundesländern nicht nur ungeheuer wütend gemacht, sondern in der Folge auch von den Etablierten entfremdet.

Gesellschaftliche Polarisierung

Nicht selten vernimmt man zur Beschreibung der politischen Lage das Wort „Rechtsruck“. Dass dies nur eine ungenaue Wiedergabe der Situation ist, zeigt das Wahlergebnis in Thüringen. Was sich zusehends abspielt, ist eine Polarisierung nach links und rechts. Nicht nur die AfD erzielte Zugewinne und schnellte auf 23,4 Prozent, wodurch sie Platz 2 besetzte. Auch die LINKE fuhr ein Plus von immerhin 2,8 Prozentpunkten ein und landete bei 31,0 Prozent. Dabei hat auch die Regierung unter Bodo Ramelow in der Koalition mit SPD und Grünen nicht eine grundlegende andere Politik gemacht, die klar erkennbar im Interesse der Masse der arbeitenden Bevölkerung ist. So bekam in der Konsequenz diese Regierung keine Mehrheit. Viele wählten die LINKE als stärkste Kraft, um zu verhindern, dass die AfD stärkste Kraft wird, so wie es auch in Brandenburg mit der SPD oder in Sachsen der CDU der Fall war. Doch Rot-Rot-Grün hat den Aufstieg der AfD in Thüringen nicht verhindert.

Die gern erwähnten Einstellungen von Lehrer*innen in Thüringen sind bei Weitem nicht ausreichend. Und die Gemeindereform des Landes Thüringen bedeutete in der Realität nur längere Wege für Anwohner*innen, weil Ämter verlegt oder geschlossen wurden. Wirklich linke oder gar sozialistische Maßnahmen wie Initiativen zur Rekommunalisierung von Wohnraum oder Kliniken sucht man in den vergangenen fünf Jahren vergebens.

Dass die Thüringer Linkspartei ausgerechnet mit Ramelow an der Spitze dennoch ihr bestes Ergebnis überhaupt einfuhr, beflügelt nun den rechten, in der Konsequenz prokapitalistischen Teil der LINKEN. Dietmar Bartsch, Vorsitzender der Fraktion der Linkspartei im deutschen Bundestag, erklärte inzwischen, man müsse an den Erfolg von Bodo Ramelow anschließen und als Bundespartei davon lernen“. Das ist aber genau der falsche Weg und die Linken in der LINKEN müssen jetzt klar dagegen halten.

Gerade die Tatsache, dass die LINKE die Wut über Sozialabbau, Niedriglohnpolitik und Rentenkürzungen nicht zum Ausdruck bringt und konsequente Lösungen anbietet, macht es der AfD leicht. Auf rechtspopulistische Art verbindet sie soziale Demagogie mit dem Gift des Rassismus und Nationalismus. So erklärte Höcke im Wahlkampf gern, Zuwanderer würden gute medizinische Versorgung erhalten und Hiergeborene hätten mit dem Pflegenotstand zu kämpfen. Darauf aufbauend versucht die Thüringer AfD unter der Führung von Höcke, rechtsextreme Positionen zu verankern und hoffähig zu machen. Dass die Positionen der AfD Lügen sind, wird dann leichter zu erklären, wenn Migrant*innen, Geflüchtete und Hiergeborene gemeinsam gegen den Pflegenotstand kämpfen. Das zu organisieren wäre eigentlich Aufgabe der LINKEN.

Anpassungskurs der LINKEN

Dass die LINKE auch nach dieser Wahl einen anderen Weg, nämlich den des Parlamentarismus und Regierungsbeteiligung beschreiten wird, steht zu befürchten. Schon kurz nach der Wahl rief die Führung der Thüringer LINKEN nicht etwa zu Kämpfen auf, sondern erklärte die grundsätzliche Verhandlungsbereitschaft mit allen im Landtag vertretenen Parteien, mit Ausnahme der rechtspopulistischen AfD.

Was damit gemeint war, offenbarte sich schnell. Als der konservative Spitzenkandidat, Mike Mohring, am Tag nach der Wahl im ARD-Morgenmagazin, ganz anders als noch am Abend zuvor, verkündete, seine Partei müsse nun „Verantwortung übernehmen“, sprang die LINKE-Führung sofort auf den Zug auf. Ramelow erklärte, man werde sehen, was möglich sei, „eine festere Koalition, eine absolute Koalition oder ein Tolerierungsmodell“. Unterstützung kam von der LINKEN-Bundesspitze. Bernd Riexinger meinte glatt, der Ball läge im Feld der CDU. Eine Absage an ein Bündnis mit einer Partei, die für die Situation in Ostdeutschland verantwortlich ist, kam nicht. Die Befürchtung, die LINKE könnte sich wirklich auf ein Bündnis mit der CDU einlassen war jedoch fehl am Platz. Aber nicht, weil die LINKE dieses Angebot prinzipienfest ablehnte, sondern, weil die CDU und auch Mike Mohring die diesbezüglichen Andeutungen wieder zurückzog. Das spricht Bände über die Situation in der LINKEN, wo führende Teile die Partei lieber als “verlässlichen” Bestandteil des Establishments sehen wollen, anstatt als Partei des Widerstands.

Was jetzt?

DIE LINKE muss endlich aufhören, das Bündnis mit den Sozialabbauparteien einzugehen und stattdessen das Bündnis mit der arbeitenden Bevölkerung und den Gewerkschaften schmieden, um den gemeinsamen Kampf mit Beschäftigten, Arbeitslosen, antirassistischen Initiativen, Rentner*innen und Mieter*innen zu organisieren. Das Potenzial dafür besteht auch unter dem mit Abstand erneut größten Teil aller Wahlberechtigten – den Nicht-Wähler*innen, die weder dem bürgerlichen Einheitsbrei, noch den Rechtspopulisten etwas zutrauen. Wenn aber die LINKE in Thüringen zum festen Bestandteil dieses Establishments wird – und das wäre bei einem Bündnis mit der CDU der Fall – dann wird für noch mehr Menschen der scheinbar einzige Weg ihre Wut zu artikulieren das Kreuz bei der AfD sein. Das darf man nicht zulassen.


Eine Regierung der LINKEN in dieser Situation kann nur eine Minderheitsregierung mit sozialistischem Programm sein. Die müsste ohne Zweifel um jedes kleine Gesetz kämpfen. Gerade dazu müsste sie die lohnabhängig Beschäftigten unabhängig von Herkunft, Sprache, Religion, Alter oder Geschlecht mobilisieren. Das zu erreichen wäre ohne Frage nicht leicht. Es wäre zudem nur möglich, wenn man der Bevölkerung zeigen würde, dass eine LINKE-Regierung wirklich in ihrem Interesse wäre. Das Programm für eine solche Regierung müsste aus Eckpunkten bestehen wie der Kommunalisierung von Wohnraum unter demokratischer Kontrolle die Mieter*innen, Verstaatlichung von Pflegeinrichtungen und Krankenhäusern, massiven Stellenaufbau an den Schulen, eine Absage an die Schuldenbremse und stattdessen die Besteuerung der Reichen, sowie antirassistische Mobilisierungen gegen AfD und Co. Eine solche Landesregierung könnte – sogar aus der Minderheit heraus – zu einem bundesweiten Fokus von Opposition gegen eine immer schwächer werdende Bundesregierung werden und den Widerstand gegen Sozialabbau, den Kampf für wirkliche Verbesserungen inspirieren und voran bringen. Sozialistische Ideen könnten wieder greifbar werden. Das wäre auch ein großer Schritt auf dem Weg hin zu einer sozialistischen Massenpartei. Und es wäre das wirksamste Mittel gegen Rechts, um die Basis der AfD zu untergraben.

Würde man dieses Programm vertreten, könnte man den Landtag von außen mit einer großen Bewegung unter Druck setzen. Doch Ramelow wird diesen Weg nicht gehen. Auch da braucht man sich keiner Illusion hinzugeben. Eine Koalition der LINKEN unter der Führung von Ramelow mit – oder Tolerierung von – Sozialabbauparteien, von SPD, Grünen, FDP und CDU, wird in Thüringen leider kaum zu verhindern sein. Wahrscheinlich sogar dann noch, wenn die zu erwartende Wirtschaftskrise hart zuschlagen und die Lebensbedingungen der arbeitenden Bevölkerung stark einschränken wird. Das zeigt, dass es darauf ankommt um grundlegende Positionen innerhalb der LINKEN bundesweit zu kämpfen. Dafür muss man jetzt endlich die linke Opposition in der LINKEN organisieren. Sol tut das im Rahmen der AKL. Wir fordern alle auf, uns dabei zu unterstützen.

akl - Antikapitalistische Linke


Grafikquellen         :

Oben          —         Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))


Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 6. November 2019

7 Gründe, warum Spahns Gesundheitspläne für Patienten gefährlich sind

File:Intensivstation fcm.jpg

Quelle        :      Netzpolitik ORG.


Am Donnerstag soll der Bundestag über das Digitale-Versorgung-Gesetz abstimmen. Doch der Vorschlag des Gesundheitsministers hat eine soziale Schieflage, weicht den Schutz sensibler Daten auf und kann zur Diskriminierung von Risikogruppen führen.

Gesundheitsminister Spahn will mit dem Digitale-Versorgung-Gesetz (Entwurf) die Daten gesetzlich Versicherter zentral speichern lassen und pseudonymisiert für Forschungszwecke zur Verfügung stellen. Gleichzeitig dürfen die Krankenkassen selbst so viele Daten zusammenlegen und auswerten wie nie zuvor – und diese für nicht näher umschriebene „digitale Innovationen“ nutzen. Der Gesetzesentwurf erregt massive Kritik – wir fassen die wichtigsten Argumente zusammen.

1. Sozial ungerechter Datenschutz

Spahns Pläne der Datenweitergabe betreffen die etwa 73 Millionen gesetzlich Versicherten. Knapp neun Millionen Menschen in Deutschland, die sich eine private Krankenkasse leisten können, sind von der Regelung ausgenommen. Private Krankenversicherungen haben in der Regel diejenigen abgeschlossen, die mehr Geld verdienen. Im Bundestag gilt das für fast die Hälfte aller Abgeordneten. Sie genießen in Zukunft einen besseren Gesundheitsdatenschutz als die Mehrheit der Bevölkerung.

2. Schieflage bei algorithmischer Auswertung

Die soziale Schieflage des Gesetzes wird dazu führen, dass gerade die Daten derjenigen ausblendet werden, die sich eine bessere Gesundheitsvorsorge und -versorgung leisten können. Es wird sich also anhand der Daten nicht auswerten lassen, welchen Einfluss eine gesetzliche oder eine private Krankenversicherung auf die Gesundheitssituation hat. Diese Fragen sind aber von hohem Interesse, wenn es darum geht, gute gesundheitliche Versorgung für alle zu gewährleisten.

3. Pseudonymisierung kann geknackt werden

Pseudonymisierung ist nicht gleich Anonymisierung. Oft genügen einige wenige Merkmale, um pseudonymisierte Daten doch einer Einzelperson zuzuordnen. Besonders bei Datensätzen mit niedrigen Fallzahlen wie bei seltenen Krankheiten ist diese Gefahr groß. Im Gesetzentwurf ist nicht beschrieben, wie die Daten vor einer solchen Identifizierbarkeit geschützt werden sollen.

Es gibt zahlreiche Felder, in denen De-Anonymisierung gelungen ist, ob nun bei Kreditkartendaten oder bei der Browserhistorie. Der Kryptografie-Experte Dominique Schröder forderte in der Expertenanhörung des Gesundheitsausschusses daher, nur mit verschlüsselten Daten zu arbeiten. Verfahren, auch mit solchen Daten Berechnungen und Auswertungen durchführen zu können, gibt es bereits.

4. Keine Widerspruchsmöglichkeiten

Die Patienten können der Nutzung ihrer sensiblen Gesundheitsdaten nicht widersprechen. Zwar ist laut der Datenschutzgrundverordnung die Zustimmung für eine Datenverarbeitung grundsätzlich notwendig, diese kann aber durch Gesetze ausgehebelt werden. Das ist hier der Fall. 73 Millionen Menschen in Deutschland haben durch das Gesetz weder die Chance, der Datenweitergabe generell abzulehnen, noch können sie ethisch fragwürdigen Studien auf Einzelfallbasis widersprechen.

5. Zentrale Massenspeicherung könnte ausgeweitet werden

Nach der alten Datenschützer-Weisheit „Wo ein Trog, da sammeln sich die Schweine“ kann eine zentrale Gesundheitsdatei weitere Begehrlichkeiten wecken. Die zentrale Erfassung könnte sich als Dammbruch erweisen, der „der Überwachung, der Kontrolle und der Sortierung von Menschen sowie der Diskriminierung bestimmter Risikogruppen Tür und Tor“ öffnet, wie es die Digitale Gesellschaft in einer Stellungnahme kritisiert.

6. Unklare Begrifflichkeiten, unklare Datenmengen

Spahns Gesetz hantiert mit unbestimmten Rechtsbegriffen: Niemand weiß bislang, was mit „digitalen Innovationen“ oder „Versorgungsinnovationen“ gemeint ist. Laut der Gesetzesbegründung dürfen aber die Krankenkassen Patientendaten aus der ärztlichen Versorgung, der Arzneimittelverordnung, der stationären Versorgung und der Abrechnung „sonstiger Leistungserbringer“ zusammenführen, um Erkenntnisse für diese „digitalen Innovationen“ gewinnen zu können.

7. Gesundheitsprofile und Diskriminierung

Der Bundesrat kritisiert, dass der Verhältnismäßigkeitsgrundsatz im Gesetz nicht gewahrt bliebe: „Die personenbezogene Zusammenführung und Auswertung ermöglicht den Krankenkassen, in großem Umfang individuelle Gesundheitsprofile ihrer Versicherten zu erstellen. Dies birgt erhebliche Risiken für die Persönlichkeitsrechte der Versicherten und die Gefahr der Diskriminierung von einzelnen oder bestimmten Risikogruppen.“ Die erweiterte Datenauswertung könnte in Richtung individualisierter Vertragsleistungen gehen und damit das Solidarprinzip von Krankenversicherungen unterlaufen.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.


Grafikquelle       :            Bildinhalt: Krankenbett einer Intensivstation mit Patient

  • Aufnahmeort: Mannheim, Deutschland
  •  Die dargestellte Person billigt jede nicht verunglimpfende Veröffentlichung.


attribution share alike This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: Frank C. Müller

Abgelegt unter Gesundheitspolitik, Politik und Netz, Regierung, Überregional | Keine Kommentare »

Linke PV am 27. /28. 10. 19

Erstellt von DL-Redaktion am 6. November 2019

Konversion der Autoindustrie, Geschlechterparität im Bundestag und Thüringen-Wahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle     :  AKL

Bericht von Lucy Redler

Der Parteivorstand (PV) widmete sich am Sonntag, 27.10. schwerpunktmäßig einer interessanten Debatte über die Zukunft der Autoindustrie, einem Gesetzesentwurf zur Herstellung von Geschlechterparität im Bundestag und der Vorbereitung der Strategiekonferenz der LINKEN am 29.2. bis 1.3.2020 in Kassel.

Am Montag, 28.10. ging es neben der Wahlauswertung in Thüringen vor allem um die neue Forderung der LINKEN zur Mindestsicherung. Darüber hinaus gab es Berichte aus dem Jugend- und Studierendenverband und wurden etliche weitere Vorlagen beschlossen. Da Thies Gleiss derzeit leider die Stimme versagt, verantwortet Lucy Redler diesen Bericht allein.


Bernd Riexinger hatte eine Diskussionsvorlage zur Zukunft der Autoindustrie und deren „soziale, ökologische, demokratische Transformation“ eingereicht, die auf hohem Niveau diskutiert wurde. In der Debatte ging es um das von ihm vorgeschlagene Ziel der Halbierung der Anzahl der Autos bis 2030, ob E-Autos eine Alternative sind oder nicht, die nötige Konversion der Produktion, einen Fünf-Stufen-Plan zum kostenfreien ÖPNV, das Ziel einer emissionsfreien Wirtschaft in 15 bis 25 Jahren, der Forderung nach Arbeitszeitverkürzung bei vollem Lohnausgleich und Fragen der Vergesellschaftung.

Angesprochen wurde, dass all dies nicht in der bisherigen Form der kapitalistischen Verwertung möglich sei. Klar wurde dabei auch, dass es im Parteivorstand unterschiedliche Vorstellungen darüber gibt, ob eine Transformation der Autoindustrie und die Einführung von Wirtschaftsdemokratie im Rahmen des Systems möglich sind, oder es nötig ist (Lucys und Thies Meinung), offensiver die Eigentums- und Systemfrage zu stellen. Das Ziel, das Klima zu retten, erfordert die Konversion der Autoindustrie. Das ist nur durch die Vergesellschaftung der Autoindustrie möglich und muss einhergehen mit der Überführung anderer Schlüsselindustrien in öffentliches Eigentum, der Abschaffung der kapitalistischen Produktionsweise und der Einführung demokratischer Planung.

Eine Debatte gab es erneut (wie bereits beim letzten PV zur CO2-Bepreisung) zur Frage, ob es ausreicht, das Angebot des ÖPNVs zu erweitern und Ordnungsmaßnahmen zu ergreifen, oder ob die Nutzung von Autos in der Innenstadt verteuert werden muss durch Parkraumbewirtschaftung und andere Maßnahmen, um marktwirtschaftlich ein anderes Verhalten zu erzwingen. Letzteres würde aus Sicht der AKL aber vor allem Menschen aus der Arbeiter*innenklasse treffen, Reiche könnten sich weiter leisten, ihre Autos in die Städte zu fahren (Umweltverbände sagen zudem, dass solche marktwirtschaftlichen Steuerungen viel zu langsam und viel zu wenig Wirkung erzeugen).

Bernd Riexinger hatte vorgeschlagen, das Konzept der LINKEN als „linken Green New Deal“ zu betiteln. Lucy sprach sich aus verschiedenen Gründen dagegen aus. Für viele klingt Deal nach einem Deal mit den Konzernen und nicht nach dem nötigen Kampf gegen Konzerninteressen. Bernd Riexinger verwies dagegen darauf, dass der Begriff international von Linken geprägt sei, zeigte sich aber offen für andere Begriffe.

Als Lesehinweis empfahl Lucy das Buch „Mit dem Elektroauto in die Sackgasse“ von Winfried Wolf (erschienen 2019 bei Promedia) und die Durchführung von Veranstaltungen mit ihm zum Thema alternative Verkehrspolitik. Winfried Wolf spricht sich darin sehr deutlich gegen E-Autos als angeblich grüne Alternative aus.

Geschlechterparität im Bundestag

Als zweiten Schwerpunkt unter Aktuelles diskutierte der PV einen Gesetzentwurf der Bundestagsfraktion zur Umsetzung der LINKE-Forderung nach Geschlechterparität im Bundestag. Dazu nahm Conny Möhring, frauenpolitische Sprecherin der Bundestagsfraktion, an der Sitzung teil und stellte den Entwurf vor. Während die Quotierung der Kandidat*innen auf den Listen und in Wahlkreisen der LINKEN unstrittig ist, ging es darum, ob die Partei einen Gesetzentwurf einbringen soll, der alle Parteien dazu verpflichtet, Wahllisten und Kandidat*innen für Direktmandate in den Wahlkreisen geschlechterparitätisch aufzustellen. Die gesetzliche Verpflichtung zur paritätischen Aufstellung der Wahllisten ist noch einfach vorstellbar, komplizierter wird es bei den Wahlkreisen. Der Vorschlag von Conny Möhring und anderen ist, die Umsetzung als paritätische Doppelbesetzung der Wahlkreise zu ermöglichen, indem die heutige Anzahl von Wahlkreisen halbiert und dann doppelt mit Mann und Frau besetzt wird. Die Alternative zur Einführung der vollen Geschlechterparität wäre die Abschaffung der Wahlkreise und die Umsetzung der Wahl über ein reines Verhältniswahlrecht. Diese Vorschläge wurden konstruktiv und kontrovers diskutiert.

Das Stimmungsbild zum Gesetzentwurf ging dann auch dementsprechend ungefähr 50:50 aus.

Eine Entscheidung darüber wurde auf die nächste PV-Sitzung am 23./24.11. verschoben. Positiv wurde festgehalten, dass Conny Möhring diese Diskussion im PV sucht, da ja sonst nicht selten die Fraktion Entscheidungen trifft und die Partei vor vollendete Tatsachen stellt.

Strategiekonferenz 2020

Am 29.2. bis 1.3.2020 soll eine bundesweite Strategiekonferenz der LINKEN im Kulturbahnhof im schönen Kassel stattfinden, die offen für alle Mitglieder ist. Dort sollen keine Beschlüsse gefasst werden, aber Räume in Plena und workshops geöffnet werden, um über die weitere Strategie der LINKEN zu sprechen. Die Konferenz soll sich vor allem an Mitglieder und Aktive richten und zudem an Akteur*innen aus dem Umfeld der Partei.

Ilja Seifert brachte es gut auf den Punkt, als er sagte, es sei nicht zentral, dass dort hundert Journalist*innen rumspringen, um sich keine Agenda von außen aufzwingen zu lassen.

Was genau diskutiert werden soll, wird Gegenstand von Debatten und auch Kontroversen sein. Ein Mitglied des geschäftsführenden PVs meinte, es solle dort kein Best-of der Kontroversen der letzten Jahre geben, sondern das diskutiert werden, was gesellschaftlich nötig sei. Es ist natürlich richtig, dass die Strategiekonferenz neue (und alte) Fragen wie Zukunft der Autoindustrie, Klimapolitik, internationale Handelsbeziehungen- und kriege, Aussichten auf eine Rezession diskutieren muss, aber zugleich müssen auch die Kontroversen der letzten Jahre ihren Platz haben. Denn diese sind ja nicht losgelöst von den gesellschaftlich notwendigen und aktuellen Fragen.

Mitglieder der Partei sind aufgerufen, bis zum 10.1.2020 eigene Strategiebeiträge von bis zu 10.000 Zeichen einzureichen. Diese könnt ihr hier einreichen: . Die Beiträge sollen online und eine Auswahl in einem Printreader veröffentlicht werden. AKL-Mitglieder werden sich mit Beiträgen zu Wort melden.

Der PV wählte eine Vorbereitungsgruppe, der folgende Mitglieder aus dem PV angehören: Jörg Schindler, Harald Wolf, Lucy Redler (Vertretung Thies Gleiss), Ralf Krämer, Jan van Aken. Dazu kommen Genoss*innen aus dem Bundesausschuss, aus Parteiströmungen, Jugendverband, SDS und der Bundesgeschäftsstelle.

Vorschläge zur Strategiekonferenz könnt ihr gern an die Vorbereitungsgruppe oder auch direkt an Lucy richten. Die Vorbereitungsgruppe wird nun noch erweitert durch Genoss*innen aus Landesverbänden (also meldet euch schnell über euren Landesverband, wenn ihr mitmachen wollt.)

Weitere Themen unter Aktuelles waren die Massenproteste in Chile, Katalonien, Libanon und Irak, die Parteikampagnen zu Pflege und Mieten, die geplanten Studierendenstreiks ab dem 23.11., die Aufklärung des Lübke-Mordes und die Rolle des Verfassungsschutzes.

Neue Forderung: 1200 Euro Mindestsicherung

Angesichts der gestiegenen Lebenshaltungskosten lagen vier Vorschläge zur Erhöhung der sanktionsfreien Mindestsicherungsforderung der LINKEN (derzeit 1050 Euro) vor. Von diesen wurden in der Debatte im Wesentlichen drei diskutiert:

Erstens: Die BAG Hartz IV, bei der Sitzung durch zwei Genoss*innen vertreten, stellte ihr Konzept von einer sofortigen Erhöhung der Mindestsicherung auf 1200 Euro vor.

Zweitens: Der Gegenvorschlag kam von Ralf Krämer, der eine Erhöhung von 1150 Euro errechnet hatte.

Drittens: Der dritte Vorschlag war, die Forderung auf 1200 Euro zum nächsten Bundestagswahlkampf zu erhöhen.

Die Debatte drehte sich dann weniger um die Differenz von 50 Euro, sondern um die Frage, nach welchen Gesichtspunkten wir Forderungen aufstellen. Während die BAG Hartz IV, Lucy und andere Parteilinke politisch dafür plädierten, die objektive Notwendigkeit zum Ausgangspunkt zu nehmen und mit der Forderung nach 1200 ein Signal an Bündnispartner*innen in Erwerbsloseninitiativen und Sozialverbänden auszusenden und eine überfällige Debatte in den Gewerkschaften anzustoßen, argumentierten andere entweder stärker mathematisch oder damit, dass für die Durchsetzung von 1200 Euro die starken Bündnispartner in den Gewerkschaften fehlen und 1200 Euro gegenüber Lohnabhängigen schwerer vermittelbar seien. Es stimmt, dass die Gewerkschaften diese Forderung nicht aufstellen, dasselbe gilt jedoch auch für die Forderung nach 1050 und 1150 Euro. Es stimmt auch, dass manche prekär Beschäftigte eine Forderung nach 1050, 1150 oder 1200 Mindestsicherung nicht nachvollziehen können, doch das spricht wohl eher für Lohnerhöhungen statt einer niedrigeren Mindestsicherungsforderung. Lucy sprach sich dafür aus, flankierende Forderungen nach einem Mindestlohn von 13 Euro aufzustellen.

Die Abstimmung ergab eine Mehrheit für die Forderung nach 1200 Euro, in der Stichwahl setzte sich dann der moderatere Vorschlag durch, diese Forderung zum nächsten Bundestagswahlkampf statt unmittelbar aufzustellen.

Wenn euch die Vorlage der vier Varianten interessiert, schicken Thies oder Lucy euch diese gern zu.

Wahlerfolg für „Landesvater Bodo Ramelow“

Die Auswertung der Thüringenwahl kam viel zu kurz. Bodo Ramelow und Susanne Hennig-Wellsow konnten Montag aufgrund vieler Termine erst ab 11:30 an der Sitzung teilnehmen und eilten um 12 Uhr mit den Parteivorsitzenden zur Bundespressekonferenz.

Landtag Erfurt 2011-05-18 mnII (55).JPG

Nach minutenlangen Standing Ovations für Bodo Ramelow für die Presse, an denen sich die Autorin nicht beteiligte, gab es hochlobende Beiträge der Parteivorsitzenden und dann Inputs von Susanne Hennig- Wellsow und Bodo Ramelow. Bodo Ramelow erklärte die Arbeitsteilung so, dass er alle drei Parteien vertrete und Susanne Hennig-Wellsow die Partei und diese Arbeitsteilung beim Arbeitskampf der Uniklinik Jena gut geklappt habe. Susanne Hennig-Wellsow lobte, dass Bodo Ramelow als „Landesvater“ überall respektiert sei. Sie verteidigte, dass es Wahlplakate mit Bodo Ramelow ohne Logo der LINKEN gab.

Leider werden diese Sichtweisen aus Sicht der Autorin von wenigen kritisch hinterfragt.

Bodo Ramelow verwies darauf, dass er Ministerpräsident bleibe und auch bereit sei, sich mit einfacher Mehrheit im dritten Wahlgang wählen zu lassen.

Natürlich sind 31 Prozent für DIE LINKE in Thüringen ein gutes Ergebnis. Es stellt sich jedoch zum einen die Frage, warum die AfD so stark werden konnte und ob DIE LINKE mit diesen 31 Prozent linke Politik betreiben wird und diese nutzt, die gesellschaftlichen Verhältnisse zu ändern oder nicht.

An Diskussionszeit verblieben genau 10 Minuten und es gab nur zwei Beiträge, unter anderem von Lucy, die neben den bekannten Differenzen zur Regierungsbeteiligung und einer Warnung vor Bündnissen mit der CDU fragte, ob DIE LINKE Thüringen die 31 Prozent denn nun gesellschaftlich für die Mobilisierung zur Umsetzung eines Gesetzes zu Mietabsenkung, Mietendeckel und einem Gesetz für bedarfsgerechte Personalbemessung im Krankenhaus nutzen werde. Bodo Ramelow antwortete, ein Mietendeckel sei Symbolik und die Regierung habe gerade erst 6000 Wohnungen zurückgekauft.

Das erinnerte die Autorin an das Motto des Berliner Bürgermeisters Müller statt auf Enteignungen auf „Kaufen, Bauen, Deckeln“ zu setzen – nur ohne Deckeln.

Die AKL bleibt gespannt, ob die 31 Prozent für wirklich linke Politik genutzt werden, oder ob es so weitergeht wie bisher mit sozialdemokratischer Politik. Die AKL spricht sich für eine Minderheitsregierung allein der LINKEN in Thüringen mit sozialistischer Politik, gestützt auf gewerkschaftliche Kämpfe und soziale Bewegungen, aus. Vier Beiträge aus dem Kreis der AKL zu Thüringen (vom Bundessprecher Thies Gleiss und von den AKL- Mitgliedern Claus Ludwig und Sebastian Rave) findet ihr hier:

Weitere Beschlüsse

Außerdem wurde (neben weiteren Vorlagen) das Folgende beschlossen:

• Die Unterstützung der Proteste gegen den AfD-Bundesparteitag am 30.11./1.12. in Braunschweig und der bundesweiten Demonstration in Solidarität mit Rojava am 2.11. in Berlin

• eine finanzielle Unterstützung von Aufstehen gegen Rassismus, der Roten Ruhr-Akademie in Essen, des politischen Aschermittwochs in Bayern, dem Gedenken an 100 Jahre Kapp-Putsch des Kreisverbands Wesel

• politische Vorlagen zur Abschaffung des Solidaritätszuschlags, eine Rekommunalisierungskampagne

• die Durchführung des Jahresauftakts am 10.1.2020 ab 18h im „refugio“ in Berlin-Neukölln und der Gremienberatung mit dem Themenschwerpunkt 15 Jahre Agenda 2010 am 11.1.2020

Darüber hinaus wurden die Berichte zur Mitgliederentwicklung im dritten Quartal, der Finanzbericht und der Genderbericht 2018 zur Kenntnis genommen (und leider aus Zeitgründen nicht diskutiert, wir empfehlen die Lektüre) und die Berichte aus dem Jugend- und Studierendenverband entgegen genommen. Für Letztere soll in Zukunft mehr Zeit auch zur Diskussion eingeplant werden.

Berlin, 30.10.2019, Lucy Redler (und schöne Grüße von Thies Gleiss)

akl - Antikapitalistische Linke


Grafikquelle           :

Oben        —       Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37


Unten            —        Susanne Hennig, 18. Mai 2011

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Sind nun alle Bodo ?

Erstellt von DL-Redaktion am 5. November 2019

Für eine LINKE-Alleinregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–11.jpg

Quelle       :      AKL

Von Claus Ludwig.

Es ist gut, dass die LINKE zur stärksten Partei in Thüringen geworden ist und bei gestiegener Wahlbeteiligung in absoluten Zahlen und prozentual zulegen konnte. Doch Grund zum Jubeln ist dieses Ergebnis nicht. Zwei Wochen nach dem Doppelmord von Halle haben die Stichwortgeber der Nazi-Terroristen unter dem offenen Rechtsextremisten Björn Höcke ihre Stimmen mehr als verdoppeln können. Jetzt werden Rufe laut, die LINKE solle mit der CDU koalieren oder die FDP zu R2G dazuholen. Die LINKE sollte  dies ablehnen.

Wie in Brandenburg und Sachsen hat es bei der Landtagswahl in Thüringen eine scharfe Polarisierung anhand der Frage “für oder gegen die AfD” gegeben. Viele dieser Wähler*innen haben ihre Stimme der stärksten Anti-AfD-Kraft und damit der Partei des Ministerpräsidenten Bodo Ramelow gegeben. In Sachsen profitierte davon die CDU, in Brandenburg die SPD.

Die LINKE gilt – nicht zu Unrecht – im Osten als Teil des Establishments. Die Regierungsbeteiligung hat die LINKE verändert, nicht aber die Verhältnisse. Auch unter Bodo Ramelow gab es keinen Politikwechsel, sondern überwiegend ein “weiter so”.

Es ist rechnerisch nicht möglich, eine Regierung ohne LINKE oder AfD in Thüringen zu bilden. Eine Regierung mit der CDU würde, gerade angesichts der nahenden Wirtschaftskrise, dazu führen, dass die LINKE die Mitverantwortung für eine Politik übernimmt, die gegen die arbeitenden Menschen gerichtet ist. Das würde der AfD die Möglichkeit eröffnen, noch stärker zu werden. Das gleiche gilt, wenn die LINKE mit SPD, Grünen weiter regiert und sich die FDP als neoliberale Laus in den Pelz holt.

DIE LINKE hat 31% der Wähler*innen für sich mobilisiert. Was macht sie daraus? Wie baut sie auf der Grundlage eine starke antirassistische Bewegung auf, um die AfD zu bekämpfen? Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, mit klaren Eckpunkten und dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren (siehe unten).

In den nächsten Wochen wird viel von Verantwortung die Rede sein. Die wahre Verantwortung der LINKEN ist es, eine gesellschaftliche Alternative zu Sozialabbau, Niedriglöhnen, Armutsrenten und Rassismus zu formulieren und dafür auf allen Ebenen zu kämpfen – auf der Straße, im Parlament und – bei 31 Prozent Wähler*innen – auch in der Regierung. Das geht nicht mit den Establishment-Parteien von CDU, FDP, GRÜNEN und SPD, das geht nur mit einer linken Alleinregierung. Wenn die LINKE klare Beschlussvorlagen im Interesse der arbeitenden Menschen in den Landtag einbringt, müssen die etablierten Parteien Farbe bekennen, ob sie mit der AfD gegen die LINKE opponieren oder deren Anträge passieren lassen.

akl - Antikapitalistische Linke

Grafikquelle    :           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 5. November 2019

Lebensstile von Politikern

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Robert Misik

Normal musst du sein! Dürfen linke Politiker Porsche fahren oder Brioni-Anzüge tragen? Wann immer solche Lebensstilfragen aufpoppen, geraten Argumente durcheinander.

Eine Freundin von mir vertritt die Ansicht, die Mentalitätsunterschiede zwischen Deutschen und Österreichern träten besonders plakativ in zwei Liedern zutage: in dem Song „Ruaf mi net an“ des verstorbenen Wiener Liedermachers Georg Danzer und in „Zu spät“ von den Ärzten.

Beide haben dasselbe Thema, nämlich verschmähte Liebe. Hauptfigur ist jeweils ein junger Mann, der von seiner Freundin verlassen wurde, weil sie sich einen klügeren, reicheren, prestigeträchtigeren Partner gesucht hat. Doch während in der deutschen Version die Ich-Figur in gigantomanische Fantasien verfällt, versinkt die österreichische Figur in weinerlichem Selbstmitleid.

Bei den Ärzten heißt es: „Doch eines Tages werd’ ich mich rächen / Ich werd’ die Herzen aller Mädchen brechen / Dann bin ich ein Star, der in der Zeitung steht / Und dann tut es dir leid, doch dann ist es zu spät.“

Bei Danzer dagegen tut der trauernde Twentysomething gar nichts, nimmt Tabletten, kann nicht mehr schlafen und verwünscht den neuen Liebhaber, der die Ex in Restaurants einlädt und ein teures Auto fährt. „I waß du hasd jetzt an Freund mid an Porsche / Geh sag ihm er soll do in Oasch geh.“ Allein dafür, dass er „Porsche“ auf „Oasch geh“ („in den Arsch gehen“) reimte, gebührt Danzer der Literaturnobelpreis. Der Porsche steht hier für Protzerei, für das Neureiche, auch ein bisschen für das Ludenhafte. Porsche repräsentiert auch ein wenig das Unse­riöse, Krösushafte.

Wir führen ja bei uns in Österreich meist ähnliche Debatten wie ihr in Deutschland, nur noch ein bisschen dümmer. Deswegen hatte die österreichische Sozialdemokratie zuletzt ihre „Porsche“-Debatte. Die SPÖ ist ja bei den vergangenen Parlamentswahlen auf 21 Prozent abgestürzt, Tags darauf trat der Bundesgeschäftsführer zurück und holte seine Habseligkeiten mit seinem schicken Oldtimer-Porsche aus der Parteizentrale. Als sich dann noch herausstellte, dass auch der Tiroler Landesvorsitzende mit einem modernen Porsche-Modell durch die Gegend kurvt, waren die „Luxus-Sozis“ in den Schlagzeilen und buchstäblich „im Oasch“.

Entkontextualisierte Debatte

Wann immer solche politischen Lebensstilfragen aufpoppen, geraten die Argumente durcheinander. Die einen meinen, linke Politiker müssten auch durch ihren Lebensstil ausdrücken, dass sie auf der Seite der einfachen Leute stehen, und dafür sind Villen, Luxuskarossen und teure Uhren, Brioni-Anzüge und Zigarren Gift. Die anderen meinen, dass diese Leute sich das Zeug ja erstens von ihrem verdienten Geld gekauft haben, sie daher auch niemandem Rechenschaft schuldig seien, dass es zweitens darum gehe, ob sie gute Politik machen, nicht ob sie in Sack und Asche herumliefen, und dass die Linken, drittens, doch für Wohlstand und Luxus für alle eintreten, nicht für Armut für jeden.

Quelle      :          TAZ        >>>>>         weiterlesen


Grafikquellen      :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Feuilleton, P. DIE LINKE, Überregional, Umwelt | Keine Kommentare »

LINKE vs. Höcke-AfD

Erstellt von DL-Redaktion am 4. November 2019

Analyse der Thüringer Landtagswahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle       :     AKL   

von Claus Ludwig, Köln

Der Aufstieg der AfD ist alarmierend und führt viele an die Wahlurne. Auch wenn es in Thüringen eine klare Mehrheit gegen die AfD gibt und nur 15 Prozent aller Wahlberechtigten (inkl. der Nichtwähler*innen) die rechtsextreme AfD unter Björn Höcke gewählt haben: Die politische Polarisierung war selten so deutlich wie bei dieser Wahl. Von der Stimmung gegen rechts hat die LINKE profitiert, die ihre Stimmen von 265.000 auf 344.000 (Zahlen auf Tausend gerundet) steigern konnte. Doch Jubeln und Freudenfeiern seitens der LINKEN sind fehl am Platz.

Die AfD konnte ihre Stimmen von 100.000 auf 259.000 um den Faktor 2,6 vermehren. Die AfD ist die Partei der erwerbstätigen Männer im mittleren Alter, liegt bei den 18-24jährigen knapp vor der LINKEN und bei den Erstwähler*innen knapp hinter ihr. Die stark von Senior*innen geprägte Altersstruktur des Landes ist einer der Faktoren, welche einen Durchmarsch der AfD verhindert haben.

Ein anderer Faktor ist das unterschiedliche Wahlverhalten von Frauen und Männern. Frauen haben in stärkerem Maße die LINKE gewählt. Das wird auch an der beruflichen Aufteilung deutlich: Bei der stärker weiblich geprägten Gruppe der Angestellten dominiert die LINKE mit 34 Prozent gegenüber 19 Prozent der AfD, bei Arbeiter*innen liegen beide nah beieinander (31 und 29 Prozent). Bei den Selbstständigen liegt die AfD vorn. Gewerkschaftsmitglieder haben zu 36,6 die LINKE und zu 22,6 Prozent die AfD gewählt, bei den Gewerkschaftsfrauen waren es 40,2 zu 16,2 Prozent.

Die AfD hat mit 34 Prozent eine besonders hohe Unterstützung unter denjenigen, die ihre eigene wirtschaftliche Situation als schlecht ansehen. Allerdings waren  nur 13 Prozent der Befragten der Meinung, die Lebensverhältnisse hätten sich in ihrem direkten Umfeld verschlechtert, für 31 Prozent sind sie gleich geblieben, 34 Prozent sehen sogar Verbesserungen. Bei den “Sorgen” dominierten die Angst vor “politischen Anschlägen” (80 Prozent), dem Klimawandel (65 Prozent), Kriminalität und dem Islam (54 Prozent). Sorgen um den eigenen Lebensstandard machen sich 31 Prozent.

Bei der Wahl der AfD gibt es Elemente von Protestwahl, aufgrund zuvor erlebter sozialer Ausgrenzung und der Benachteiligung des Ostens. Diese waren jedoch bei dieser Wahl nicht entscheidend. Die AfD wird zwar von vielen gewählt, die sich vernachlässigt oder abgehängt fühlen. Dies ist allerdings nicht deckungsgleich mit einem bereits erfolgten sozialen Abstieg. Es handelt sich auch um eine Zunahme verfestigter rassistischer und rechtsextremer Einstellungen, auch wurzelnd in der massiven Intervention von Nazi-Organisationen in den 1990er Jahren und der Förderung von Rassismus durch staatliche Institutionen und die Debatten der bürgerlichen Parteien. All dies wurde und wird begünstigt durch das Fehler einer wirklich klaren linken Alternative und starken Gewerkschaften.

Björn Höcke ist auch unter AfD-Wähler*innen umstritten – was diese nicht daran hindert, ihn zu wählen. 82 Prozent aller Wähler*innen sehen die AfD zu nah an rechtsextremen Positionen. Aber 47 Prozent der Befragten finden es gut, dass sie “die Zuwanderung begrenzen” will und 39 Prozent halten sie für eine “demokratische Partei wie die anderen Parteien auch”. 44 Prozent der AfD-Wähler*innen sehen Höcke zu nah am Rechtextremismus, aber 77 Prozent “finden es gut, dass er kein Blatt vor den Mund” nimmt.

Bei der AfD-Unterstützer*innen handelt es sich nicht überwiegend um harte Faschist*innen, die bereit zur Aktion sind. Doch die Akzeptanz völkisch-faschistischer Sprache und Propaganda ist hoch. Das Potenzial, von einer Phase überwiegend parlamentarischer Agitation zu Straßenaktionen überzugehen und die Landes-AfD zu einer aktiven faschistischen Kraft wie die NPD zu machen, wächst.

Die LINKE hat es mit ihrer Fokussierung auf den Ministerpräsidenten Bodo Ramelow geschafft, die Rolle von SPD und Grünen gleich mit zu übernehmen. Anders als in Sachsen und Brandenburg konnte sie ihre starke Position bei den über 60jährigen halten. Gleichzeitig wurde sie zur Gegenspielerin der AfD, legte in größeren Städten wie Jena, Erfurt, Weimar, Suhl und Gera sowie unter Erstwähler*innen, bei Menschen mit höherer Bildung und bei Frauen im erwerbstätigen Alter besonders stark zu. Dies sind Schichten, die in anderen Bundesländern vor allem die Grünen wählten, auch wegen ihrer scheinbar konsequenten antirassistischen Positionierung. Dieses Ergebnis ist vor allem der Bündnis-Konstellation auf Landesebene geschuldet. Dazu beigetragen hat allerdings auch die glaubhafte Positionierung von Bodo Ramelow und vieler bekannter LINKER, die sich an Blockaden gegen Nazi-Aufmärsche beteiligt haben oder im NSU-Untersuchungsausschuss aktiv waren.

Der Verlust der Regierungsmehrheit für R2G bei Stärkung der LINKEN ist ein Hinweis darauf, dass die Lager-Arithmetik der Regierungsbefürworter*innen in der LINKEN nicht stimmt. Es wird keine starke LINKE neben einer stabilisierten SPD und dynamischen Grünen geben. Wenn die LINKE erfolgreich ist, geht das auf Kosten der SPD und der Grünen. Der Aufschwung der Grünen ist hingegen mit einer Begrenzung der LINKEN verbunden.

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -96.jpg

Solange nicht auf der Basis verstärkter Klassenkämpfe die Gesellschaft in Bewegung gerät und weitere Schichten von bisherigen Nicht-Wähler*innen erreichbar werden, bleiben die Verschiebungen bei den Wahlen im Großen und Ganzen innerhalb der Lager. Die Grünen profitieren vom Niedergang der SPD, die LINKE vom Schwächeln der Grünen. Die CDU verliert an die AfD. Ausnahmen bestätigen die Regel: In Thüringen gab es eine bedeutende, aber nicht entscheidende Wanderung von 23.000 CDU-Wähler*innen zur LINKEN. Die CDU-Spitze hatte versucht, LINKE und AfD gleichermaßen auszugrenzen, dies wurde von deren Wähler*innenschaft mehrheitlich abgelehnt.

Die in Berlin regierenden Parteien kommen nicht aus ihrer Krise heraus, und das am Vorabend des wirtschaftlichen Abschwungs. Die Meinung der meisten Thüringer*innen über die SPD ist eindeutig: “nur mit sich, ihrem Personal und Posten beschäftigt”.

Die Zahlen stammen aus: “Die Wahl zum 7. Thüringer Landtag am 27. Oktober 2019, WAHLNACHTBERICHT UND ERSTER KOMMENTAR”, Horst Kahrs und Benjamin-Immanuell Hoff, Rosa-Luxemburg-Stiftung sowie von Infratest Dimap im Auftrag der ARD-Tagesschau.

akl - Antikapitalistische Linke


Grafikquelle        :

Oben           —         Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37


Unten            —         Landtagswahl Thüringen am 14. September 2014

Abgelegt unter L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Katarina Witt – Interview

Erstellt von DL-Redaktion am 3. November 2019

„Man schweigt den Schmerz weg“

File:Bundesarchiv Bild 183-1988-0911-030, Katarina Witt, Jutta Müller.jpg

Von Anja Maier und Katrin Gottschalk

Die Eiskunstläuferin Katarina Witt war ein Weltstar, der in der DDR lebte – nicht alle haben sie dafür geliebt. Doch auch ihr und ihrer Familie kam 1989 das eigene Land abhanden. Ein Gespräch über hartes Training, Helden des Ostens und Männer am Herd.

taz am wochenende: Frau Witt, wir haben hier Fotos aus Ihrer Zeit in Karl-Marx-Stadt.

Katarina Witt: Ach, guck mal an. Die Frau Müller und ich in der Trainingshalle in Chemnitz! Oh Gott, wie toll, da müsste ich ungefähr dreizehn gewesen sein.

Wen sehen Sie auf diesen Bildern, wer waren Sie damals?

Das ist ein anderes Mädchen als das, an das ich mich erinnere. Kurze Haare, sehr burschikos, eher wie ein Junge. Und ich gucke da ziemlich ernst, Frau Müller sagt mir offenbar gerade, wo’s langgeht. Ich höre zu und hab ein bisschen Schiss.

Sie war ab 1977 Ihre Trainerin, hatte eine fast soldatische Ausstrahlung. Wie streng war diese Frau Müller tatsächlich?

Frau Müller war noch strenger, als man sich das ausmalen möchte. (lacht) Sie wollte das Beste von uns, das ist nun mal der Trainerjob. Da musste sie auch manchmal extrem sein, ohne dass man das gleich persönlich nimmt und sofort der Rechtsanwalt angerufen wird, wie das heute läuft. Der Sport war schließlich auch für mich eine ernste Sache. Wenn es nicht lief, hat man sich das sehr zu Herzen genommen. Ein Sportler muss im Grunde jeden Tag über seine Schmerzgrenze hinausgehen können, auch langweilige Sachen geduldig wiederholen.

Jutta Müller ist eine starke Frauenfigur in Ihrem Leben.

Absolut. Sie hat mich geprägt, ich habe lange mehr Zeit mit ihr als mit meiner Mutti verbracht. Wenn wir ins Ausland gereist sind, da hat sie mir auch mal ’ne Stulle geschmiert oder ein Würstchen unterm Wasserhahn warm gemacht. Wir haben ins Ausland Schwarzbrot und Salami mitgenommen, weil wir kaum Westgeld hatten, um uns was zu kaufen.

Gibt es heute junge Frauen, die Sie fördern und fordern?

Na ja, ich fordere vor allem meine Umwelt heraus. (lacht) Aber klar, ich treffe oft Frauen, denen ich ein Vorbild war, für die ich ein anderes Bild von der DDR rübergebracht habe: nicht immer so trist, wie man uns darstellen wollte. Einige erzählen mir auch, sie seien nach mir benannt worden.

Sind Sie eine Heldin?

Überhaupt nicht. Helden sind andere. Ich war eine Leistungssportlerin und habe da meine Frau gestanden, auch unter immensem Druck. Wir haben Leistungen geliefert, aber wir waren keine Helden, haben uns nicht aufgebäumt gegen etwas. Helden sind für mich die Leute, die 1989 auf die Straße gegangen sind. Die haben Mut gezeigt, Rückgrat. Ich hatte im Sport dagegen das, was ich machen wollte.

Wie kommt es eigentlich, dass es heute in der gesamtdeutschen Erzählung so wenige Heldinnen und Helden aus dem Osten gibt?

Ich bemerke, dass es da noch immer eine Trennung gibt. Als ich zum Beispiel nach dem Tod von Sigmund Jähn, dem ersten Deutschen im All aus der DDR, ein älteres Foto von uns beiden auf Instagram geteilt habe, kamen aus dem Osten diese Reaktionen: einer von uns, einer unserer Helden, einer von unserer Seite. Diese Reaktionen bekomme ich zu meiner Person auch. Auch mein Leben hat vor 89 stattgefunden und nach 89. Klar haben wir Nena und Modern Talking gehört – aber „bei uns“ sage ich, wenn es mit meinem ehemaligen Land zu tun hat. Auch wenn ich dies nicht wieder zurückhaben will. Jetzt gibt es andere Helden, für viele wird das gerade Greta Thunberg.

Als Sigmund Jähn verstorben war, entwickelte sich eine Debatte, ob jemand, der Generalmajor der DDR gewesen ist, zum Helden taugt. Wie sehen Sie das?

Ich finde es richtig, dass diese Diskussionen geführt werden. Aber das ist ja so, als würde man den Sportlern aus der DDR sagen: Ihr könnt keine Helden gewesen sein, denn ihr habt ja ’ne Diktatur repräsentiert. Sigmund Jähn und auch ich sind in der DDR aufgewachsen und zur Schule gegangen. Jähn wurde es dort ermöglicht, als erster Deutscher ins All zu fliegen. Was will man ihm da vorwerfen?

Was wird Ihnen denn 2019 noch vorgeworfen? Sie galten lange als SED-Profiteurin.

Eigentlich nüscht. (lacht) Klar, es gab’ne Zeit, wo ich sehr polarisiert habe. Letztendlich sagen eigentlich alle, ob Ost oder West, dass ich auf eine gute Weise meine Meinung, meine Haltung beibehalten habe. Ich habe meinem Land und dem Sportsystem alles zu verdanken, meiner Trainerin, meinen Eltern. Trotzdem bin ich nicht mit geschlossenen Augen durch die Welt gegangen, ich habe gesehen, dass der Sport der Bereich war, in dem Menschen wie ich ihre Träume verwirklichen konnten. In anderen Bereichen ging das nicht, und das war natürlich schlimm für die Betroffenen. Anderen wieder wurde vorgeschrieben, was sie lernen, studieren sollen.

Bundesarchiv Bild 183-1984-0831-421, Berlin, Sportlerball im Palast der Republik.jpg

Die Älteren erinnern sich an Sie als die Gold-Kati aus dem Osten, Jüngere haben Sie eher als Fernsehpromi auf dem Schirm. Als wer möchten Sie denn erinnert werden?

Ich will nicht als Fernsehpromi gesehen werden. Was ist das denn? Nüscht. Ich finde überhaupt dieses Promisein sehr fragwürdig. Ich komme vom Sport, und da habe ich eine Lebensleistung abgeliefert und dort fast ein Jahrzehnt die Weltspitze mitbestimmt. Das ist es, woran man sich erinnern soll.

Sie sind bekannt dafür, Ihr Privatleben sehr gut zu schützen. Kürzlich aber haben Sie doch eine sehr persönliche Geschichte erzählt. Für das Por­trätbuch „Ostfrauen verändern die Republik“ haben Sie geschildert, wie es Ihren Eltern nach der Wende gegangen ist.

Hören Sie auf, da fange ich gleich wieder an zu heulen.

Ihr Vater ist damals arbeitslos geworden, und Sie haben Ihre Eltern noch jahrelang unterstützt. Eine sehr ostdeutsche Erfahrung. Wie geht man als Kind damit um?

Ich war damals 23 Jahre alt. Meine Eltern, die heute über achtzig sind, waren damals also genauso alt wie ich heute. Die haben immer versucht, Probleme von uns Kindern fernzuhalten. Dieser Umbruch Anfang der Neunziger, der Schmerz, der damit einherging, die Verletzungen, das bricht ja jetzt erst auf. Unsere Eltern fangen jetzt erst an, offen zu reden, und das ist für uns, ihre Kinder, neu.

Wie war das damals in der Familie Witt?

Als die Mauer fiel, hatten meine Eltern schon ein langes Arbeitsleben hinter sich, die Kriegskindergeneration ist ja viel früher ins Berufsleben gestartet. Sie hatten erwachsene Kinder und die berechtigte Erwartung, jetzt ein Stück persönliche Freiheit gewinnen, die Früchte ihrer Arbeit ernten zu können. Also Anerkennung für ihre Arbeit, mehr persönliche Freiheiten, Erfahrungen weitergeben. Tatsächlich aber wurde ihnen gesagt: Wir haben eigentlich gar keinen Platz mehr für euch. Es ging da nicht nur um das Finanzielle, sondern auch um den verletzten Stolz, um diese Botschaft: Du bist überflüssig. Da wurde ihnen gesagt: Seid doch froh, ihr habt jetzt Freiheit, Demokratie. Aber was fängst du damit denn an, wenn gerade das gesamte Kartenhaus deines Lebens zusammenbricht und dich niemand an die Hand nimmt?

Was hätte denn damals geschehen müssen?

Es kam niemand und hat die Ostdeutschen an die Hand genommen. Unsere Kompetenzen waren nicht mehr gefragt. Die wenigsten waren ja Unternehmer, wir waren eher Macher, so haben wir das gelernt. Wir kamen aus einem Land, in dem – entschuldigen Sie den Ausdruck – aus Mist Bonbons gemacht wurde. Dinge wurden gelöst.

Aber 1990 kam dieses Prinzip an sein Ende.

Ja, so war das. Diese Generation musste nach dem Mauerfall um alles, alles kämpfen: ihre Rente, die Anerkennung der Abschlüsse und Studienzeiten, Frauenrechte, ihre Häuser und Wohnungen. Das ist das Problem heute: Diese Menschen fühlen sich zweitklassig behandelt. Sogar bei meiner Frau Müller habe ich das damals erlebt.

Was ist passiert?

Gala-Nacht des Sports 2013 Wien red carpet Hermann Kröll Theresa Breuer Katarina Witt.jpg

Man hat diese Weltklassetrainerin wirklich kaltgestellt. Die Rivalitäten zwischen dem ostdeutschen und dem westdeutschen Eislaufverband brachen voll auf. Wir waren nun mal die Erfolgreicheren in den zurückliegenden Jahren, wir hatten die Weltmeister, die Olympiasieger. Da hatte man schon dieses Gefühl: Ihr habt verloren, und wir sagen euch jetzt, wo’s langgeht. Selbst hier also, in diesem überschaubaren Bereich, hat man es nicht geschafft, die besten Erfahrungen aus beiden Systemen zusammenzuführen. Es gab eine große Arroganz, so eine herablassende Siegermentalität.

Haben Sie persönlich das auch zu spüren bekommen?

Quelle     :        TAZ          >>>>>         weiterlesen


Grafikquellen       :

Oben        —        Katarina Witt, Jutta Müller ADN-ZB Thieme 11.9.1988 Karl-Marx-Stadt: Eiskunstlauf.- Die zweimalige Olympiasiegerin Katarina Witt wurde bei einem Schaulaufen in ihrer Heimatstadt Karl-Marx-Stadt vom Leistungssport verabschiedet. In der mit nahezu 5.000 Eissportfreunden ausverkauften Sporthalle „VIII. Parlament“ wurde die 22jährige Schauspiel-Studentin noch einmal begeistert gefeiert. Bewegende Augenblicke zum Abschluß einer glanzvollen Sportlerlaufbahn zwischen Trainerin Jutta Müller und Katarina Witt.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-1988-0911-030 / CC-BY-SA 3.0


2. ) von Oben        —              Es folgt die historische Originalbeschreibung, die das Bundesarchiv aus dokumentarischen Gründen übernommen hat. Diese kann allerdings fehlerhaft, tendenziös, überholt oder politisch extrem sein. Berlin, Sportlerball im Palast der Republik ADN-ZB/Franke/31.8.84 Berlin: Sportlerball Beim Eintreffen zum Sportlerball im Palast der Republik: Erich Honecker, Generalsekretär des ZK der SED und Vorsitzender des Staatsrates der DDR; Dr. h.c. Margot Honecker, Minister für Volksbildung der DDR (2.v.l.); Willi Stoph, Mitglied des Poltibüros des ZK der SED und Vorsitzender des Ministerrates der DDR. L.: Bahn-Radsprinter Lutz Heßlich; 2.v.r.: Eiskunstlauf-Olympiasiegerin Katarina Witt. [Berlin.- Politiker und Sportler (u.a. Kati Witt) auf dem Weg zum Sportlerball im Palast der Republik, im Hintergrund Gebäude des Außenministeriums] Abgebildete Personen: Honecker, Erich: Staatsratsvorsitzender, Generalsekretär des ZK der SED, DDR (GND 118553399) Honecker, Margot: Ministerin für Volksbildung, SED, DDR (GND 122782933) Heßlich, Lutz: Radrennsportler, DDR Witt, Katarina: Eiskunstläuferin, SC Karl-Marx-Stadt, Olympiade 1984 und 1988, DDR (GND 11884508X) Stoph, Willi: Ministerpräsident, Staatsratsvorsitzender, Armeegeneral, SED, DDR

Abgelegt unter Feuilleton, Kultur, Mensch, Überregional | Keine Kommentare »

Linke sollte Kämpferisch sein

Erstellt von DL-Redaktion am 3. November 2019

Statt Sozialdemokratie 2.0

2019-10-27 Wahlabend Thüringen by Sandro Halank–53.jpg

Besser nicht so ?

Quelle       :       AKL 

Von von Sebastian RaveBremen

Die ernüchternden Wahlergebnisse in Brandenburg und Sachsen scheinen bei der LINKEN fast schon wieder vergessen zu sein. Nach dem Wahlerfolg von Bodo Ramelow in Thüringen und der ersten Regierungsbeteiligung im Westen in Bremen gehen kritische Stimmen im Knallen der Sektkorken unter. Dabei liegt gerade in diesen vermeintlichen Erfolgen eine Gefahr für DIE LINKE.

Es gibt nichts Grundlegendes, was die LINKE, die in Sachsen und Brandenburg verloren hat, von der LINKEN unterscheiden würde, die in Thüringen gewonnen hat. Alle drei Landesverbände stehen für die Hoffnung, als linker Teil eines “linken Lagers” in der Regierung eine graduelle Verbesserung der Verhältnisse erreichen zu können.

Tatsächlich sind die Regierungserfolge beispielsweise in Thüringen aber eher überschaubar. Der Verfassungsschutz blieb ebenso unangetastet wie die Schuldenbremse (wie in Bremen), ein Landesmindestlohn, der auch bei Aufträgen von Kommunen gilt, wurde nicht eingeführt. Dafür ist Thüringen heute das Land mit dem zweitgrößten Niedriglohnsektor (30%).

Das Scheitern des Projekts Sozialdemokratie 2.0 lässt sich deutlich daran festmachen, dass eines der Ziele des Koalitionsvertrags der scheidenden rot-rot-grünen Regierung lautete: „Der Kampf gegen alte und neue Nazis, gegen Rassismus und Antisemitismus, muss entschlossen fortgesetzt werden“. Bei allem Bemühen und der Teilnahme an Demonstrationen: Am Ende der Legislatur wurde das Ziel, Nazis und Rechtspopulist*innen wirksam zu bekämpfen, verfehlt. Und leider trägt auch DIE LINKE mit ihrer wirkungslosen sozialdemokratischen Politik einen Teil der Verantwortung dafür. Wenn die Menschen das Gefühl haben, trotz einer linken Regierung Bürger*innen zweiter Klasse zu bleiben und DIE LINKE Teil des Establishments ist, hat es eine rechte Opposition eben leicht.

Die ehemalige Sozialdemokratie ist nicht aus reiner Boshaftigkeit zur neoliberalen Agenda-2010-Partei geworden, sondern weil sie sich den Sachzwängen des globalisierten Kapitalismus gebeugt hat. Dieser ist mittlerweile in einer tiefen Krise, die Sachzwänge verschärfen sich sogar noch weiter – ein Kurswechsel bei der LINKEN weg von der Sachzwanglogik ist deshalb dringend nötig.

Die Partei muss sich endlich trauen, den Kapitalismus nicht nur in Programmen in Frage zu stellen. Sie muss sich in den Stadtteilen und Arbeitsplätzen verankern, indem sie eine konstruktive Rolle bei jeder kleinen und großen Gegenwehr spielt. Zum Beispiel wurde der Mietendeckel in Berlin vor dem Hintergrund einer monatelangen Debatte über Enteignung von Immobilienkonzernen als Zugeständnis an die Bewegung durchgesetzt. Wenn es auch in Bremen und Thüringen solche Verbesserungen geben soll, reicht es nicht, SPD und Grüne am Kabinettstisch mal darauf anzusprechen. Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren. Zu den Eckpunkten sollten gehören:  1. Nichtumsetzung der Schuldenbremse, 2. Bekämpfung der Niedriglöhne, 3. Stopp aller Abschiebungen, 4. Mietendeckel, Mietsenkung und Enteignung der Immobilienkonzerne, 5. Einführung eines Landesgesetzes zur bedarfsgerechten Personalbemessungen in den Krankenhäusern (Thüringen könnte hier Vorreiter werden!) 6. Bedarfsgerechter Haushalt, 7. Rückgängigmachen von Privatisierungen.

Wir gehen nicht davon aus, dass sich SPD und Grünen an einer Regierung mit einem solchen Programm beteiligen würden. Aber das wäre ein Brechen mit der Sachzwanglogik und würde die Frage nach einer gesellschaftlichen Alternative zum Kapitalismus konkret auf die Tagesordnung stellen.

akl - Antikapitalistische Linke


Grafikquelle         :       Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

30 Jahre Mauerfall

Erstellt von DL-Redaktion am 2. November 2019

Geistiges Kleingärtnertum

Von Stefan Reinecke

Non Stefan ReineckeDie westdeutsche Linke träumte von Revolutionen. Doch als 1989 eine vor ihrer Haustür geschah, war sie überfordert.

Wir kennen die Bilderschleifen, die jeden 9. November aufs Neue gezeigt werden. Wahnsinn-Rufe, knatternde Trabis, Genscher und der Jubel in der Prager Botschaft. Auch Bilder können Floskeln werden, die mehr verstecken als erhellen. Im Herbst 1989, sagen diese Bilder, waren die Deutschen begeistert.

Alle Deutschen? Die Stimmung im Westen war viel schwankender. Im September waren aus der DDR schon Zehntausende in den Westen gekommen. Es fehlten Wohnungen und Jobs. Laut einer Umfrage meinte fast die Hälfte der Westbürger, das Boot sei jetzt leider voll und die Ostler sollten bitte in Plauen und Güstrow bleiben.

Ein paar Wochen nach dem Mauerfall ventilierte Oskar Lafontaine, ob DDR-Bürger weiterhin ein Anrecht auf Sozialleistungen haben sollten. Damit fördere man ja deren Abwanderung. Der SPD-Chef wollte, zumindest für eine Weile, zwei Staatsbürgerschaften. Lafontaine wollte die DDR genau in dem Moment faktisch anerkennen, in dem die SED politisch und die DDR wirtschaftlich kollabierte.

Er spekulierte auf das Gefühl der Westler, von den Habenichtsen aus dem Osten überrannt zu werden. In seinen Reden erschien die Einheit eher als unvermeidliches Übel. Die Grünen rangen sich widerwillig im Frühjahr 1990 – noch nach der SED/PDS – dazu durch, anzuerkennen, dass die Zweistaatlichkeit Geschichte war.

Keine Hürde für Europa

Die Erklärungen von Sozialdemokraten und Grünen bezeugen, 30 Jahre später gelesen, Realitätsblindheit. Warum diese Irrtümer? Der Historiker Timothy Garton Ash hat die Unfähigkeit der SPD im Herbst 1989 mit der erstarrten Ostpolitik erklärt.

Die SPD war demnach auf die SED-Führung und die Politik kleiner Verbesserungen fixiert und nahm die Bürgerbewegung nur als Störung wahr. Die späte Ostpolitik zeigt in der Tat Wahrnehmungsblockaden einer Politik, die auf Verständigung mit den Macht­eliten einer Diktatur verengt war. Allerdings waren die Grünen eng mit der Bürgerbewegung verdrahtet – und hatten ähnliche blinde Flecken.

Die westdeutsche Linke versagte 1989 komplett: moralisch, analytisch und politisch. Moralisch gab es keine Rechtfertigung dafür, dem DDR-Volk, das sich gerade befreit hatte, vorzuschreiben, in welchem Staat es zu leben hatte. Warum sollte Selbstbestimmung in Tibet und der Westsahara gelten, aber nicht zwischen Rostock und Görlitz? Zudem hatte die DDR laut Grundgesetz-Artikel 23 misslicherweise das Recht, der Bundesrepublik beizutreten.

Politisch hechelte die Linke dem Geschehen hinterher. Kohl setzte zügig die Währungsunion um. Dazu gab es angesichts des Abwanderungsstroms von Ost nach West keine realistische Alternative. Doch Lafontaine war überzeugt, dass die Währungsunion ein Fiasko würde und Kohl, der Nationalist, von seinen haltlosen Versprechungen eingeholt würde. Auch die atemlose Kritik, dass die deutsche Vereinigung die europäische zerstören würde, war falsch. Kohl setzte die Einheit zusammen mit Paris, London, Moskau und Washington ins Werk. Die deutsche Einheit war keine Hürde für Europa – im Gegenteil.

Gegen den Kapitalismus

Nach dem 9. November zeigte sich das geistige Kleingärtnertum der politischen Linken. Sie war fasziniert von Revolten gegen Autokraten – in dem Moment, in dem eine Revolution vor ihrer Haustür passierte, war sie schnell irgendwie beleidigt. Eine Epoche ging zu Ende. Die radikale Linke nahm übel, weil die Ossis genau das wollten, was sie ablehnte: Parlamentarismus und Kapitalismus. Viele Sozialdemokraten und Grüne klammerten sich an ihre eingravierte Überzeugung, dass es zwei deutsche Staaten geben müsse, und mäkelten, dass Kohl wieder alles falsch mache. Aber Kassandra gewinnt keine Wahlen.

Warum dieses Versagen? Es wurzelte nicht in der Nähe zum SED-Regime, sondern tiefer. Es gab in der Linken zwar eine kleine Strömung – um Rudi Dutschke, Tilman Fichter und Peter Brandt – die die Einheit als linkes Projekt verstanden. Doch das Gros hielt das für einen bizarren Spleen.

Die meisten Linken verstanden die Teilung irgendwie als gerechte Strafe für die NS-Verbrechen. Das war historisch Unsinn: Die innerdeutsche Grenze war, wie jedes Schulkind wissen konnte, Resultat des Kalten Krieges. Aber unser Gefühl sagte etwas ­anderes. Wir waren, manche insgeheim, manche ­offen, froh, dass die Mauer die fatale Geschichte des deutschen Nationalstaates beendet hatte.

Bundeshauptstadt Bonn 04.jpg

Ich will die neue Kanzlerin werden. Mein Hab und Gut habe ich mitgebracht.

Und gab es dafür nicht auch solide, vernünftige, moralische Motive? Der Historiker Hans Mommsen hatte 1981 eine historische Einordnung des bundesrepublikanischen Selbstgefühls skizziert. Wie in Österreich gebe es in der Bundesrepublik das Bewusstsein, etwas Eigenes geworden zu sein. Der Bismarck’sche Nationalstaat sei Geschichte und die Deutschen seien angesichts der Katastro­phen des 20. Jahrhunderts besser in mehreren Staaten aufgehoben.

Die westdeutsche Linke war postnational – und damit Avantgarde. Die Hälfte der unter Dreißigjährigen im Westen empfand die DDR 1987 als Ausland. In einem CDU-Programmentwurf von 1988 kam die Wiedervereinigung nicht mehr vor. Hatte nicht auch Helmut Kohl 1981 festgestellt, dass „die verlorene Einheit im Sinne eines alten Nationalstaates nicht mehr wiederherstellbar ist“?

Quelle          :        TAZ         >>>>>        weiterlesen


Grafikquelle          :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt

Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons


2.) von Oben    —           DL / privat  – CC BY-SA 3.0


Unten         —        Die Bundesumweltministerin Angela Merkel am Stresemannufer hinter dem Plenarsaal der ehemaligen Bundeshauptstadt Bonn beantwortet einem Fernsehteam deren Fragen. Im Hintergrund ist das Abgeordnetenhochhaus Langer Eugen zu sehen. Fotografische Impressionen von Andreas Bohnenstengel während der Parlamentarischen Woche im Juni 1995 in: Der Dreizehnte Deutsche Bundestag. Innenansichten unseres Parlaments. ISBN 3-87576-357-2

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

R-R-G ohne Mehrheit

Erstellt von DL-Redaktion am 28. Oktober 2019

Warum die Linkspartei eine Minderheitsregierung anstrebt

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Koalition oder Tolerierung? Irgendwie muss die Linkspartei in Thüringen mit der CDU zusammenarbeiten. Strategen sehen Vorteile für die Minderheitsregierung.

Über Minderheitsregierungen spricht Bodo Ramelow schon länger positiv. Auch wenn er im Wahlkampf stets für Rot-Rot-Grün kämpfte, das Thema war für ihn – anders als die in Deutschland vorherrschende Meinung – „kein Schreckgespenst“. Im Deutschlandfunk-Interview sagte Ramelow im September, in nordischen Ländern sei eine solche Konstellation „ganz normal“.

Es sei zwar „anstrengend, mit wechselnden Mehrheiten zu regieren“, erklärte der Linken-Politiker einige Wochen zuvor dem Redaktionsnetzwerk Deutschland. Aber der damit verbundene „sanfte Zwang zum Kompromiss“ könne auch bereichernd wirken. „Ein Blick über die Landesgrenzen, etwa nach Dänemark, ist da hilfreich.“

Die Volksparteien verlören an Anziehung, der Abstand zwischen den Parteien werde geringer. „Die Minderheitsregierung wird auch bei uns früher oder später kommen, da ist es allemal besser, sich schon jetzt auf neue Regierungsformate einzustellen und für eine höhere gesellschaftliche Akzeptanz zu werben.“

Nun wird es womöglich ernst. Es scheint, als ob Thüringen nach der ersten linksgeführten Landesregierung nun ein weiteres demokratisches Experiment erleben könnte.

Die Mehrheit für Ramelows Linksbündnis aus Linken, SPD und Grünen ist seit Sonntag dahin. Und die Diskussionen in der Linken wie auch bei SPD und Grünen haben begonnen. Auch wenn die Linken-Landesvorsitzende Susanne Hennig-Wellsow der Form halber auf die bevorstehenden Beratungen der Parteigremien am Montagabend verweist und sich zu dem Projekt zunächst nicht äußern will.

In der der Analyse der Linken-nahen Rosa-Luxemburg-Stiftung zum Wahlausgang in Thüringen aber wird eine klare Empfehlung ausgesprochen. Autor Horst Kahrs, früher Leiter der Strategieabteilung im Karl-Liebknecht-Haus, der Linken-Parteizentrale, schreibt: „Mit der Wahl in Thüringen wird endgültig klar, dass Kenia-Koalitionen keine ausreichende Antwort auf die Umbrüche im Parteiensystem sind und über neue Konstellationen nachgedacht werden muss.“

Nach schwieriger Regierungsbildung – den Regierungsauftrag sieht er klar bei Ramelow – stehe eine „Konstellation bevor, die es so oder so noch nicht gegeben hat“, heißt es in dem sogenannten „Wahlnachtbericht“, der traditionell auch Grundlage für die Diskussion in den Parteigremien ist.

Vorteile gegenüber dunkelrot-schwarzer Koalition

Die Präferenz des Soziologen Kahrs ist klar. Eine Minderheitsregierung hat aus seiner Sicht klare Vorteile gegenüber einem formalen dunkelrot-schwarzen Regierungsbündnis: „In der Auseinandersetzung mit der AfD wären Minderheitsregierungen gegenüber lagerübergreifenden Mehrheitsregierungen das probatere Mittel: Sie würden die Unterschiede zwischen den Parteien links von der AfD erkennbarer machen und die demokratische Streitkultur beleben können.“

2017-08-30 Georg Maier Vereidigung by Olaf Kosinsky-7.jpg

Nur mit den AfD-Stimmen könnte eine solche Regierung gestürzt werden. Das könnte das Experiment stabilisieren. Zentraler Prüfstein einer Regierung sei immer die Verabschiedung eines Haushaltes, „hier könnte sich dann der demokratische Konsens gegen die AfD manifestieren“.
Grafikquellen         :

Oben     —        Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

Abgelegt unter L. Thüringen, Medien, P. DIE LINKE, Überregional | 1 Kommentar »

Zu – „Räte, Netz, Partei“

Erstellt von DL-Redaktion am 28. Oktober 2019

DIE LINKE: „Eine Debatte findet nicht statt“

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Quelle      :        Scharf  —  Links

Von Helge Buttkereit

Zu Peter Nowak „Räte, Netz, Partei“ im Neuen Deutschland vom 19. Oktober 2019, S. 21 (1)

Der Zustand der Linken ist erbärmlich. Die linken Parteien befinden sich seit Jahren freien Fall, nach der SPD ist nun auch die Linkspartei in der Existenzkrise. Die außerparlamentarische Linke ist kaum vernehmbar, wenn überhaupt in Form von Verteidigungs- oder Abwehrkämpfen gegen Repressionen oder gegen Rechts. Eine Besserung ist nicht in Sicht, zumal nicht an die Wurzel der Probleme vorgedrungen, die eigene Geschichte kritisch aufgearbeitet und daraus konkrete Schlussfolgerungen gezogen werden. Die Linke in der Krise müsste selbstkritische, radikale Organisationsdebatten führen, wo doch ihre Organisationen am Boden liegen. Tut sie aber nicht.

Wenn dann ein Autor nicht nur eine fast vergessene Organisation der westdeutschen Linken wieder ins Bewusstsein rückt, ihre Aktualität herausarbeitet und gleichzeitig auf nicht einmal zwanzig Seite eine fundierte Organisationsgeschichte des Proletariats liefert, dann wäre zumindest eine Beschäftigung mit dem Inhalt des Buches, eine kritische Auseinandersetzung mit den Argumenten angebracht. Peter Nowak hingegen hat eine an einigen Stellen falsche und ansonsten oberflächliche Rezension vorgelegt. Auf das Ziel des rezensierten Autors, einen Beitrag zur Organisationsdebatte zu leisten, geht er nicht einmal ein, geschweige denn, dass er in diese einsteigt.

Das besagte neue Buch von Carsten Prien unter dem Titel „Rätepartei“ ist eine historisch-materialistische Kritik des Sozialistischen Büros (SB) und reicht weit darüber hinaus. Das SB war in den 1970er Jahren die wichtigste Organisation der undogmatischen Linken in der Bundesrepublik, an der sich viele bekannte Köpfe wie beispielsweise Elmar Altvater, Arno Klönne oder Wolfgang Streeck beteiligten. Rudi Dutschke als einer der wichtigsten Vertreter dieser Strömung schon in der Studentenbewegung der 1960er Jahre war ebenfalls Teil des SB. Er wollte ausgehend von dessen Struktur eine „Rätepartei“ aufbauen. Es ging darum, die lockere, tendenziell unverbindliche und letztlich doch wieder von der Zentrale namens Arbeitsausschuss gesteuerte Organisation in eine „Partei neuen Typs“ umzuwandeln. Diese „Rätepartei“ sollte basisdemokratisch strukturiert sein, ausgehend von den „Arbeitsfeldern“, in denen sich bereits das SB organisierte. Mit „Arbeitsfeldern“ werden die Orte beschrieben, an denen die  Parteimitglieder in der Produktions- aber auch in der Reproduktionssphäre tätig sind. Davon ausgehend entwickelt sich im Organisationsmodell eine Parteiorganisation in Form einer Rätestruktur, die einen neuen Typ von Partei darstellte, würde sie Wirklichkeit.

Wer konkrete Stadtteil- oder Betriebsorganisationen kennt, wie Peter Nowak, für den sollte eine solche Organisationsform und auch ihre modellhafte Darstellung nicht abstrakt oder theoretisch, wie er schreibt, sondern im Aufbau zumindest erst einmal logisch erscheinen.

Denn die Arbeitsfelder sind ja praktisch vorhanden und eben an einigen Orten sogar schon organisiert, ohne ihre eigene Organisationsform weiter zu treiben. Dies zeigt sich schon in der ewigen Diskussion um die Priorität von Partei und Bewegung. Eine konkrete Aufhebung der beiden Vereinseitigungen in eine neue Organisation, wie sie Dutschke und viele andere mit ihm in den 1970er Jahren diskutierten, scheint heute undenkbar zu sein. Warum eigentlich?

Anstatt sich diese Fragen zu stellen, wird Nowak unsachlich. Warum er Prien mit ironischem Unterton als „selbsterklärten theoretischen Nachlassverwalter Dutschkes“ tituliert, bleibt in seinem Text ebenso unklar wie so vieles andere. Denn ein solcher sein zu wollen, hat Carsten Prien an keiner Stelle erklärt. Nowak führt diese Beschreibung hier ein, die allerdings sehr wohl eine sachliche Grundlage hat. Carsten Prien hat in seinem Buch „Dutschkismus“ eine kurze wie prägnante Darstellung von Rudi Dutschkes politischer Theorie vorgelegt und stellt in seinem neuen Buch nun ausgehend von Dutschke eine Diskussion dar, die es in der Krise der Linken mehr denn je verdient, rezipiert zu werden.

Richtig ist ferner, dass Prien die Diskussionen im SB parteiisch darstellt, wie Nowak es ihm vorhält. Parteiisch aber ist Carsten Prien wiederum für die Sache selbst, die revolutionäre Partei, deren Geschichte er darstellt und in deren Tradition er sowohl Dutschkes Parteigründungsversuche der 1970er als auch seine eigene Arbeit stellt.

Dabei geht es ihm um die revolutionäre Partei, die zur Selbsterkenntnis kommt, so schreibt er in „Rätepartei“, „dass die proletarische Selbstorganisation nicht Mittel zu irgendeinem ihr äußerlichen Zweck ist, sondern die aus der bürgerlichen Gesellschaft selbst erwachsene historische Prozessgestalt hin zu einer ,freien Assoziation‘ geschichtlich selbstbewusster und selbsttätiger Individuen“.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Diese historische Erkenntnis, gewonnen aus einer Analyse der Geschichte der Arbeiterbewegung, gilt es heute zu vertiefen und in einer Organisationsdebatte in konkrete praktische Schritte zu überführen.

Dabei ist sachliche Kritik sowohl an historischen Personen wie an Organisationen nötig, wie sie Carsten Prien auch übt. An keiner Stelle „stempelt“ oder „watscht“ er ab. Priens Kritik hat immer eine sachliche Grundlage, die Nowak entweder nicht zur Kenntnis nimmt oder aber bewusst unterschlägt. So ist beispielsweise die von ihm zitierte Kritik Carsten Priens an Peter Brückner im Buch mit einer erläuternden Fußnote untermauert. Brückner an dieser Stelle aufgrund anderer (an dieser Stelle nicht zu diskutierenden) Tätigkeiten in Schutz zu nehmen, ist unsachlich. Schlicht falsch ist die Angabe, im Anhang des Buches sei ein Briefwechsel zwischen Negt und Dutschke abgedruckt. Richtig ist: Hier sind drei wichtige Originaltexte der beiden Protagonisten der Organisationsdebatte der 1970er abgedruckt.

Es ist schade, dass Peter Nowak neben solchen einfachen Fakten auch die theoretische Tiefe des Buches von Carsten Prien nicht erfasst hat.

„Rätepartei“ könnte (eine) Grundlage für die notwendige Organisationsdebatte der Linken heute sein. Leider zeigt auch Nowaks Rezension, dass diese Debatte (noch) nicht stattfindet.


Helge Buttkereit ist wie Carsten Prien Mitarbeiter des Hans-Jürgen-Krahl-Instituts e.V. Der Text liegt auch der Tageszeitung Neues Deutschland vor, die allerdings nur kurze Leserbriefe abdrucken will.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons



Oben         —         Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom

Autor    —     Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg
  • Created: 2014-05-10 13:18:56



Unten        —           Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor     —        Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Gewerkschaften, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

Berliner Mietendeckel

Erstellt von DL-Redaktion am 25. Oktober 2019

Ersten Erfolg der Bewegung in Rückenwind für Enteignungskampagne verwandeln 

File:Potsdamer Platz, Berlin, April 2016.JPG

Quelle      :     AKL

Von     Lucy Redler, Berlin

Nach monatelangem Ringen und Druck der Mieter*innenbewegung und einer Gegenkampagne der Bauwirtschaft, der Genossenschaften, CDU, FDP, AfD und Teilen der SPD hat sich die rot-rot-grüne Regierung auf einen Entwurf zum Mietendeckel geeinigt. Der Beschluss des Senats geht nun ans Parlament und es bleibt abzuwarten, ob die SPD oder die rechte Opposition noch versuchen, einzelne Punkte zu verwässern.

Die drei wesentlichen Elemente des neuen Mietendeckels sind:

  • Mietenstopp: Die Mieten aller Mietwohnungen auf dem freien Markt, die vor 2014 gebaut wurden, werden rückwirkend zum 18. Juni 2019 für fünf Jahre eingefroren. Das betrifft 1,5 Millionen Haushalte.
  • Obergrenzen: Bei Wiedervermietung darf die Wohnung nicht teurer vermietet werden als gegenüber dem/der Vormieter*in (Ausnahme: Mieten unter fünf Euro netto kalt, diese können auf fünf Euro erhöht werden). Sind die bisherigen Mieten höher als die Obergrenzen-Tabellenwerte, die dem Gesetz beigefügt sind, gilt die Obergrenze, derzufolge die Kaltmieten 6,45 und 9,80 pro Quadratmeter je nach Baujahr und Ausstattung nicht überschreiten dürfen (ausgenommen sind Ausstattungsaufschläge.)
  • Mietsenkung: Bei bestehenden Mietverträgen gibt es es einen Anspruch auf Mietsenkung, wenn die Miete zwanzig Prozent über den Grenzwerten liegt (dabei gelten je nach Lage der Wohnung Auf- und Abschläge).

Der Senat rechnet mit 300.000 Anspruchsberechtigten. Wie viele von ihnen am Ende wirklich einen Antrag auf Absenkung stellen ist offen. Nicht wenige Mieter*innen dürften Angst haben, es sich mit ihrer/ihrem Vermieter*in zu verderben, denn die Regelungen gelten zunächst nur fünf Jahre und es ist offen, ob Teile des Gesetzes vom Gericht kassiert werden (weitere Fakten zum Entwurf).

Wie dicht ist der Deckel?

Eine wirkliche Bewertung der Tiefe des Eingriffs in das Eigentum der Immobilienkonzerne ist erst möglich, wenn klar ist, wie viele Menschen materiell von der Absenkung profitieren und wie geschickt die Konzerne Umgehungsstrategien finden. Nicht nachvollziehbar ist zudem, warum Mietsenkungen erst beim Überschreiten der Obergrenzen um zwanzig Prozent greifen und damit Bestandsmieten anders bewertet werden als Neuvertragsmieten. Zudem sind Modernisierungen von einem Euro pro Quadratmeter weiterhin möglich.

Unbestreitbar ist das Ergebnis aber ein wichtiger Erfolg der Mieter*innenbewegung, den es ohne die Proteste und den politischen Druck durch die Enteignungsdebatte nicht gegeben hätte. Diese hat auch dazu geführt, dass die SPD sich nicht mit ihrem Vorhaben durchsetzen konnte, Mietsenkungen zu verhindern. Wahr ist aber auch, dass das jetzige Gesetz deutlich hinter den ersten Entwurf zurück fällt.

Trotzdem wird die Einführung dieses Mietendeckels eine wichtige Signalwirkung auf Aktive bundesweit haben. Die Einführung sollte als Steilvorlage genutzt werden, für schärfere Gesetze zu Mietenstopp und Mietsenkungen in anderen Bundesländern und auf Bundesebene zu kämpfen. Auch in Berlin muss es zukünftig Auseinandersetzungen über eine Schärfung des Gesetzes geben.

Flag of Die Linke

Für die Berliner*innen ist das Gesetz nun vor allem eine Atempause, es löst die grundlegenden Probleme auf dem von privaten Konzernen dominierten Wohnungsmarkt jedoch nicht. Deshalb kommt es jetzt auch darauf an, die Kampagne für Enteignung der Immobilienkonzerne ohne Atempause weiter voranzutreiben und für massiven bezahlbaren Neubau durch die landeseigenen Wohnungsbaugesellschaften zu kämpfen.


Ursprünglich hatte die SPD den Mietendeckel als Idee aufgebracht, um weitergehenden Forderungen der Initiative „Deutsche Wohnen & Co enteignen“ und der LINKEN nach Enteignungen von Immobilienkonzernen den Wind aus den Segeln zu nehmen. Im Gegenteil zu dieser Absicht spricht nun einiges dafür, dass die Initiative Rückenwind bekommen könnte. Denn der Mietendeckel hat gezeigt: Kämpfen lohnt sich.Erst deckeln, dann enteignen: Das muss jetzt die praktische Kampagne-Politik der LINKEN bestimmen und auch zur Kampagne der Gewerkschaften werden. DIE LINKE muss alles dafür tun, dass das juristische Verfahren zur ersten Stufe des Volksentscheids „Deutsche Wohnen & Co enteignen“ so schnell wie möglich abgeschlossen wird, um in die zweite Stufe der Unterschriftensammlung und der Kampagne einzutreten. Diese kann zum Rahmen werden, um die Organisierung von Mieter*innen qualitativ zu erhöhen und politisch ein Beispiel zu setzen, dass Enteignungen breiten Rückhalt in der Bevölkerung haben und zur Nachahmung in anderen Bereichen empfohlen werden. Denn es geht um nicht weniger, als die kapitalistischen Machtverhältnisse grundlegend zu ändern.

Dieser Artikel erschien unter zuerst.

akl - Antikapitalistische Linke


Grafikquellen       :

Oben      —      Potsdamer Platz, Berlin, April 2016

Author Another Believer       /       Source   :    Own Work
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.


Unten           —       Flag of Die Linke

Public Domain

Abgelegt unter Allgemein, APO, Berlin, Opposition, Überregional | Keine Kommentare »

Köln-Kurden machten mobil

Erstellt von DL-Redaktion am 24. Oktober 2019

Der Krieg auf der Domplatte

Fichier:Düsseldorf, Rosenmontag 2016, politische Karnevalswagen (06).jpg

Aus Berlin und Köln Dinah Riese, Anett Selleund, Christian Werthschulte

Adnan organisiert in Köln Proteste gegen den türkischen Einmarsch. Bekir Yılmaz in Berlin kann dagegen verstehen, dass die Türkei keinen PKK-nahen Staat tolerieren will. Der eine ist Kurde, der andere Türke. Landet der Konflikt an der syrischen Grenze jetzt mitten in Deutschland?

Aus dem Hauptbahnhof von Köln strömen an diesem wie an jedem Abend die Pendler*innen hinaus. Aber statt des Dom-Panoramas erwartet sie heute etwas anderes: gelb-grün-rote Fahnen der kurdischen Miliz YPG. Seit über einer Woche versammeln sich hier kurdische Gruppen, um gegen den Einmarsch der Türkei in Nordsyrien zu demonstrieren. „Operation Friedensquelle“ nennt die Türkei das, was sie tut; als „nicht im Einklang mit dem Völkerrecht“ bezeichnet es Bundesaußenminister Heiko Maas (SPD). Am Mittag gab es in Köln eine Mahnwache, jetzt am frühen Abend eine Demonstration. Heute sind etwa einhundert Menschen gekommen. „Man muss einen Tag als Kurde leben, um die Kurden zu verstehen“, sagt Adnan, der die Versammlung angemeldet hat. Sein Nachname soll nicht in der Presse veröffentlicht werden.

Adnan arbeitet als Sozialarbeiter in Köln, seine Familie kommt aus einem Dorf in der Nähe von Kobani auf der nördlichen Seite der türkisch-syrischen Grenze. „Ich schaue jede freie Minute aufs Handy“, sagt er. Er liest Nachrichtenportale, wartet auf E-Mails seiner Verteiler und telefoniert mit Freund*innen, die südlich der Grenze auf syrischem Territorium gewohnt haben. Sie sind mittlerweile in die 100 Kilometer entfernte Stadt Raqqa geflohen. „Ich fühle mich so hilflos“, erzählt er. „Wir sind bestürzt, dass wir alleingelassen werden.“ Aber die Solidarität der Bevölkerung mit der Mahnwache sei groß. Einen Tag später, am Samstag, demonstrieren in Köln 10.000 Menschen. An einem der Startpunkte flucht eine Frau im Vorbeigehen im rheinisch-türkischen Akzent: „Diese Scheißkurden. Sollen die doch woanders demonstrieren.“ Niemand beachtet sie.

Es ist kein neues Phänomen, dass sich Konflikte in und um die Türkei auch in Deutschland niederschlagen, sei es die türkische Militäroffensive gegen die syrische Stadt Afrin im Januar 2018 unter dem Namen „Operation Olivenzweig“ – ebenfalls ein Friedenssymbol – oder der Putschversuch in der Türkei 2016; oder seien es die verschiedenen Militärputsche in der Türkei, etwa 1971 oder 1980, in deren Folge viele Kurd*innen vor Verfolgung aus der Türkei fliehen mussten – zum Beispiel nach Deutschland.

Türkischstämmige Menschen bilden laut Mi­krozensus 2018 die größte Minderheit in Deutschland: 13,3 Prozent der „Menschen mit Migrationshintergrund“ hierzulande haben diesen, weil sie selbst oder mindestens ein Elternteil die türkische Staatsbürgerschaft hat oder hatte. Das sind rund 2,8 Millionen Menschen. Darunter sind auch viele Kur­d*innen. Wie viele von ihnen in Deutschland leben, lässt sich nicht so leicht beziffern. Schätzungen gehen von 600.000 bis anderthalb Millionen aus, sie oder ihre Familien stammen vor allem aus der Türkei, aus Syrien, dem Irak oder dem Iran.

Beiderseits wird provoziert. Bei spontanen, nicht angemeldeten Aktionen gegen kurdische Versammlungen und Demonstrationen seien nach Einschätzung des nordrhein-westfälischen Verfassungsschutzes „Anhänger der rechtsextremistischen Grauen Wölfe“ unter den Teilnehmenden gewesen, erklärt das Innenministerium des Landes. Diese, „aber auch nationalistische regierungstreue Türken“ hätten bei diesen Aktionen den Wolfsgruß gezeigt, um ihr Gegenüber zu provozieren. Kurd*innen wiederum reagierten „auf dieses Zeichen hoch emotional.“

Anfang dieser Woche kommt es in Herne zu einer Schlägerei zwischen Türken und Kurden, wie die örtliche Polizei berichtet, beteiligt sind 50 bis 60 Personen. Schon in der Vorwoche wurde in der Stadt im Ruhrgebiet der Wolfsgruß gezeigt, wo­raufhin kurdische Demonstrant*innen erst einen türkischen Kiosk und dann ein Café angriffen. Eine kurdische Demonstration in Mönchengladbach wurde „verbal attackiert“, so das NRW-Innenministerium, bevor es zu körperlichen Auseinandersetzungen kam. In Dortmund wurden türkische Fahnen sowohl gezeigt als auch verbrannt, Letzteres hat der Versammlungsleiter rasch unterbunden. In Lüdenscheid wurde ein türkischstämmiger Mann mit einem Messer schwer verletzt, in Bottrop wurden aus einer Gruppe von etwa 200 Menschen heraus Pflastersteine auf eine kurdische Versammlung geworfen. Immer wieder seien auch Parolen der auch in Deutschland verbotenen Kurden-Partei PKK gerufen oder entsprechende Symbole gezeigt worden.

So hätte der „Schwarze Block des Staat“ aussehen können.

Es sei eine Situation „kurz vor der Explosion“, man sitze „auf einem Pulverfass“ – so ist seit Tagen zu lesen. Unsicher fühle er sich in Köln im Moment nicht, widerspricht Adnan, auch wenn er bestimmte Ecken meidet, wo sich ultranationalistische Türken treffen: „Das hat man nichts zu suchen.“

Im Bundesinnenministerium gibt man Entwarnung. Im Zusammenhang mit der türkischen Militäroffensive würden bereits seit geraumer Zeit „Mobilisierungsaktivitäten kurdischer und deutscher linker Organisationen verzeichnet“, sagt ein Sprecher des Ministeriums auf Nachfrage. Vereinzelte gewaltsame Auseinandersetzungen seien „nicht auszuschließen“. Eine „Verschärfung der ­Gefährdungslage“ sei derzeit aber „nicht erkennbar“.

Quelle       :         TAZ              >>>>>            weiterlesen


Grafikquellen          :

Oben        —        So sah es einmal in Düsseldorf aus. /Düsseldorf, Rosenmontag 2016, politische Karnevalswagen.

Cette œuvre a été placée dans le domaine public par son auteur, Kürschner. Ceci s’applique dans le monde entier.


Unten     —          Bereitschaftspolizei officers during a demonstration

Abgelegt unter Feuilleton, Köln, Medien, Überregional | Keine Kommentare »

Wahlen in Thueringen

Erstellt von DL-Redaktion am 24. Oktober 2019

Allen Untergangs-Prognosen getrotzt

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -110.jpg

Von Michael Bartsch

Nach fünf Jahren klopft sich Rot-Rot-Grün in Thüringen auf die Schulter. Die drei Koalitionspartner würden am liebsten zusammen weitermachen.

Es ist der Blick auf die Opposition, der in Thüringen zeigt, wie rund es für die Regierung eigentlich läuft. Mike Mohring wirke ziemlich bemüht, Angriffsflächen bei Rot-Rot-Grün zu entdecken, schilderte ein Radiohörer bei MDR Aktuell seinen Eindruck vom CDU-Spitzenkandidaten in Thüringen. In der Tat musste Mohring beim CDU-Wahlkampfauftakt am 3.Oktober das Geschäft der AfD betreiben und ein apokalyptisches Bild von Thüringer Zuständen zeichnen, um Wirkung zu erzielen. Ausgerechnet am Tag der Einheit denunzierte er überdies seinen Kontrahenten Bodo Ramelow von der Linken als „Gewerkschaftsfunktionär aus dem Westen“.

Die gesenkten Hörner der Union wirken wie ein Beleg für die überwiegend erfolgreiche Arbeit der ersten linksgeführten Koalition eines Bundeslandes. Die CDU-Kritik am Lehrer- und Polizistenmangel oder an schwacher Kommunalfinanzierung gleicht einem Eigentor. Linke, SPD und Grüne haben die rigide Sparpolitik und den Personalabbau der CDU-geführten Vorgängerregierungen gestoppt. Statt der im Koalitionsvertrag vorgesehenen 2.500 sind 3.900 Lehrer neu eingestellt worden, was freilich immer noch keine vollständige Unterrichtsversorgung sichert. Tausend Erzieherinnen mehr verbessern die Kita-Betreuung. Und das Volumen des Finanzausgleiches zwischen Land und Kommunen ist von 1,8 auf 2,1 Milliarden gewachsen.

Im November 2014 – kurz nach dem guten Ergebnis der Linken unter Bodo Ramelow – mobilisierte die CDU-Mittelstandsvereinigung viertausend Menschen, die auf dem Erfurter Domplatz mit Kerzen in der Hand den Untergang ihres geliebten Thüringen verhindern wollten. Hundert Tage nach seiner Wahl zum Ministerpräsidenten konterte Ramelow solche Ängste in seiner gewohnt trockenen Art: „Es gibt immer noch Bananen!“ Es gibt 2019 sogar den chinesischen Großinvestor CATL, der pünktlich zum Landtagswahltermin eine 1,8 Milliarden Euro teure Batteriefabrik ans Erfurter Autobahnkreuz baut.

Im Landtagsgebäude trifft man die ziemlich aufgeräumte Landes- und Fraktionsvorsitzende der Linken Susanne Hennig-Wellsow. Sie blickt sichtlich zufrieden auf eine mit den schlimmsten Orakeln begonnene Legislaturperiode zurück. „Wir haben keine einzige Abstimmung verloren!“ Dabei war Rot-Rot-Grün nur mit einer knappen Ein-Stimmen-Mehrheit gestartet.

An der Uneinigkeit der Oppositionsparteien CDU und AfD scheiterte im Dezember 2017 der Versuch, Ministerpräsident Bodo Ramelow (Linke) zu einer Vertrauensabstimmung zu zwingen. Die CDU wollte damals Differenzen in der Koalition über die größtenteils gestoppte Gebietsreform ausnutzen. Vor allem eine Reduzierung der 17 Landkreise bei nur 2,1 Millionen Einwohnern galt als das zentrale Vorhaben der Koalition. „Die Kreisgebietsreform ist das einzige wirklich gescheiterte Projekt“, räumt der SPD-Fraktionsvorsitzende Matthias Hey ein und verweist auf die Widerstände in den Regionen. In der Tat sind es nicht nur CDU-Politiker, die die historisch gewachsene Kleinstaaterei des Thüringer Flickenteppichs für einen „Segen“ halten. „Die Gebietsreform nicht um jeden Preis durchzuziehen hat dazu geführt, dass sie auf kommunaler Ebene freiwillig stattfindet“, dreht die Linken-Chefin hingegen die halbe Niederlage ins Positive.

Quelle        :      TAZ          >>>>>           weiterlesen

Im Labor wird’s spannend

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Kommentar von Georg Löwisch zur Bedeutung der Wahl in Thüringen

Mitten in Deutschland wird am Sonntag gewählt. Aber die Republik redet lieber darüber, dass die Bayern nur knapp gegen Piräus gewonnen haben. Oder da­rüber, ob AKK was Dummes oder was Kluges wagt (und ob sie dem Außenminister rechtzeitig Bescheid gesimst hat). Während im Sommer vor den Wahlen in Brandenburg und Sachsen ein medialer Countdown lief, ist von Thüringen kaum die Rede.

Das hat Gründe. Thüringen hat mit 2,1 Mil­lio­nen Einwohnern nur ungefähr halb so viele wie Sachsen. Und nach dem Grusel über die starken AfD-Ergebnisse vom 1. September wird in Dresden und Potsdam ziemlich geräuscharm über Kenia-Koalitionen verhandelt. Ein wenig ist die rot-rot-grüne Regierung in Erfurt an der geringen Aufmerksamkeit sogar selbst schuld: Sie legte den Wahltermin extra nicht auf denselben Sonntag wie die anderen, sondern lässt so spät wie möglich wählen. Das Kalkül: Nach dem AfD-Schocker in Brandenburg und Sachsen profitieren wir von der Gegenmobilisierung. Jetzt wirkt es aber so, als wollten viele das Land, wo Björn Höcke seine völkischen Träume propagiert, am liebsten wegschweigen.

Quelle          :          TAZ            >>>>>           weiterlesen


Grafikquellen       :

Oben      —          Landtagswahl Thüringen am 14. September 2014

  • CC BY-SA 3.0 de
  • File:2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -110.jpg
  • Created: 2014-09-14 19:10:36


Unten         —          Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

Abgelegt unter L. Thüringen, P. DIE LINKE, P.CDU / CSU, P.Die Grünen, Überregional | Keine Kommentare »

Höckes nativer Enkeltrick

Erstellt von DL-Redaktion am 23. Oktober 2019

Anständige Floskeln und unanständige Ideologie

Landesparteitag AfD Thüringen 2019 - Björn Höcke - 1.jpg

Ein Essay von Tubias Ginsburg

Während die Nachrichten über den Anschlag in Halle auf die Smartphones eintrudeln, hält Björn Höcke eine Wahlkampfrede auf einem Familienfest der AfD. Der jüdische Autor Tobias Ginsburg war dabei.

Als Björn Höcke endlich die Bühne betritt, ist der Terroranschlag von Halle bereits vorbei. Zwei Menschen sind tot. Eine Holztür hat das große Massaker verhindert.

Ich weiß nicht, ob die durchnässten Menschen im thüringischen Mühlhausen von dem Attentat wissen. Während ich alle zwei Minuten mein Handy zittrig aus der Tasche krame, mich dabei frage, warum ich Jom Kippur an so einem beschissenen Ort verbringe und nicht bei meiner Familie bin, stehen die Leute um mich herum ganz friedselig beisammen.

Es sind vor allem gutgelaunte Rentner und Kleinbürger, dazwischen ein paar fröhliche Neonazis, die das AfD-Familienfest besuchen. Geduldig wartet man hier auf Björn Höckes Auftritt, trinkt Bier und Glühwein, schunkelt sanft zu volkstümlicher Schlagermusik, vorgetragen von zwei dauergrinsenden Musikern in Trachten, und wann immer ein neuer Regenschauer herabschüttet, flüchtet man unter die Zelte. Und die grinsende Kapelle greift beherzt in die Schlagerkiste: „Tiefe Spuren in unsren Herzen, tausend Sünden im Gesicht / Die nächsten hundert Jahre, die liegen noch vor uns / Wir sind alle noch am Leben!“

Der jung ergraute Kerl knurrt genervt auf, als ich ihn nach dem Attentat in Halle frage. „Waren sicher wieder die Goldstücke“, sagt er und meint damit Geflüchtete.

„Aber eine Dönerbude wurde auch zusammengeschossen.“

Der graue Kerl zuckt mit den breiten Schultern: „Kennen wir doch schon alles.“

Es ist gar nicht so einfach Menschen mit Terroranschlägen noch zu beeindrucken. Sicherlich, in der Welt meines Smartphones, bevölkert von linksliberalen, antirassistischen und nicht zuletzt jüdischen Stimmen, da sitzt der Schock tief. Da erkennt man die Zäsur: Ein Nazi hat in Deutschland versucht, ein Blutbad in einer Synagoge anzurichten. Aber hier auf dem Mühlhäuser Untermarkt, gleich vor der schönen gotischen Kirche, da klingt das alles nur halb so schlimm.

„Wie viele Tote denn?“, fragt mich die alte Frau mit Bratwurst, als ich sie anspreche.

„Mindestens zwei.“

„Ah, ah ja“, sagt sie, nickt freundlich, und wir wissen beide nicht, wie wir das Gespräch noch fortsetzen können. Was kann man dieser Frau sagen? Was kann man sagen, was tun nach so einer Tat?

Gut, da sind zunächst die Floskeln. Wir müssen gegen rechts sein. Noch mehr! Und gegen jeden Antisemitismus! Wir stehen unteilbar! Wir sind mehr! Nie wieder! Keinen Millimeter nach rechts! Rassismus, pfui Spinne! Und so fort. Gefordert wird das von den Anständigen, gehört von anderen Anständigen. Die Unanständigen lesen derweil unanständige Texte, in denen abgefuckte AfD-Politiker den Mörder als unpolitischen Geisteskranken darstellen. Und dann sind da noch all jene, die einfach nur weiterhin auf Familienfesten in ihre Bratwurst beißen wollen. Die einen Scheiß auf gutgemeinte Floskeln geben. Sich nicht angesprochen fühlen.

Klar erfüllen die Floskeln trotzdem einen Zweck. Sie sind beruhigende, kollektive Mantras: Die offene, pluralistische Gesellschaft ist noch lange nicht verloren. Und es liegt in der Natur des Mantras, dass man es wiederholt – und in der Natur des Menschen, sich im Moment der Hilflosigkeit Mut zuzusprechen. Sicher, man kann auch zusätzlich noch ein konsequentes Vorgehen gegen die rechte Szene verlangen. Aber haben wir das nicht schon nach den NSU-Morden verlangt? Nach der Nordkreuz-Todesliste, nach Franco A., nach dem Mord an Walter Lübcke? Oder nach 1945? Es ist gar nicht so einfach, sich nach so einer Tat wieder Mut zu machen.

Höcke nun wiederum gelingt das Mutmachen ganz hervorragend. Er macht seinem begeistertem Publikum Mut im Kampf gegen das verlogene Establishment, gegen Zuwanderung und Multikulti. Mut, sich von Kollegen, Freunden, Enkelkindern als Rassist beschimpfen zu lassen. Mut, trotzdem die AfD zu wählen.

Und dann äußert er sich auch zu Halle. Das muss er auch. Es ist bereits 17 Uhr, es nieselt, einige Zuschauer haben sich in Deutschlandflaggen mit dem Schriftzug „Wir sind das Volk“ gehüllt, im Hintergrund kreischen die Trillerpfeifen der Gegendemonstration. Die Bluttat liegt Stunden zurück, und die Pressemitteilungen laufen heiß.

Datei:Skulptur Juedische Opfer des Faschismus (Foto 2008).jpg

Höcke setzt den Anschlag in eine Reihe mit anderen Gewalttaten, die allesamt von Nichtdeutschen begangen wurden: Mit dem Jungen, der in Frankfurt vor einen ICE gestoßen wurde, mit dem Syrer, der zwei Tage zuvor in Limburg mit einem Lastwagen mehrere Autos gerammt hatte. „Und heute hören wir von einem Terroranschlag auf eine jüdische Gemeinde in Halle, und wir fragen uns als AfD: Was ist in diesem Land los?“

Eine unappetitliche Aufzählung, eine heuchlerische Frage, erst recht aus dem Mund von Höcke: einem Faschisten, der seine geschichtsrevi­sio­nis­tischen und rassistischen Verbal­exzesse mit ritterhafter Mannhaftigkeit und dunkelbrauner Nostalgie performt. Aber dieser Höcke ist an diesem Tag nur bedingt anzutreffen. Wie schon am Vortag in Apolda steht vor mir ein taktierender Wahlkämpfer, ein schmalbrüstiger Kerl mit brav frisiertem Scheitel. Der, so scheint es, sich Mühe gibt nicht allzu laut zu werden. Der sich als unschuldiges Opfer des Establishments geriert. Zwar hebt für ein paar Sätze zum Crescendo an und goebbelt herum, aber gleich darauf entschuldigt er sich artig dafür: „Entschuldigen Sie, an dieser Stelle werde ich einfach immer so emotional.“

Quelle         :        TAZ          >>>>>         weiterlesen


Grafikquellen       :

Oben        —      Landesparteitag der AfD-Thüringen am 19. August 2019 in Arnstadt


Unten        —    Skulptur „Jüdische Opfer des Faschismus“ (1957) von Will Lammert in der Großen Hamburger Straße, Berlin. Sie steht vor dem Jüdischen Friedhof Berlin-Mitte.

Denkmalplakette Deutschland.svg
Dies ist ein Foto des Berliner Kulturdenkmals mit der Nummer


Urheber Jochen Teufel

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter L. Thüringen, Medien, P.AfD, Überregional | Keine Kommentare »

Ein Linker Blick zurück

Erstellt von DL-Redaktion am 21. Oktober 2019


2018-10-12 Eva Maria Bulling-Schröter LINKE 7988.jpg

Quelle        :    Scharf  —   Links

Von Fritz Schmalzbauer

Manchmal schadet es nicht, sich zu erinnern: Nicht nur im Großen und Ganzen, sondern im Detail. 2004/2005: Schröder/Fischer zwingen ihre Parteien auf neoliberalen und danach auf Kriegskurs (die Parteien lassen sich zwingen). Wir, eine kleine Gruppe von Gewerkschaftern – in der Presse als „enttäuschte Sozialdemokraten“ tituliert, wobei nur enttäuscht sein kann, wer sich täuschen lässt – protestierten und wurden, soweit noch „drin“, aus der SPD ausgeschlossen.

Die von uns ins Leben gerufene „Alternative für Arbeit und soziale Gerechtigkeit“ (ASG) wuchs schnell zu einer beachteten Bewegung. Es entstand daraus die WASG – Wahlinitiative für Arbeit und Gerechtigkeit und mit ihr der erste Geburtsfehler der neuen Linken: Statt, wie ursprünglich proklamiert, einen Rückhalt aus kritischen Gewerkschaftern und Sozialdemokraten zu organisieren, öffnete eine beteiligte Gruppe das Spektrum hin zu einer allgemeinen Sammlungsbewegung, in der sich alles austoben konnte, was je mit der Welt unzufrieden war. Bundestagswahlen und mögliche Mandate überlagerten den Ausgangspunkt.

Bei den von Schröder vorgezogenen Bundestagswahlen und der Kandidatur der WASG-Kandidaten auf PDS-Listen vereinbarten einige Leute hinter verschlossenen Türen, was sich später als DIE LINKE präsentierte. Damit bekam die PDS im Westen einen neuen Frühling, obwohl sie kurz davor noch völlig marginalisiert war. Die Belohnung: Ausgehandelte Bundestags- und später Europa-Mandate, mit denen es sich gut leben läßt und vor allem das politische Überleben von Leuten, die das Manipulieren gelernt hatten, so die heutige Bayernvorsitzende der LINKEN und von den Gewerkschaftern vorher nie wahrgenommene PDS-Abgeordnete Eva Bulling-Schröter.

Die Folgen der „parteitechnischen“ Unterwerfung unter die PDS, hinter dem Rücken der gewählten Parteileute der WASG gesteuert und ausgehandelt in Berlin: Flucht von Menschen des linksdemokratischen Spektrums der SPD, den Gewerkschaften, den Grünen und Nichtorganisierten. Sie wollten mit der PDS nichts zu tun haben. Zugegeben – ich hatte zwar dagegen opponiert und polemisiert, aber  letzten Endes für die Gründung der Partei DIE LINKE gestimmt, weil es zu diesem Zeitpunkt keine machbare Alternative gab. Was das „Machen“ betrifft, war der PDS-Apparat den westlichen Nebenberufspolitikern eben überlegen. Er überlebte in den neuen Strukturen, ob Partei, Fraktion oder Stiftung durch Profis, die weiterhin dafür sorgten, dass blieb, was bleiben durfte und hinzukam, was dem Apparat nicht im Wege stand.

Auf einer Referenten-Zusammenkunft von Gewerkschaftern in Bayern kritisierte ein Berliner Professor, Berater von Gewerkschaftsvorsitzenden, die Politik der Linken in der Europa-Fraktion. Sie hätten doch seine wohndurchdachten Vorschläge erhalten und dennoch ignoriert. Daraufhin schauten natürlich alle auf mich und warteten auf eine geharnischte Antwort. Mir fiel nichts besseres ein als „lieber eine kritikwürdige Linke als keine“. Gelächter und Applaus.

Schnee von gestern? Ich glaube nicht. Vergangenes läßt sich zwar nicht korrigieren, aber man kann gelegentlich daraus lernen. Die Ironie der Gegenwart will es, dass ausgerechnet im Osten in der Politik von Bodo Ramelow, Gewerkschafter in der Übergangszeit von der DDR zur BRD mit „Ostauftrag“ in Thüringen, ein Stück der ursprünglichen Idee weiter lebt. Linke Politik braucht zwar schonungslose Kritik nach innen und aussen, sie braucht aber auch nachvollziehbare, in der jeweiligen Situation nötige und mögliche Schritte. Geht dabei allerdings die Perspektive verloren, landet man bei der SPD. Schritt für Schritt.

Gründungsvorstand WASG / DIE LINKE

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle       :          Eva Maria Bulling-Schröter, geb. Bulling, deutsche Politikerin (DIE LINKE.) Sie ist eine der Spitzenkandidaten für DIE LINKE. Bayern in der Landtagswahl 2018. Titel des Werks „Eva Maria Bulling-Schröter (DIE LINKE)“

Abgelegt unter Bayern, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Sie trainieren unser Ende!

Erstellt von DL-Redaktion am 19. Oktober 2019

Zur laufenden Atomkriegsübung in Büchel 

Quelle         :       Scharf  —  Links

Ein Beitrag von Kathrin Vogler

Seit Montag und bis heute trainieren US-Truppen gemeinsam mit der Bundeswehr in der jährlichen Militärübung „Steadfast Noon“ den Atomkrieg über Deutschland. Die Bundeswehr setzt dabei Tornados und Eurofighter ein. Trainiert werden die Einsatzbereitschaft und die Fähigkeit zur Zusammenarbeit zwischen den europäischen Militärs und der in Europa stationierten US-Air Force-Kräfte. Die beteiligten deutschen Standorte sind in diesem Jahr Büchel und Nörvenich. Auch in Nörvenich waren früher Atomwaffen stationiert. In Büchel lagern aktuell bis zu 20 Atombomben des Typs B61. Das Taktische Luftwaffengeschwader 33 der Bundeswehr soll im Atomkriegsfall die Bücheler Atombomben im Rahmen der Nuklearen Teilhabe ins Ziel bringen.

Kathrin Vogler, friedenspolitische Sprecherin der Fraktion Die Linke im Bundestag, dazu: „Es ist völlig wahnsinnig, was da gerade geschieht. Die USA übt mit der Bundeswehr sowie niederländischen, italienischen und polnischen Streitkräften, wie man einen Atomkrieg in Europa führt. Käme es dazu, würden Millionen Menschen sterben und kein Stein bliebe auf dem anderen. Es ist auch skandalös, dass die Bevölkerung nicht informiert wird. Wir wissen zum Beispiel nicht, ob die Bücheler Atombomben während der Übung über der Eifel herumgeflogen werden.

Kathrin Vogler 3.jpg

Ich habe Mitte September eine Kleine Anfrage zu Steadfast Noon  gestellt, die die Bundesregierung bis heute nicht beantwortet hat. Wie groß ist das Risiko, dass hier ein katastrophaler Unfall geschieht? Dass diese Atomkriegsübung eine politische und militärische Drohgebärde gegenüber Russland sein soll, macht alles noch schlimmer: Steadfast Noon markiert den Rückfall in den nuklear bestückten Kalten Krieg, der uns alle als Geiseln nimmt. Meine Antwort darauf: Wir müssen alle Atomwaffen abschaffen. Die Bundesregierung muss sofort den UN-Atomwaffenverbotsvertrag unterschreiben.“


Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen      :

Oben       —       Explosion von Upshot-Knothole Badger 1953 auf der Nevada Test Site


Unten      —        Kathrin Vogler. Foto: Niels Holger Schmidt


Abgelegt unter Bundestag, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Hessen droht U-Ausschuss

Erstellt von DL-Redaktion am 18. Oktober 2019

Verbindungen des Lübcke-Mörders

Wolfhagen, KS - Bründersen v W.jpg

Von Konrad Litschko

Der Ex-Verfassungsschützer Andreas Temme soll mit dem mutmaßlichen Lübcke-Mörder „dienstlich befasst“ gewesen sein. Ein U-Ausschuss könnte folgen.

Hessen steuert auf einen neuen Untersuchungsausschuss zu – und zwar zum Mordfall Lübcke. Nachdem am Donnerstag Hessens Innenminister Peter Beuth (CDU) einräumte, dass es einen dienstlichen Bezug des früheren Verfassungsschützers Andreas Temme, der am Tatort des NSU-Mordes in Kassel war, mit dem mutmaßlichen Lübcke-Mörder Stephan Ernst gibt, stellte die Opposition einen U-Ausschuss in Aussicht.

Auf Nachfrage der SPD hatte Beuth im Innenausschuss erklärt, Temme – ein einst langjähriger V-Mann-Führer – sei mit Ernst „dienstlich befasst“ gewesen. Näheres wollte er dazu nicht sagen. Ein Sprecher des Verfassungsschutz teilte aber der taz mit, es gehe um zwei Vermerke in Ernsts Personenakte aus dem Jahr 2000, die Temme unterzeichnet habe. Ernst war damals in der Kasseler Neonazi-Szene aktiv und galt als gewalttätig. Dienstliche Treffen zwischen Ernst und Temme seien nicht bekannt, sagte der Sprecher. Auch eine Zusammenarbeit von Ernst mit dem Landesamt habe es „zu keiner Zeit“ gegeben, ebenso wenig sei dieser V-Mann gewesen.

Die Rolle von Andreas Temme ist bis heute dubios. Der Verfassungsschützer war am Tatort, als der NSU im April 2006 in Kassel Halit Yozgat in seinem Internetcafé erschoss. Nur zufällig sei er dort gewesen, von dem Mord habe er nichts mitbekommen, beteuert Temme bis heute. Er wurde 2007 schließlich versetzt – und arbeitete zuletzt im Regierungspräsidium, das der im Juni erschossene Walter Lübcke (CDU) leitete. Zu dieser Tat bekannte sich Stephan Ernst: Er habe Lübcke wegen dessen Kritik an Geflüchtetengegner auf einer Bürgerversammlung 2015 getötet. Später widerrief er sein Geständnis.

Nach dem jetzigen Hinweis auf Temme halte er „einen Untersuchungsausschuss zum Mord an Walter Lübcke für nahezu unausweichlich“, erklärte der SPD-Parlamentsgeschäftsführer Günter Rudolph. Auch der FDP-Innenpolitiker Stefan Müller nannte es „erstaunlich“, dass die Information erst auf Nachfrage ans Licht komme. „Diese Informationspolitik ist ein weiteres Mal aufs Schärfste zu kritisieren. Der Innenminister bettelt um einen Untersuchungsausschuss.“ Der Linken-Innenexperte Hermann Schaus sagte ebenso: „Der Innenminister, CDU und Grüne legen ein Verhalten an den Tag, dass einen neuen Untersuchungsausschuss nahezu unumgänglich macht.“

Frühzeitige Löschung der Akte

Innenminister Beuth appellierte dagegen, sich „an die Fakten zu halten, anstatt durch haltlose Thesen Verschwörungstheorien zu bedienen“. Dass sich Temme, beim Verfassungsschutz zuständig für den Bereich Rechtsextremismus, auch mit dem damaligen Szeneangehörigen Ernst befasst habe, sei „nicht überraschend“. Beuth warnte die Opposition, „Sachverhalte unnötig zu skandalisieren“.

Quelle       :          TAZ         >>>>>             weiterlesen


Grafikquellen      :

Oben        —          Bründersen, Wolfhagen, von Westen


Unten          —         Peter Beuth auf dem 29. Parteitag der CDU Deutschlands am 6. Dezember 2016 in Essen

  • CC BY-SA 3.0Hinweise zur Weiternutzung
  • File:2016-12-06 Peter Beuth CDU Parteitag by Olaf Kosinsky-8.jpg
  • Erstellt: 2016-12-06 17:57:26

Abgelegt unter Hessen, P.CDU / CSU, Regierung, Überregional | Keine Kommentare »

Imperiale Gedankenspiele

Erstellt von DL-Redaktion am 16. Oktober 2019

Miserabler Aussenpolitiker, der ich bin

Quelle       :        untergrund-blättle  CH.

Von Eckhard Mieder

Ich hatte mich, das war zu Zeiten der DDR, entschieden, das Maul zu halten. Ich meine: das Maul zu halten, wenn es an Stamm-, Stuben- oder anderen Tischen außenpolitisch hoch- und herging.

Wenn räsoniert, schwadroniert, spekuliert wurde, als wären wir zwischen Wüsten, Metropolen, Parlamenten, Horizonten etc. heimisch. Ich weiß nicht, wie es an schweizerischen, spanischen, marokkanischen, chinesischen Quassel-Tischen zugeht -, mir kam es stets sehr, sehr deutsch vor, über die Welt Bescheid zu wissen und zu palavern.

Ich fand es ungehörig – plötzlich? irgendwann? weiß nicht mehr! -, über andere Völker, Regionen, Nationen und sowas zu urteilen. Ich hielt diese Unterhaltungen, in denen jeder alles über die fernen Orte, Konflikte, Ungereimtheiten dieser Welt wusste und seine Meinung knautschte, bis die Flasche leer war, nicht mehr aus. Ich kapierte da vieles nicht; ich kapiere bis heute den Lauf der Welt nicht; oder wissen Sie, was grad in Bali, Mali oder mit irgendeinem Ali gleich nebenan usw. geschieht? Oder doch.

Oder doch. Wenn ich die Welt als das Einfache nehme, das sie mir ist. Es gibt auf ihr massenhaft Menschen, die ihr Leben menschenhaft leben wollen. Und es gibt – relativ massenhaft – Menschen, die ihr Leben für menschenhafter halten als das der anderen. Es gibt also Politik und Leben. Es gibt Menschen und Menschen. So. Sortiert nach Sorten oder Ambitionen gibt es Menschen, die leben, Familien gründen, friedlich ihrer Wege ziehen oder einfach nur bleiben wollen. Und es gibt Menschen, die anders drauf sind. Imperialer. Süchtiger. Kriegerischer. (Haben die nicht auch Familie und die Freude auf einen Feierabend bei einem Glas Merlot/Riesling oder den Tagesbeginn mit einer Schüssel Müsli?)

Diese zweite Sorte Mensch (ich vereinfache gewiss, das mischt sich ja, wie sich alles mischt, gestern lief mir ein Regenwurm mit dem Gesicht amerikanischen Präsidenten, dessen Namen mir nicht einfiel, über den Weg; oder war es das Gesicht eines arabischen Präsidenten, dessen Namen mir ebenfalls entfallen war?) -, die zweite Sorte Mensch macht Politik. Im Namen der anderen Sorte Mensch, soweit es sich um eine Demokratie handelt. Und die mag Krieg. Die mag es, auf der Welt die Karten zu mischen. Die mag es, um des Profits willen – das sage ich so hin, obwohl ich keine Ahnung habe – mal da einzumarschieren, mal dort jemanden wegzuputschen, mal gleich wieder ein paar Flugzeuge oder bewaffnete Schiffe auf die Reise zu schicken … Ehrlich? Ist das so? Doch, so ist das, und ich finde das zum Kotzen.

Ich erinnere mich daran, wie es 1968 war. Als die Sowjets (darf man sagen; „Sowjets“ steht, glaube ich, nicht auf der List der Unwörter) in Prag einmarschierten. Da war ein Geschrei in der Welt, und jeder Schrei war ein Ruf nach Freiheit, Selbstbestimmung, Mündigkeit u. ä. Dann war das vorbei, so um 1990 rum. Plötzlich gab es – Freiheit, Selbstbestimmung, Mündigkeit u. ä. Und es gab Invasionen – plötzlich? irgendwie? weiß nicht mehr -, die … ja was? Die anders waren? Welche Schweinerei ist anders als – eine andere Schweinerei?

Welches Schlachtfest ist heiterer – als ein anderes Schlachtfest? Welches Massaker ist akzeptabler – als ein anderes Massaker? Jugoslawien, Irak, Libyen, Jemen, Syrien, irgendwie auch die Ukraine, irgendwie auch Venezuela – was, zum Teufel, geht auf dieser Welt vor? Was unterscheidet eine einstige Sauerei von einer Sauerei heute? Wieso haben wir uns daran gewöhnt, dass die zweite Sorte Mensch Schwein sein darf, und die erste Sorte Mensch leidet wie immer? Wäre ich blutrünstig, würde ich wünschen: Über den wirklichen Schweinen schwebe das Damokles-Schlachte-Beil. Mal sehen, was passiert.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikquelle         :      Porträt

Abgelegt unter Bücher, Medien, Sachsen-Anhalt, Überregional | Keine Kommentare »

Dringend- Solidaritätsaufruf:

Erstellt von DL-Redaktion am 16. Oktober 2019

Keine Einschüchterung durch Hohenzollern und Co.!

Ernst August von Hannover 1983 Hochzeit Ekaterina Malysheva Georg Friedrich Prinz von Preußen und Ehefrau Sophie Prinzessin von Preußen.jpg

Wer sieht sich so etwas denn noch an ? Nur Narren ?

Quelle      :    Scharf  —   Links

Von Hans-Gerd Öfinger

Liebe Kolleginnen und Kollegen,

am 26. August 2019 habe ich auf der von mir mit redigierten Website einen Artikel mit dem Titel „Hohenzollern und Co. enteignen“ veröffentlicht. Konkret geht es darin um aktuelle Meldungen, wonach die Familie Hohenzollern, Nachfahren von Kaiser Wilhelm II., seit Jahren geheime Verhandlungen mit dem Staat führt. „Ein Jahrhundert nach dem Ende der Monarchie in Deutschland fordern die Erben der Hohenzollern-Dynastie vom Staat massive Entschädigungen in Millionenhöhe, Kunstwerke sowie unentgeltliches Wohnrecht im Potsdamer Schloss Cecilienhof“, so der Vorspann. Der Artikel bezieht sich auch auf die vom Landesverband DIE LINKE Brandenburg und vom Vorstand der Partei DIE LINKE initiierte Online-Petition „Keine Geschenke den Hohenzollern!“. Darin werden die Entschädigungsforderungen auch unter Verweis auf die Verstrickung der Hohenzollern mit dem Naziregime strikt abgelehnt. Ich empfehle, diese Petition zu unterstützen. Die Fraktion DIE LINKE im Bundestag hat das Thema aufgegriffen und fordert in einer Kleinen Anfrage von der Bundesregierung Aufklärung über die nichtöffentlichen vertraulichen Verhandlungen mit der Familie Hohenzollern.

„Prinz v. Preußen ./. der funke“

Mein Online-Artikel wurde offenbar binnen weniger Stunden auch in Kreisen um Georg Friedrich Prinz von Preußen registriert und missfiel ihm. Der Prinz ist ein Ururenkel von Wilhelm II., der als letzter deutscher Kaiser für die Verbrechen des deutschen Imperialismus in den Kolonien und im 1. Weltkrieg steht, unter dem Druck der Novemberrevolution 1918 abdankte und in das niederländische Exil floh.

So setzte schon einen Tag später eine Berliner Anwaltskanzlei im Auftrag des Prinzen ein längeres Schreiben (Betreff: „Prinz v. Preußen ./. der funke“) samt vorgedruckter Unterlassungsverpflichtungserklärung auf. In einem weiteren Schreiben erreichte die Redaktion eine Gegendarstellung mit der Originalunterschrift des Prinzen. Es folgte über einen Monat lang eine rege Korrespondenz sowie Beratungen, die viele Ressourcen verschlangen.

Im Rahmen meiner Recherchen konnte ich auch weitere spannende Fakten zu Tage fördern, die ich nicht für mich behalten werde. Ich gehe davon aus, dass auch andere Personen, Medien, Historiker und Organisationen, die sich kritisch zu den Forderungen der Hohenzollern äußerten, mit ähnlich lautenden Mahnschreiben und Forderungen überzogen wurden. Nachdem die Brandenburger LINKE zwei im Artikel zitierte und vom Anwalt des Prinzen beanstandete Aussagen aus der Begründung der Online-Petition strich, sah ich mich ebenfalls zu einer entsprechenden Streichung veranlasst. Die wesentlichen Aussagen und politischen Schlussfolgerungen im Artikel bleiben davon allerdings unberührt.

Mit solidarischen Grüßen

Hans-Gerd Öfinger

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle       :       Hochzeitsgäste Georg Friedrich Prinz von Preußen und Ehefrau Sophie Prinzessin von Preußen vor der Marktkirche bei der Hochzeit von Ekaterina Malysheva und Ernst August von Hannoverg

Abgelegt unter Feuilleton, Niedersachsen, Traurige Wahrheiten, Überregional | Keine Kommentare »

Bodo, der Balancekünstler

Erstellt von DL-Redaktion am 12. Oktober 2019

Der Rote, den die Schwarzen lieben

2019-02-09 Viessmann Luge World Cup Oberhof StP 0103 LR10 by Stepro.jpg

Wer hat den größten Mund ?

Aus Vietnam und Thüringen Anna Lehmann

Ende Oktober wählt Thüringen. Bodo Ramelow, der einzige Ministerpräsident der Linkspartei, regiert dort seit fünf Jahren – und zwar so, dass selbst CDU-Anhänger sich eine weitere Amtszeit wünschen. Wie macht er das?

Gleich wird Bodo Ramelow in seine Vergangenheit hinabfahren, 800 Meter in die Tiefe. Das Bergwerk Merkers liegt im Westen Thüringens, an Hessens Grenze. Tausende Kilometer Stollen durchziehen die Landschaft unterirdisch.

Unter einem stählernen Förderturm warten an diesem warmen Augusttag der Leiter des Bergwerks, einige Politikerinnen und Journalisten. Zwei Dienstlimousinen mit Blaulicht fahren vor. Aus einer steigt Bodo Ramelow. Zusammen mit Gregor Gysi ist der Ministerpräsident Thüringens auf Wahlkampf-Wandertour. Beide sind mit Funktionshemden, Outdoorhosen und fabrikneuen Wanderstiefeln ausgerüstet. Dabei werden sie nach dem Bergwerksbesuch nur den 380 Meter hohen Hundskopf hochstapfen.

Zuvor fährt Ramelow in Merkers ein, heute ein Schaubergwerk mit Klettergarten und Konzerthalle. Die Kumpel, die hier noch arbeiten, sind vorwiegend mit Verfüllung beschäftigt, sie stopfen Hohlräume zu. Der Werksleiter schüttelt Ramelow die Hand. Ramelow boxt dem Mann daneben spielerisch vor die Brust. „Och, der Betriebsrat“, sagt er. Der Mann grinst.

Anfang der neunziger Jahre kämpfte Ramelow selbst als Arbeitnehmervertreter in Thüringen um Arbeitsplätze im Bergbau – gegen den westdeutschen Monopolisten, die Kali und Salz AG. Und gegen die Politik. Damals verlor er.

Fast 30 Jahre später kämpft er erneut um Arbeitsplätze im Bergbau. Diesmal zusammen mit K+S, wie die Kali und Salz AG heute heißt. Und die Politik ist er.

Selbstverständlich ist es nicht, dass die Gegner von einst nun Verbündete sind. So wenig wie es erwartbar war, dass die Linke, die erstmals einen Ministerpräsidenten stellt, nach fünf Jahren Regierung in Thüringen weder entzaubert noch zerstritten ist. Wenige Wochen vor der Landtagswahl führt sie sogar in den Umfragen.

Fast 25 Jahre hat die CDU das Land regiert. Bis 2014 Ramelow kam. Seit fünf Jahren führt er eine Koalition aus Linken, SPD und Grünen, die sich auf nur eine Stimme Mehrheit im Landtag stützt. Derzeit ist völlig offen, welche Konstellation nach dem 27. Oktober regieren könnte. Sicher ist nur: Wenn die Linke gewinnt, dann wegen Bodo Ramelow.

Die Partei weiß das. Alle Großplakate zeigen Ramelows Konterfei – mal als Lokführer, mal als Spaziergänger. Personenkult? Na klar doch.

„Seilfahrt“. Hinab saust der Korb mit Ramelow in die „Teufe“, wie es bergmännisch heißt. In der salzhaltigen Luft der Kaligrube erzählt Ramelow, jetzt in blauem Bergmannskittel und mit weißem Helm, in einer Bar in 807 Meter Tiefe, wie er sich 2015 mit dem Vorstandsvorsitzenden von K + S, Norbert Steiner, aussöhnte.

Kalischacht Bleicherode, Thüringen 8.JPG

Der Steiner sei ein Raubatz, wie er selbst, sagt Ramelow. „Alle haben gedacht: Weil ich damals auf der Seite der Kalikumpel war, würde ich niemals mit dem reden können.“ Aber man sei sich auf Augenhöhe begegnet und habe Frieden geschlossen.

Bodo Ramelow ist ein Mann der Gegensätze. Der Ministerpräsident ist aufbrausend und eitel, rechthaberisch und rauflustig. Mal kotzt ihn die Antifa an, mal der MDR. Mit Nazis und der AfD legt er sich seit jeher an. Wenn er auf Autofahrten allein mit seinem Handy ist, schwitzt sein Team. Ramelows Twitter-Scharmützel sind gefürchtet. Seine Mitarbeiter räumen hinter dem Chef auf.

Corinna Hersel traf Bodo Ramelow im Frühjahr 1990 zum ersten Mal. „Jetzt kommt der aus dem Westen und will uns die Welt erklären“, dachte sie damals. Hersel ist heute Verdi-Bezirksgeschäftsführerin, damals arbeitete sie für die Ost-Gewerkschaft Handel, Nahrung und Genuss. Ramelow, den die hessische Gewerkschaft Handel, Banken und Versicherung nach Thüringen entsandt hatte, traf dort auf viele tausend Frauen, die gerade ihre Arbeitsplätze verloren. Die Treuhand löste die Handelsorganisation der DDR auf. Von ihm habe man Wunder erwartet, erzählt Ramelow. „Die Menschen haben ja gedacht: Ich als Westdeutscher muss es wissen.“

Der Gewerkschaftssekretär aus Mittelhessen landet mitten im Osten und jener Umbruchzeit, deren Verwerfungen heute, 30 Jahre nach dem Mauerfall, wieder aufbrechen. Ramelow sieht, wie massenhaft Betriebe plattgemacht werden und sich Menschen von der gerade erkämpften Demokratie wieder abwenden.

Stunden hätten sie zusammen in Betriebsversammlungen verbracht, erzählt Hersel. Aus dem „arroganten Arsch“ wurde der Bodo – „einer, der immer für uns da war, den man auch mal nachts anrufen konnte“.

Der aber auch jähzornig sein kann. Als die Aktentasche mit dem frisch ausgehandelten Tarifvertrag beim Grillabend verschwindet, tobt er. Der Vertrag findet sich später in der Mikrowelle, jemand hatte sie als Tresor ausgewählt, als Ort für besonders Schützenswertes. Ramelow kann sich aber auch entschuldigen. „Das hat ihm viele Punkte eingebracht“, sagt Hersel.

Drei Jahre später, als auch die Kaligruben im Osten geschlossen werden sollen, wird aus dem Gewerkschafter Bodo der Politiker Ramelow. Die Schließung der Grube in Bischofferode 1993 habe ihn politisiert, erzählt Ramelow. „Sonst wäre ich immer noch der nette Gewerkschaftssekretär, der schaut, wann der nächste Tarifvertrag um die Ecke kommt.“

Die Treuhand-Anstalt, die das Volksvermögen der DDR privatisiert, plant damals die ostdeutschen Gruben mit dem westdeutschen Monopolisten Kali und Salz zu fusionieren. Der Schönheitsfehler: Zusammen produzieren die Gruben mehr Kali, als der Markt braucht, also sollen vor allem Gruben im Osten geschlossen werden. Die Bischofferoder Kumpel besetzen die Grube und treten im Sommer 1993 in den Hungerstreik. Die IG Bergbau macht nicht mit, stattdessen kommt der HBV-Sekretär Ramelow. „Wer bist’n du? Mach dich vom Tor“, empfangen ihn die Kumpel. Ramelow bleibt, obwohl er für Bergbau nicht zuständig ist. Er verstehe das Problem, sagt er, er wolle helfen.

Was der Gewerkschafter Ramelow damals nicht verstand: Bischofferode war nur ein kleiner Stein in einem größeren Spiel. In den geheimen Verträgen zwischen der Treuhand und Kali und Salz, die erst 20 Jahre später geleakt werden, stand, was viele ahnten: Die Schließung von Bischofferode war politisch gewollt. Die Treuhand hatte der Kali und Salz AG die Grube regelrecht aufgedrängt: Um den Erhalt von Jobs sollte sich der Konzern nicht scheren, für Verluste und ökologische Altlasten würden größtenteils die Steuerzahler haften. Die Arbeitsplätze im Westen waren wichtiger.

Als zum Jahresende 1993 alle Verhandlungen gescheitert sind, handelt Ramelow im Auftrag der Kumpel die Sozialpläne mit der Treuhand aus. Warum sie ihm doch vertraut haben? „Der war kein Phrasendrescher, hat sich reingekniet“, erzählt Gerhard Jüttemann, damals stellvertretender Betriebsratsvorsitzender. „Er war immer da: mit Informationen und Adressen – und vorbereitet, wie kaum einer sonst.“

Jüttemann, weißer Bart, schwarze Bergmannskluft, ist mit anderen ehemaligen Kumpeln nach Erfurt gekommen, wo die Rosa-Luxemburg-Stiftung im August 2019 eine Ausstellung über die Treuhand eröffnet. Es ist voll. Jüttemann erwartet Ramelow vor der Tür, sie begrüßen sich mit Schulterklopfen. „Bodo“ – „Gerd“.

Die Leiterin der Luxemburg-Stiftung spricht zur Eröffnung von der „Entwertung von Biografien“. Und sagt: „Es war nicht eure Schuld.“ Einige der Ältere weinen. Ramelow schaut zu Boden, nickt.

Bischofferode wird ein Wendepunkt: Menschen, die vier Jahre vorher noch skandierten „Wir sind ein Volk“, sind nun zutiefst enttäuscht. Und Ramelow? Tritt 1999 in die PDS ein, wird Fraktionschef in Thüringen, sitzt später im Bundestag, managt die Fusion von WASG und PDS zur Linken und kehrt nach Thüringen zurück.

2009 tritt er zum ersten Mal als Ministerpräsidentenkandidat an, die SPD koaliert aber als Juniorpartner mit der CDU. 2014 wird die Linke erneut zweitstärkste Partei, Ramelow schmiedet eine Koalition mit SPD und Grünen und stellte sich im Landtag zur Wahl. Im ersten Wahlgang fällt er durch. Im zweiten Versuch klappt es.

File:NNU đền Ngọc Sơn.jpg

Bodo Ramelows Besuch im Ngoc-Son-Tempel in Hanoi

In Ramelows Arbeitszimmer in der Staatskanzlei steht eine Lampe aus Metall – die letzte Grubenlampe aus Bischofferode. „Darum sitze ich hier“, sagt er, als die taz im Frühjahr 2017 auf der Besuchercouch sitzt. In Erinnerung an den schwersten Arbeitskampf im Osten kämpft er jetzt um die 4.500 Arbeitsplätze im Bergbau Thüringens.

Aber Kalivorräte sind endlich, außerdem wird die Lauge seit Jahren in den Fluss Werra entsorgt und versalzt das Wasser. Auch Ramelow weiß, dass die Zukunft anders aussieht.

Quelle        :      TAZ        >>>>>         weiterlesen


Grafikquellen         :

Oben          —      Viessmann Luge World Cup Oberhof; Ministerpräsident Bodo Ramelow mit Schneemann „Flocke“; Maskottchen, mascot


2.)   von Oben        —       Kalischacht Bleicherode, Thüringen


Unten       —       Casablanca1911 at Vietnamese Wikipedia

This work has been released into the public domain by its author, Casablanca1911 at the Wikipedia project. This applies worldwide.

Abgelegt unter Feuilleton, L. Thüringen, P. DIE LINKE, Überregional | 1 Kommentar »

Die Linke – Saarland

Erstellt von DL-Redaktion am 12. Oktober 2019

Prozess gegen Linke-Politiker wegen Titelmissbrauchs


Saarlouis (dpa/lrs)

Der saarländische Linke-Politiker Andreas Neumann (45) muss sich wegen des Vorwurfs des Missbrauchs von Titeln vor Gericht verantworten. Es komme am 31. Oktober vor dem Amtsgericht Saarlouis zu einem Prozess, nachdem Neumann gegen einen Strafbefehl Einspruch eingelegt habe, teilte das Gericht am Freitag mit. Das Amtsgericht hatte am 4. September gegen Neumann einen Strafbefehl erlassen, weil dieser nach der Vorlage von Dokumenten einer nicht existierenden Universität fälschlicherweise über Jahre einen Doktortitel getragen haben soll.

Es erging eine «Verwarnung mit Strafvorbehalt» – quasi eine Geldstrafe auf Bewährung: Die Verurteilung zu 90 Tagessätzen zu je 50 Euro – also insgesamt 4500 Euro – sollte vorbehalten bleiben. Zudem wurde eine Bewährungsauflage von 1800 Euro ausgesprochen. Neumann habe sich im Rahmen des bisherigen Verfahrens zu dem Tatvorwurf nicht eingelassen, hieß es vom Gericht.

File:Amtsgericht, Prälat-Subtil-Ring 10, Saarlouis.jpg

Der Ortsverband der Linke in Saarbrücken-Malstatt hatte am 9. September beschlossen, einen Antrag auf Parteiausschluss von Neumann zu stellen, sobald der Strafbefehl gegen ihn rechtskräftig geworden sei. Nach Ansicht der Linken hat Neumann «dem Ansehen und der Glaubwürdigkeit der Partei» im Saarland schwer geschadet.

Quelle       :          Welt           >>>>>          weiterlesen


Grafikquellen         :

Oben       —           dieLinke Stadtratsfraktion Saarbrücken 05.02.2010; Birgit Huonker, Andreas Neumann, Astrid Schramm


Unten       —      Amtsgericht, Prälat-Subtil-Ring 10, Saarlouis

Author Saarbraut

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

Abgelegt unter Medien, P. DIE LINKE, Saarland, Überregional | Keine Kommentare »

Aufgeklärt nach 50 Jahren

Erstellt von DL-Redaktion am 11. Oktober 2019

Antikolonialer Anschlag in Hamburg

Von Wolfgang Kraushaar

1969 detonierten auf einer Werft 20 Kilo Sprengstoff. Täter konnten nie ermittelt werden. Erst jetzt erfahren wir mehr über die Tat von Linken.

Der 13. Oktober 1969 ist ein Montag. Für die Bundesrepublik erweist sich der Wochenbeginn als ein schwarzer Tag. Die Bundeswehr verliert in der Nähe des Fliegerhorstes Memmingen ihren 100. Starfighter, jenes von der US-Rüstungsfirma Lockheed produzierte und 1958 vom damaligen Bundesverteidigungsminister Franz Josef Strauß trotz erheblicher Bedenken von Experten in hoher Stückzahl angekaufte Kampfflugzeug F-104 G. Auch wenn sich der 28-jährige Hauptfeldwebel Maximilian Ambs mit dem Schleudersitz retten kann, ist allein schon der symbolische Schaden enorm. Im Gegensatz zu einem anderen Vorkommnis dieses Tages stellt das Unglück eines der Top-Themen in der Presseberichterstattung des darauffolgenden Tages dar.

Im Hamburger Hafen gehen am frühen Morgen des 13. Oktober zwei Warnanrufe ein. Der erste erreicht um 6.13 Uhr eine Polizeistation, der zweite zwei Minuten später den Werkschutz von Blohm & Voss. Die 1877 gegründete Großwerft war mit der Produktion von Kriegsschiffen tief in den Nationalsozialismus verstrickt, wurde nach Kriegsende von den Briten geschlossen, teilweise demontiert, war aber 1955 wieder zugelassen worden und zu Beginn der sechziger Jahre dazu übergegangen, erneut Kriegsschiffe zu bauen. Ein anonymer Anrufer fordert: „Lassen Sie sofort die Korvette ‚João Coutinho‘ räumen: wir sprengen das Schiff in die Luft!“

Es dauert keine 20 Minuten, bis es tatsächlich so weit ist und um 6.32 Uhr ein Sprengsatz explodiert. Getroffen wird jedoch nicht so sehr das Kriegsschiff des Nato-Partnerlandes, sondern eine zwischen Kaimauer und der Korvette befindliche Schute. Den nicht sonderlich großen Kahn, der dem Transport von Gütern und Materialien dient, hat es so schwer erwischt, dass er in kurzer Zeit am Steinwerder-Kai versinkt. An der Korvette selbst, heißt es, sei nur geringer Sachschaden entstanden. Menschen sind nicht verletzt worden.

Die Reaktionen in der Presse sind eher bescheiden. Lediglich das Hamburger Abendblatt und die lokale Ausgabe der Bild-Zeitung informieren ihre Leser über das Ereignis. Später wird sich zeigen, dass das insbesondere bei den für den Anschlag Verantwortlichen für Verwunderung sorgt. Denn sie waren nicht nur davon überzeugt, dass sie eine spektakuläre antikolonialistische Aktion verübt hätten, sondern dass diese auch ohne die Verbreitung eines Bekennerschreibens durch das Medien-Interesse für die gewünschten Multiplikatoreneffekte sorgen würde.

Die Polizei tappt nach dem Anschlag im Dunkeln

Ganz im Gegensatz zum mangelnden Echo in der Presse widmen sich einige linke Gruppen und Zeitungen dem Anschlag. Überraschenderweise ist es aber eine niederländische Gruppierung, die als Erstes darauf reagiert. Ein in dem Nachbarland aktives Angola-Komitee lässt es sich nicht nehmen, die versuchte Attacke als antikolonialistische Aktion uneingeschränkt zu begrüßen. An Spekulationen beteiligen sich mehrere linksradikale Blätter. So wird etwa von der in Westberlin erscheinenden Wochenzeitung agit 883 behauptet, dass die Sabotageaktion von Werftarbeitern verübt worden sei.

Die mit dem Anschlag befassten Ermittler ­geben am Tag darauf bekannt, dass von den Tätern jede Spur fehle, man aber vermute, dass sie aus den Reihen einer antikolonialistisch eingestellten Organisation stammen würden. Konkret genannt werden das Governo Revolucionário de Angola no Exilio (Angolanische Revolutionsregierung im Exil, GRAE) und die Movimento Popular de Libertação de Angola(Volksbewegung für die Befreiung Angolas, MPLA). Diese beiden Organisationen würden auch, heißt es weiter, über Mitglieder in europäischen Studentenbewegungen verfügen. Mitglieder beider Organisationen hatten immer wieder mit Flugblattaktionen gegen den Bau derartiger Korvetten im Hamburger Hafen protestiert, zuletzt beim Stapellauf der „João Coutinho“ am 2. Mai.

Portugal tut im Übrigen so, als ginge es die Angelegenheit nichts weiter an. Ein Sprecher des in Hamburg befindlichen Generalkonsulats erklärt, dass „die Sache“ sie nicht betreffen würde. Solange die Schiffe nicht der Regierung ihres Landes übergeben worden und bis dahin Eigentum der Werft seien, hätten sie damit nichts zu tun.

Bei den 84 Meter langen und 10 Meter breiten Korvetten, die eine Besatzung von 70 Mann aufnehmen können, handelt es sich um eine eigene Schiffsklasse, die sogenannte „João-Coutinho“-Klasse. Die Schiffe verfügen über zwei 7,6-cm-Geschütze und zwei 4-cm-Maschinenkanonen in Doppellafetten. Portugal will sie zur Bekämpfung der in seinen Kolonien aktiven Guerillabewegungen einsetzen, die für die Unabhängigkeit ihrer Länder kämpfen. Nach ihrer Indienststellung sollen sie bei Patrouillenfahrten und Kampfeinsätzen in Angola, Mosambik, Guinea-Bissau und vor den Kapverden zum Einsatz kommen.

Trotz aller Anstrengungen verlaufen die von der Hamburger Staatsschutzabteilung K4 angestrengten Ermittlungen ergebnislos. Zwar sollen als verdächtig geltende Werftangehörige verhört und Mitglieder des Sozialistischen Lehrlingszentrums (SLZ) über Monate hinweg überwacht worden sein, aber niemand von ihnen wird festgenommen oder gar vor Gericht gestellt. Von den Urhebern des Anschlags fehlt jede Spur.

Erst 50 Jahre später beginnt die Aufarbeitung

Es wird schließlich ein halbes Jahrhundert dauern, bis sich das ändert. Die Betreffenden entscheiden, einen Bericht über Gründe und Hintergründe ihres Anschlags zu verfassen. Ihre Überlegungen sind eingebunden in einen kollektiven Erinnerungsprozess. Als sich die 68er-Bewegung im letzten Jahr zum 50. Mal jährte, trafen sich rund dreißig ehemalige Aktivisten – zum ganz überwiegenden Teil einstige Mitglieder des legendären Sozialistischen Deutschen Studentenbundes (SDS).

Die Hamburger Ehemaligen wollten es nicht bei einem einmaligen Treffen bewenden lassen, sondern einen Arbeitskreis bilden, um ihre eigene Geschichte aufzuarbeiten. Als ein Vorgriff auf diesen Schritt ist dem Autor von einem Sprecher der Ehemaligengruppe ein Anfang März 2019 verfasster Bericht zugestellt worden, in dem der Auslöser für den Anschlag im Hamburger Hafen sowie der Ablauf der Aktion minutiös dargelegt wird. Auch wenn niemand der daran Beteiligten bereit ist, mit seinem Namen nachträglich für das Geschehene einzutreten, so gibt es keinen plausiblen Grund, an der Authentizität ihrer Darstellung zu zweifeln.

Es ist allgemein bekannt, dass die „Entdeckung“ der Dritten Welt samt den zahlreichen in Afrika, Asien und insbesondere in Lateinamerika aktiven Befreiungsbewegungen zu den Schwerpunkten der 68er-Bewegung zählte. Diese Hinwendung war maßgeblich durch die Nachrichten vom Vietnamkrieg befördert worden. Die grauenerregenden Bilder, die Tag für Tag von den südostasiatischen Schauplätzen per TV zu sehen waren, erschütterten insbesondere große Teile der jüngeren Generation.

Der Antikolonialismus ging aber weit über Vietnam als US-Stützpunkt hinaus, denn es ging dabei auch um den Restbestand an von europäischen Mächten beherrschten Ländern wie Angola. Im Frühjahr 1969 wurde dieser Aspekt von den Protestierenden aufgegriffen. So schlug etwa der seit dem Mai 1968 wegen Verletzung der Rathaus-Bannmeile mit Haftbefehl gesuchte Karl Heinz Roth, ein SDS-Kader, die Durchführung einer eigenen Kampagne gegen den Neokolonialismus vor, in deren Verlauf auch über den von Portugal in seinen afrikanischen Kolonien praktizierten Krieg aufgeklärt werden müsse.

Diese Bezugnahme kam nicht von ungefähr, denn es war den Protestierenden bereits bekannt, dass drei für die portugiesische Marine bestimmte Korvetten demnächst vom Stapel laufen sollten. Aus diesem Grunde hatte sich auch die MPLA Anfang April in Schreiben an die Geschäftsleitung sowie den Betriebsrat von Blohm & Voss gewandt und darin festgestellt, dass mit dem Bau der Kriegsschiffe eine Entscheidung für den portugiesischen Kolonialismus und damit zugleich auch für die Unterdrückung des angolanischen Volkes gefällt worden sei.

Und am Ende desselben Monats meldete sich mit Amilcar Cabral der Anführer einer anderen Befreiungsbewegung, der in Guinea-Bissau einer an der afrikanischen Westküste gelegenen portugiesischen Kolonie – aktiven Partido Africano da Independência da Guiné e Cabo Verde (PAIGC) zu Wort. Er spitzte die Vorwürfe dahin­gehend zu, dass die bei Blohm & Voss gebauten Fregatten „für den Völkermord im Kolonialkrieg gegen unser afrikanisches Volk bestimmt“ seien. Er richte deshalb an alle Kräfte, die sich für Recht und Freiheit einsetzen würden, „… die dringende Aufforderung, der Kollaboration zwischen den Regierungen in Bonn und Lissabon auf politischer, militärischer, wirtschaftlicher und finanzieller Ebene durch wirksame Aktionen ein Ende zu setzen“.

Zur selben Zeit führte der AStA im Auditorium Maximum der Universität eine Informationsveranstaltung zu dem in immer weiteren Kreisen als skandalös betrachteten Fall des Korvettenbaus durch. SDS-Mitglieder verteilten dort ein Flugblatt, auf dem auch der Brief der MPLA abgedruckt war.

Eine Hamburger Kommune bedenkt, was man tun kann

Der Bericht aus der Gruppe von Hamburger Ex-SDSlern beginnt damit, dass der Besuch eines niederländischen Kamerateams geschildert wird, das im Herbst 1968 in einer Hamburger Kommune vorbeigekommen war, um nähere Informationen über die drei im Bau befindlichen portugiesischen Korvetten zu gewinnen. Die in der im Stadtteil Harvestehude gelegenen Hochallee 21 lebende Kommune hatte die Aufmerksamkeit des Filmteams errungen, weil in einigen zum Thema portugiesischer Kolonialismus verteilten Flugblättern ihre Adresse gestanden hatte.

Quelle         :          TAZ        >>>>>          weiterlesen


Grafikquellen      :

Oben       —          Werksgelände von Blohm + Voss: vorne die Einfahrt, mittig das Verwaltungsgebäude, rechts dahinter das Trockendock Elbe 17, oben rechts Dock 10