DEMOKRATISCH – LINKS

                      KRITISCHE INTERNET-ZEITUNG

RENTENANGST

Archiv für die 'Mensch' Kategorie

Missbrauchte Lebewesen

Erstellt von DL-Redaktion am 13. Dezember 2019

Datei:Schlachtung5.jpg

Von Hilal Sezgin

Dass Tierversuchsanstalten Untersuchungsergebnisse fälschen, dürfte kein Einzelfall sein. Bundesweit gibt es immerhin mehr als 700 solcher Labore.

Genau zwei Monate ist es her, dass die Tierrechtsorganisation Soko Tierschutz heimliche Aufnahmen aus dem Innern der Tierversuchslabore der Firma LPT veröffentlicht hat; und wie viel mehr ist seither ans Tageslicht gekommen! LPT steht für Laboratory of Pharmacology and Toxicology GmbH & Co. KG; diese Firma unterhält in Hamburg und Umgebung mehrere Labore, in denen Pharmazeutika und weitere chemische Substanzen an Tieren auf Giftigkeit getestet werden.

Noch vor wenigen Jahren hat die Firma auf ihrer Website offen ihr Leistungsspektrum dargestellt; angeboten wurden Tests an Mäusen, Ratten, Hamstern, Meerschweinchen, Kaninchen, Hunden, Affen, Katzen, Schweinen, Fischen und Vögeln, und zwar mit folgenden Methoden: oral, intraperitoneal (in die Bauchhöhle), intravenös, per Infusion, dermal, per Inhalation, intravaginal, intrathekal (ins Rückenmark), rektal und per Eingabe in den Augenlidsack.

Solche Giftigkeitstests sind zwar bislang vorgeschrieben, aber zumeist nicht genehmigungspflichtig. Ihre Durchführung verläuft im völligen Graubereich, wird fast nie durch Veterinärämter kontrolliert. Der gemeinnützige Verein Soko Tierschutz hatte einen Automechaniker als Tierpflegehelfer eingeschleust, der berichtete, dass sich unter seinen Kollegen nur ein einziger ausgebildeter Tierpfleger befand; die anderen waren Schlachter, Mechaniker und ein Militärmusikant.

Sogar wenn solche Versuche ordnungsgemäß durchgeführt werden, ist ihre Aussagekraft mehr als zweifelhaft. Wenn Sie Hund oder Katze besitzen, wissen Sie, dass denen Schokolade giftig werden kann; Eichhörnchen knabbern unbeschadet am Fliegenpilz. Dass Contergan Fehlentwicklungen am menschlichen Fötus hervorrufen würde, konnte man aufgrund der vorherigen Tierversuche nicht ahnen; jedes Jahr müssen Medikamente vom Markt genommen werden, weil sie sich im Tierversuch als „unbedenklich“ erwiesen hatten, bei der Anwendung am Menschen aber nicht. Zur eigenen Sicherheit, also um teure Ausfälle und Schadensersatzforderungen zu vermeiden, testen viele Firmen längst nicht mehr nur im Tierversuch, sondern zum Beispiel auch mithilfe von Zellkulturen. Dass das Gesetz immer noch auf dem Tierversuch beharrt, ist daher ohnehin antiquiert.

Ausgeschnittene Tattoonummer

Im Falle von LPT meinte der Soko-Mitarbeiter zudem zu beobachten, dass mindestens einmal Daten gefälscht wurden, damit sie zu den erwünschten Ergebnissen „passten“. Diese Anschuldigungen wurden seither durch ehemalige Mitarbeiter des Unternehmens bestätigt. Der frühere Leiter der Hämatologie sagte gegenüber dem TV-Magazin Fakt aus, dass in einer Krebsstudie die Organe eines verstorbenen Affen ausgetauscht worden waren: „Man hat die Tattoonummer, die sich im Brustbereich des Tieres befindet, ausgeschnitten. Diese hat man nach dem Ende der Studie den Organen des ersetzten Tieres hinzugefügt.“ Ein weiterer Mitarbeiter erinnert sich an Manipulationen von Fakten, die bereits 2005 der zuständigen Hamburger Behörde gemeldet worden seien.

Damals ist anscheinend nicht viel geschehen, doch vor zwei Wochen wurden mehrere Labore und Geschäftsräume der LPT von Staatsanwaltschaft und Veterinäramt durchsucht und anscheinend wurde umfangreiches Material mitgenommen. Mehrere Firmen haben Aufträge ans LPT zurückgezogen; das Unternehmen selbst verkündete, ein Labor zu schließen. Mehrere Großdemonstrationen gegen Tierversuche, an denen jeweils bis zu 15.000 Menschen teilnahmen, gingen voraus. Dem steht bisher ein großes Schweigen deutscher Forschungseinrichtungen und des zuständigen Berliner Ministeriums gegenüber.

Quelle       :         TAZ           >>>>>        weiterlesen

———————————————————————-

Grafikquellen      :

Oben            —     Schlachtung auf Burg Loket

Urheber Straktur

Ich, der Urheberrechtsinhaber dieses Werkes, veröffentliche es als gemeinfrei. Dies gilt weltweit.

—————————–

Unten       —          Peta  —     dinamicline [CC BY-SA 3.0 (https://creativecommons.org/licenses/by-sa/3.0)], via Wikimedia Commons

Abgelegt unter Deutschland, Ernährungspolitik, Positionen, Umwelt | Keine Kommentare »

Frauenrechts-Aktivistinnen

Erstellt von DL-Redaktion am 13. Dezember 2019

Diese mutigen Frauen hätten im 2019 Schlagzeilen verdient

Nasrin Sotoudeh portrait-1.png

Frauenrechtsanwältin Nasrin Sotoudeh – Iran – ist zu insgesamt 38 Jahren Gefängnis verurteilt worden.

Quelle          :         INFOsperber    CH.

Von Barbara Marti

Medien informieren manchmal über Frauenrechts-Aktivistinnen in China oder Iran, doch selten über ebenso mutige in andern Ländern.

Von der Inhaftierung einer Anwältin in China oder über Schikanen gegen eine andere Anwältin im Iran wurde berichtet. Dagegen informieren die gleichen Medien kaum über etliche Frauenrechts-Aktivistinnen in andern Ländern, die teilweise seit Jahren oder sogar Jahrzehnten für gleiche Rechte kämpfen und einer mindestens so grossen Repression ausgesetzt sind. Im laufenden Jahr 2019 hätten folgende Frauen aus Afghanistan, Sudan, Uganda und Südafrika Schlagzeilen machen müssen.

Einsatz unter Lebensgefahr

  • Ihsan Fagiri: Die Ärztin engagiert sich als Mitgründerin der Frauenrechtsorganisation «No to Women’s Oppression» seit Jahren im Sudan gegen die Diskriminierung von Frauen. Als besonders mutig gilt ihr Engagement für Frauen, die im Bürgerkrieg Opfer von Vergewaltigungen als Kriegswaffe wurden. Fagiri arbeitet unter Lebensgefahr und war aus politischen Gründen auch schon in Haft. Sie gilt als eine der zentralen Persönlichkeiten aus der Zivilgesellschaft, die im Frühjahr zum Sturz des Langzeitdiktators Omar al-Bashir beitrugen. Ihr Engagement für Frauenrechte ist seither nicht weniger gefährlich geworden, da ein führendes Mitglied des regierenden Militärrates einer ihrer gefährlichsten Widersacher ist. Für ihr unermüdliches Engagement für Frauenrechte hat die Stadt Weimar der mutigen Frau im Herbst den Menschenrechtspreis verliehen. In der Laudatio hiess es, dass der Preis Fagiri «einen gewissen Schutz durch die grosse Öffentlichkeit» geben soll.
  • Zarifa Ghafari: Die 26-Jährige trat im Frühjahr als eine der ersten Frauen in Afghanistan ein Bürgermeisteramt an. Ihre Aufgabe sei es, die Menschen von Frauenrechten und der Tatkraft von Frauen zu überzeugen, schrieb sie auf Twitter. «Ich werde beweisen, dass Frauen nicht schwach sind.» Der Afghanische Präsident Ashraf Ghani hatte sie schon neun Monate zuvor zur Bürgermeisterin ernannt. Doch an ihrem ersten Arbeitstag drang ein Männer-Mob in ihr Büro ein und bedrohte sie mit Steinen und Stöcken. Paramilitärs retteten sie. «Komm nicht zurück», schrie ihr der männliche Mob nach. Doch Monate später trat sie – schwer bewacht – ihr Amt an. Der konservative Provinzchef, den Ghafari hinter dem Männer-Mob vermutete, war zurückgetreten. Ghafari werde vom IS und den Taliban mit dem Tod bedroht, sagte sie kürzlich der «New York Times». Doch sie habe mehr Angst vor kriminellen Syndikaten, die in den lukrativen und hoch korrupten Handel mit Land involviert sind. Einer sei in ihr Büro gekommen und habe sie mit dem Tod bedroht, falls sie bleibe. Ghafari: «Ich werde hierbleiben und versuchen, die Gesellschaft zu verändern.»

Frauenrechtsaktivistinnen im Gefängnis

  • Stella Nyanzi: Die Lektorin für medizinische Anthropologie engagiert sich seit Jahren in Uganda für Frauen- und Menschenrechte. Im Sommer ist sie zu anderthalb Jahren Gefängnis verurteilt worden, weil sie Langzeitpräsident Yoweri Museveni vorwarf, «jegliche Moral und Professionalität» in den Institutionen Ugandas abzubauen. Vor zwei Jahren sass Nyanzi bereits einmal im Gefängnis, weil sie das Präsidentenpaar beleidigt hatte. Anlass war, dass Museveni im Wahlkampf 2016 kostenlose Binden für Schülerinnen und eine Bildungsoffensive für Mädchen versprochen hatte, nach gewonnener Wahl aber untätig blieb. Beides sind zentrale Forderungen von Frauenrechtsaktivistinnen, da viele Mädchen während ihrer Periode nicht zur Schule gehen, weil sie sich Monatshygiene nicht leisten können. Nyanzi kam schliesslich nach internationalen Protesten auf Kaution frei. Jetzt wolle sie im Gefängnis bleiben, berichten jedenfalls britische Medien. Sie fühle sich dort sicherer, könne junge Frauen ausbilden und ihnen eine Stimme geben.
  • Anders als über Stella Nyanzi informierten grosse Medien bei uns ausführlich über Nasrin Sotoudeh aus dem Iran: Die Anwältin war Anfang dieses Jahres im Iran in einem unfairen Verfahren zu 33 Jahren Gefängnis und 148 Peitschenhieben verurteilt worden. Die Anklage lautete unter anderem auf «Verschwörung zur Gefährdung der nationalen Sicherheit», «Anstiftung zu Korruption und Prostitution», «Auftreten in der Öffentlichkeit ohne Kopftuch», «Störung der öffentlichen Ordnung» und «Aufwiegeln der öffentlichen Meinung». Zusammen mit einem Urteil aus einem anderen Verfahren beläuft sich ihre Gefängnisstrafe auf insgesamt 38 Jahre. Nach iranischem Recht muss sie davon mindestens 17 Jahre absitzen, schreibt «Amnesty International». Zuletzt arbeitete Sotoudeh an der Verteidigung von Frauen, die letztes Jahr öffentlich gegen den Kopftuchzwang protestiert hatten und deshalb im Gefängnis landeten. Sotoudeh ist schon mehrmals wegen ihres Engagements für Frauenrechte zu langjährigen Haftstrafen verurteilt worden.

Jianmei Guo of China - 2011 International Women of Courage awardee.png

 Guo Jianmei in China

Kritik an Regierungen

  • Lucinda Evans: Die Frauenrechtsaktivistin aus Südafrika engagiert sich mit ihrer Nichtregierungsorganisation «Philisa Abafazi Bethu» seit Jahren gegen sexuelle Gewalt an Frauen und Mädchen. Evans kritisiert öffentlich die Regierung, weil sie zu wenig unternimmt, um die grassierende Gewalt gegen Frauen zu stoppen. Zuletzt sprach sie im Herbst an einer Kundgebung vor tausenden Frauen in Kapstadt. «Ich frage die Ministerinnen: Wann zieht ihr endlich diese Männer zur Verantwortung, die schon so lange versagen?»
  • Anders als Lucinda Evans schaffte es Guo Jianmei in China in die Schlagzeilen unserer Medien : Die Anwältin erhielt in diesem Herbst sogar den Alternativen Nobelpreis «für ihre bahnbrechende und beharrliche Arbeit zur Sicherung der Frauenrechte in China». Guo Jianmei gründete 1995 das erste Rechtsberatungszentrum für Frauen. Träger war zuerst die Universität Peking, später eine Nichtregierungsorganisation. Betroffene sexueller Übergriffe, Wanderarbeiterinnen und Angestellte in Diskriminierungsverfahren erhielten vom Zentrum Rechtsberatung und -beistand. Für arme Frauen waren diese kostenlos. 2016 schloss die Regierung das Zentrum ohne Begründung. Als im gleichen Jahr das Gesetz zum Schutz vor häuslicher Gewalt in Kraft trat, kritisierte Guo Jianmei, dass Ausführungsbestimmungen fehlen. Das fortschrittliche Gesetz werde deshalb nie zur Anwendung kommen. Die heute 58-Jährige hatte schon in jungen Jahren darauf hingewiesen, dass Frauen in China zwar rechtlich weitgehend gleichberechtigt sind, die entsprechenden Gesetze aber zu selten angewendet werden. Guo Jianmei konnte den Alternativen Nobelpreis nicht persönlich entgegennehmen, da ihr die Regierung offenbar die Ausreise verweigerte.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Keine. Die Autorin ist Redaktorin und Herausgeberin des Online-Magazins «FrauenSicht».

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

——————————————————————

Grafikquellen         :

Oben        —        Nasrin Sotoudeh

Source https://twitter.com/ashourinia/status/1111680577428586497?s=21
Author Arash Ashourinia

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

—————————

Unten          —         2011 International Women of Courage awards

Abgelegt unter International, Kultur, Mensch, Schicksale | Keine Kommentare »

Der gewagte Green Deal

Erstellt von DL-Redaktion am 12. Dezember 2019

Von der Leyens gewagte Mondreise

MoonClouds.JPG

Seht nur die kalten weißen Haare des Mondes von Wanne-Eickel

Von     Eric Bonse

Die Kommissionspräsidentin setzt beim Kampf gegen den Klimawandel auf Förderung der Wirtschaft. Die EU soll Vorreiter in der Klimapolitik werden.

Die Europäische Union will eine globale Führungsrolle im Kampf gegen die Klimakrise übernehmen – mit einer „Wachstumsstrategie“, die auch die Wirtschaft ankurbeln soll. Das kündigte Kommissionspräsidentin Ursula von der Leyen in Brüssel an. Es war die erste große Entscheidung seit ihrem Amtsantritt am 1. Dezember.

„Der Europäische Grüne Deal ist unsere neue Wachstumsstrategie“, sagte die CDU-Politikerin, die von den Staats- und Regierungschefs eingesetzt worden war. Investitionen in Milliardenhöhe sollten dazu führen, dass die EU bis 2050 klimaneutral wird und zugleich zum Spitzenreiter bei grüner Technologie und Industrie aufsteigt.

Dies sei Europas „Mann-auf-dem-Mond-Moment“, rief von der Leyen aus – womit sie ein Stichwort der konservativen EVP-Fraktion im Europaparlament aufgriff. Mit „Mann auf dem Mond“ ist allerdings nicht das Mondmännchen, sondern der Mondflug gemeint, der einst die Fantasie anregte – und der US-Industrie zu einer Führungsrolle verhalf.

Bisher ist allerdings nicht einmal klar, ob sich alle 28 EU-Staaten an der Reise beteiligen. Polen und andere osteuropäische Staaten haben das Ziel der Klimaneutralität beim EU-Gipfel im Juni in eine unverbindliche Fußnote verbannt. Ob der Widerstand beim nächsten Gipfeltreffen am Donnerstag gebrochen werden kann, ist offen.

„Wir haben nicht alle dieselben Ausgangsbedingungen“, räumte der neue EU-Gipfelchef, Charles Michel – ein liberaler Belgier –, unter Anspielung auf das Kohleland Polen ein. Michel versprach, auch „die sozialen Konsequenzen in Rechnung zu stellen“ und die Verlierer der klimapolitischen Wende großzügig zu entschädigen.

Eine zentrale Rolle soll dabei der „Just Transition Fund“ spielen. „Wir haben das Ziel, 100 Milliarden Euro an Investitionen für die am stärksten gefährdeten Sektoren und Regionen zu mobilisieren“, sagte von der Leyen. In den ersten Plänen war nur von 35 Milliarden Euro die Rede.

Finanzierung ist noch offen

Quelle        :        TAZ             >>>>>           weiterlesen

——————————————————-

Green New Deal der EU

Ein großer Plan mit Lebenslüge

Hans Baluschek, Illustration - Little Peter's trip to the Moon, Night.JPG

Von der Leyens Mondfahrt

Kommentar von Ingo Arzt

Der Green Deal der EU-Kommission ist ein Klimapapier mit vielen vernünftigen Vorhaben. Doch die Lebenslüge vom ewigen Wachstum thematisiert es nicht.

Die EU ist das Beste, was es im Klimaschutz derzeit gibt. Und das ist keine gute Nachricht.

Die neue Kommissionschefin Ursula von der Leyen hat am Mittwoch ihren „European Green Deal“ präsentiert, der retromodern nach Ärmel aufkrempeln und Probleme anpacken klingt. Es geht, nur zur Erinnerung, eigentlich darum, einen Kollaps der Ökosphäre zu verhindern. In dessen Folge Millionen, vielleicht Hunderte Millionen Menschen sterben könnten, weil wir Jetztmenschen ihnen die Lebensgrundlagen weggeflogen, weggefahren und weggefressen haben.

Und was macht die neue EU-Kommission? Sie schreibt ein erstaunliches, deprimierendes Papier von 24 Seiten. Erstaunlich, denn darin steht geschrieben, der Klimawandel sei die definierende Herausforderung unserer Generation, Arten stürben aus, Wälder und Meere würden zerstört. Die Klimaziele werden deutlich erhöht. Ökosysteme sollen geheilt werden. Der Green Deal fasst eine Menge vernünftiger Vorhaben zusammen, von einer CO2-Grenzzsteuer bis zur Steuer auf Flugbenzin oder einem möglichen „Recht auf Reparatur“ für neue IT-Geräte. Das ist ein passabler Wurf, verglichen mit dem, was aus Australien, Russland, Japan, Saudi-Arabien China oder Berlin kommt.

Quelle         :          TAZ          >>>>>         weiterlesen

——————————————————–

Grafikquellen     :

Oben         —       Full moon surrounded by clouds over Carmel-by-the-Sea, California, September, 2009

Abgelegt unter Energiepolitik, Ernährungspolitik, Europa, Umwelt | Keine Kommentare »

Augsburg-Weihnachtsmarkt

Erstellt von DL-Redaktion am 12. Dezember 2019

Ein merkwürdiges Verbrechen

Ein Kommentar von

In Augsburg ist ein Mann durch eine Gewalttat zu Tode gekommen. Ein anderer Mann ist verletzt worden. Die öffentliche Behandlung dieses Geschehens wirft ein grelles Schlaglicht auf den Zustand der Gesellschaft.

Merkwürdigkeit

„Aktenmäßige Darstellung merkwürdiger Verbrechen“ nannte einst der Wirkliche Staatsrat und Präsident des Appellationsgerichts Ansbach, der Strafrechtslehrer Paul Johann Anselm Ritter von Feuerbach eine von ihm herausgegebene Sammlung von Kriminalfällen. Er meinte mit „merkwürdig“ nicht „seltsam“, sondern: bemerkenswert. Und als bemerkenswert erschienen ihm die Fälle, weil man daraus etwas lernen konnte: Über die Taten, die Menschen, die sie begehen und erleiden, die Aufklärung und das Recht, das sie als strafwürdige Taten erfassen und „würdigen“ will. Seit dem Jahr 1828, als Feuerbach sein Buch veröffentlichte, hat sich die Schlagzahl der Berichte über Straftaten vertausendfacht. Die daraus zu ziehenden Lehren haben sich nicht im selben Maß entwickelt.

Seit dem 6. Dezember ist wiederum die Rede von einem merkwürdigen Verbrechen: In Augsburg ist ein Mann durch Gewalteinwirkung getötet worden; ein zweiter Mann wurde verletzt. Wenn man den seither anhaltenden Verlautbarungen und Berichten folgt, ist die Tat, vorab und auf jeden Fall, als entsetzlich, grauenhaft, fürchterlich, schockierend, zutiefst verstörend, unfassbar usw. zu bezeichnen. Alles andere wäre fast schon wieder selbst ahndungswürdig, da es „verharmlost“, die Opfer missachtet, die Realität verkennt, Verbrechen entschuldigt, usw. Man kann sich also vermutlich, sofern man nicht alsbald, ungefragt und bedingungslos in das lautest mögliche Wehgeschrei einstimmt, nur unbeliebt machen, mindestens aber verdächtig der Förderung von Gewalt, Verrohung und Menschenverachtung.

Dennoch ist es notwendig, auf Distanz zum Geschehen zu gehen, ein wenig Luft zu holen und die Geschehnisse von außen zu betrachten. Im Gegensatz zu den teils erlogenen, teils erfühlten Eindrücken, die rund um die Uhr vermittelt und berichtet werden, befinden sich nämlich annähernd 100 Prozent aller Menschen im „Außen“ des Geschehens: Sie sind nicht betroffen, auch wenn sie noch so laut ihre „Betroffenheit“ versichern. Sie waren nicht dabei, auch wenn sie noch so lang die Fotos vom Tatort anschauen. Und sie sind nicht Teil des nun ablaufenden „Verfahrens“ medialer, strafrechtlicher, politischer Art, sei es als Verletzte oder Hinterbliebene, sei es als Beschuldigte oder (deren) Angehörige.

Pressekonferenz

Bitte überlegen Sie einmal, wann Sie zuletzt in ARD oder ZDF eine live übertragene polizeiliche Pressekonferenz von 50 Minuten Dauer gesehen haben, und bei welchem Tat-Ereignis das der Fall war. Ich denke, da wird vielen gar nichts einfallen, andere werden vage Erinnerungen an Terroranschläge, andere katastrophale Ereignisse oder ungewöhnlich gravierende Ermittlungsverfahren haben. Zu den im vergangenen Jahr von der Polizei registrierten 3.200 vollendeten oder versuchten Tötungsdelikten hat die ARD, soweit ich weiß, keine Live-PK bundesweit übertragen.

Vor den Kameras: Ein Polizeipräsident, ein Leiter der Kriminalinspektion, ein Leitender Oberstaatsanwalt. Jeder der drei hat viele Jahre Berufserfahrung. Jeder weiß, was ein Totschlag ist, was eine Körperverletzung. Jeder kennt den Unterschied zwischen Jugendlichen und Erwachsenen, die Voraussetzungen für Haftbefehle und für Verurteilungen. Jeder kennt die Statistiken über Gewaltdelikte, und hat schon viele hundert Verfahren wegen solcher Delikte gesehen. Von all diesen Erfahrungen fließt in die Statements der drei Auskunftspersonen ein: Nichts. Und keiner der zahlreichen Journalisten fragt danach. Der Polizeipräsident versichert, er sei über die Tat ganz besonders betroffen, weil der „Blaulichtsektor“ (Polizei, Feuerwehr, Rettungsdienste) in Augsburg besonders gut zusammenarbeiten, und lobt die herausragend gute Zusammenarbeit in der vorliegenden Sache. Der KPI-Leiter erklärt ein ums andere Mal, wie ganz außerordentlich gut, erfolgreich und perfekt er und die von ihm geleitete Inspektion gearbeitet haben. Die „20-köpfige Ermittlungsgruppe“ habe in „herausragender Polizeiarbeit“ die Tat aufgeklärt und alle Verdächtigen festgenommen. Etwas später erläutert er: Ein Jugendlicher habe der Polizei auf Befragen mitgeteilt, er könne sich vorstellen, wer bei der Tat dabei gewesen sein könnte. Von diesem Hinweis aus habe man die Täter ermittelt. Dagegen ist nichts einzuwenden. Es ist allerdings nicht „herausragend“, sondern ziemlich schlichte Routinearbeit.

Der Leitende Oberstaatsanwalt (LOStA) bittet um Entschuldigung dafür, dass „seine Kapitaldezernentin“ (er meint: die für Tötungsdelikte zuständige Staatsanwältin) nicht anwesend sei: Gerade im Moment sei sie beim Amtsgericht, „um Haftbefehle zu erwirken“. Fünf habe sie schon erwirkt, er hoffe, dass er noch im Laufe der PK für die weiteren zwei Vollzug melden könne.

Alle sieben Haftbefehle sind, wie man erfährt, wegen dringenden Verdachts des Totschlags (ein Beschuldigter) bzw. der Beihilfe dazu (sechs Beschuldigte) am ersten Opfer sowie der gefährlichen Körperverletzung (alle sieben Beschuldigte) am zweiten Opfer ergangen. Das ist aus verschiedenen Gründen wichtig, vor allem deshalb, weil nach § 112 Abs. 3 StPO bei Verdacht eines Totschlags ein so genannter „Haftgrund“ nicht erforderlich ist: Die Annahme von Totschlagsverdacht führt auch ohne Flucht, Fluchtgefahr oder Verdunkelungsgefahr zur Anordnung von Untersuchungshaft. LOStA und KPI-Leiter erwähnen diesen Umstand nicht. Es trifft sich freilich gut, dass man der in Angst, Schrecken und Zorn aufgewühlten Bevölkerung und „Social-Media“-Nation nicht erklären muss, was Haftgründe sind und warum man Jugendliche mit „mehreren Staatsangehörigkeiten“ eventuell nicht in Haft genommen hat. Erst mal einsperren ist immer gut. Bayern ist sicher.

Tatverdacht

Die Sache selbst blieb in der Pressekonferenz im Vagen. Das Geschehen, aufgezeichnet von einer Überwachungskamera, soll sich nach Auskunft der Polizei innerhalb weniger Sekunden abgespielt haben: Die Opfer-Gruppe ging zunächst an der Tätergruppe vorbei; dann dreht sich das spätere erste Opfer um und ging auf die sieben Personen zu. Diese „umringten“ ihn kurz, es wurde geredet; dann schlug einer unvermittelt mit der Hand gegen den Kopf. „Und das führte so zum Tod“, wiederholte der KPI-Leiter gleich mehrmals; auf weitere Journalistenfragen gab es „aus Gründen des Opferschutzes“ keine Auskunft. Diese Schilderung lässt natürlich alles offen. Das kann vielleicht auch gar nicht anders sein, weil man halt noch nicht mehr weiß. Aber man sollte dann nicht so tun, als stünden irgendwelche ausschlaggebenden Tatsachen schon fest.

Quelle         :           Spiegel-online         >>>>>        weiterlesen

————————————————————-

Grafikquelle         :

Oben        —        Augsburger Christkindlesmarkt

————————————-

Unten              —         Thomas Fischer auf der re:publica 2016

Abgelegt unter Bayern, Deutschland, Justiz-Kommentare, Schicksale | Keine Kommentare »

Vorschläge eines Sozialisten

Erstellt von DL-Redaktion am 12. Dezember 2019

Für eine Klassenpolitik in der Umweltbewegung!

IAA Verkehrswende Demo 07.JPG

Quelle       :            AKL

Von Hans Neumann, Hildesheim

Die Massenproteste gegen den Klimawandel bringen Schüler*innen, Studierende, abhängig Beschäftigte, Erwerbslose, Rentner*innen, aber auch Selbständige und Unternehmer*innen auf die Straße. Außer der AfD spricht sich niemand dagegen aus, dass der Kampf gegen den Klimawandel ganz oben auf der Prioritätenliste stehen muss. So viel Einigkeit über politische und soziale Grenzen hinweg, freut viele, die in der Bewegung aktiv sind. Sozialist*innen sollten verstehen, dass diese scheinbare Stärke der Bewegung zum Verhängnis werden kann. Eine genauere Analyse über die Rolle von Klassen in Gesellschaft und sozialen Bewegungen ist angebracht.

Wenn Sozialist*innen die Gesellschaft erklären wollen, kommen sie nicht daran vorbei, sie mit Blick auf ihre materielle Grundlage zu verstehen. Im Gegensatz zum Idealismus ist es für den Marxismus zweitrangig, welchen Gruppen sich Menschen gedanklich zuordnen und welche Vorstellungen voneinander unterscheidbar sind. Wenn vegane Katholik*innen nichts mit anarchistischen Tierbefreiungsaktivist*innen zu tun haben wollen, mag das im Einzelfall wichtig sein. Für das Verständnis unseres Zusammenlebens in einer Klassengesellschaft ist es aber weniger interessant. Hier ist es vor allem von Relevanz, welche Rolle Menschen im Produktionsprozess spielen und ob sie sich dessen bewusst sind. Mit Marx gesehen ist hierbei entscheidend, wer die Mittel zur Produktion besitzt und wer nicht – also ob einem die Maschinen, Rohstoffe, Gebäude oder Ähnliches gehören, die zur Herstellung von verkaufbaren Produkten benötigt werden oder ob man in dieser Wirtschaft im Grunde nichts anderes als seine Arbeitskraft verkaufen kann. Alle, die in letztere Kategorie fallen, bilden für Marx die Arbeiter*innenklasse, die rein zahlenmäßig den überwiegenden Teil der Gesellschaft ausmacht und von der Konjunktur der Wirtschaft und der Willkür der Eigentümer an den Produktionsmitteln, den Kapitalisten, abhängig ist. Werden Jobs schlecht bezahlt, bleibt weniger zum Leben. Gibt es nicht genug Jobs, bleibt in der Regel nur das bisschen Brotkrumen an Arbeitslosengeld oder anderen staatlichen Leistungen, um zu überleben. Ganz anders ergeht es ihrem Gegenpart, der Kapitalist*innenklasse (oder „Bürgertum“). Deren Mitglieder können sich ein schönes Leben machen, weil sie weder von ihrer Arbeitskraft abhängig sind, noch genau genommen selbst arbeiten: im Produktionsprozess schaffen nämlich nur die beschäftigten Arbeiter*innen neuen Wert – den Mehrwert –, der zum Teil wieder in das Unternehmen investiert wird, zum Teil ausgezahlt, zum anderen Teil von den Kapitalist*innen in die eigene Tasche gesteckt wird.
Deshalb ist z.B. Aloys Wobben nicht wegen seines großartigen Umweltbewusstseins oder Fleißes unter den 20 reichsten Deutschen. Sein Vermögen von mehr als sieben Milliarden Euro ergibt sich einzig und allein aufgrund seines Eigentums an der Firma Enercon GmbH (Windanlangenproduktion), d.h. seiner Stellung im Produktionsprozess und damit vor allem durch die Ausbeutung seiner Beschäftigten.
Wenn es um Arbeitskämpfe geht, forderten die Arbeiter*innen bei Enercon in der Vergangenheit einen höheren Lohn, kürzere Arbeitszeiten oder Verzicht auf Stellenstreichungen – was insgesamt hieß, einen größeren Teil des von ihnen produzierten Werts an die Beschäftigten abzugeben. Das Unternehmen setzte in diesen Fällen aber alles daran, ein möglichst kleines „Stück vom Kuchen“ abgeben zu müssen. Das Interesse der vielen Arbeiter*innen und der wenigen Kapitalist*innen steht einander direkt gegensätzlich, unversöhnlich diametral gegenüber.
Außerhalb solcher Lohn- oder Arbeitskämpfe ist das Klassenverhältnis vielen Beschäftigten oft nicht bewusst und dennoch – unabhängig wie die einzelnen Menschen dazu stehen, wie sie es wahrnehmen oder was sie empfinden – gibt es diese Klassen an sich und auch diese Klassengesellschaft. Dass sich Arbeiter*innen bewusst als Klasse für sich zusammenschließen und organisiert Gegenmacht aufbauen, ist allerdings ein Prozess, der durch Erfahrungen mit Ausbeutung und vor allem mit Klassenkämpfen voran getrieben wird. Es ist die Aufgabe von Sozialist*innen, diesen Prozess durch Propaganda und Organisierung voran zu treiben und Ihre Stellung im Produktionsprozess aufzuzeigen – gerade weil die Kapitalist*innenklasse als Klasse für sich schon organisiert ist: Mit ihren prokapitalistischen Parteien, ihren Gesetzen und vor allem mit ihrem Staat.

IAA Verkehrswende Demo 16.JPG

Klassen und ihre Schichten
Wenn Marxist*innen also zwischen dem grundlegenden Klassenunterschied (Eigentum an Produktionsmitteln: ja/nein) und der bewussten Zuordnung zu einer Klasse unterscheiden, vergessen sie dabei aber auch nicht die jeweiligen Spezifika unterschiedlicher Schichten in den Klassen: In der Arbeiter*innenklasse ist es z.B. beachtenswert, ob man sich in der Ausbildung befindet oder bereits lange Jahre arbeitete; ob man in einer Zeitarbeitsfirma knechtet, oder einen unbefristeten Vertrag hat; ob man aufgrund seines Geschlechts zusätzliche Unterdrückung erfährt oder nicht; ob man in einer Fabrik für Solaranlagen arbeitet oder in der Pflege usw. All diese Unterschiede sind wichtig. Sie prägen die Bedürfnisse der Menschen und beeinflussen ihr Denken von sich und der Welt. Innerhalb der gesamten Arbeiter*innenklasse haben diese Schichten aber auch gemeinsame Interessen – Klasseninteressen. Je bewusster sich die aktiven Teile der Arbeiter*innenklasse über ihre Klasseninteressen sind, desto mehr werden sie danach streben Kämpfe und Bewegungen zu einzelnen Fragen (Lohnhöhe, Umweltschutz etc.) zu politischen Bewegungen/Kämpfen zu machen, die die Klassenherrschaft des Bürgertums und die im Kapitalismus bestehenden Eigentumsverhältnisse in Frage stellen.

Die Rolle des Kleinbürgertums
Das alles mag als theoretisches Gefasel wahrgenommen werden. Mit Blick auf die gegenwärtigen Kämpfe zum Thema Umwelt sind diese Ausführungen aber nicht unwichtig: Denn oft vergessen linksdenkende Menschen, dass auch auf einer Demonstration zum Thema Umwelt eine Zusammensetzung von Akteur*innen unterschiedlicher Klassen und Klassenschichten gegeben ist und oft sogar eine bestimmte in Forderungen und Ideen dominieren kann. Im Falle der gegenwärtigen Umweltbewegung sind es vor allem kleinbürgerliche Schichten, die den politischen Charakter der Proteste bestimmen.
Als unterster Teil der besitzenden Klasse teilt sie mit dem Großbürgertum die wesentlichen Gesamtinteressen der Kapitalist*innenklasse, droht aber durch starke Konkurrenz des großen Kapitals immer wieder, in die Arbeiter*innenklasse abzusteigen. Die ihr Angehörigen besitzen Produktionsmittel und können im kleinen Rahmen ihre Existenz auch auf die Ausbeutung anderer Arbeitskräfte stützen, bleiben aber selbst darauf angewiesen, von ihrer eigenen Arbeit zu leben. Mit kleinem Kapital ist ihr Wettbewerb in der Regel auf lokaler Ebene begrenzt, während das Großkapital in viel breiteren Kontexten agieren kann. Das Großkapial benötigt Einfluss auf die Gesetzgebung des Staates und seiner Außenpolitik, während das Kleinbürgertum sich auf individuellen Einfluss begrenzt und oft in eher lokaler Politik mitmischt. Es ist insofern privilegiert, als dass es sich die Früchte seiner Arbeit direkt auszahlen kann, während Arbeiter*innen ausgebeutet werden und nur einen Teil des von ihnen produzierten Werts als Arbeitslohn erhalten. Durch den Konkurrenzdruck der großen Kapitale ist das Hinabsteigen in die Arbeiter*innenklasse jedoch immerzu eine reelle Gefahr. Insofern wird es ideologisch zwischen die Stühle gesetzt: Der Sozialismus wird als Bedrohung betrachtet, weil er das Privateigentum an Produktionsmitteln in Frage stellt, der Kapitalismus wird als Bedrohung betrachtet, weil er durch den Konzentrationsprozess des Kapitals das Kleineigentum an Produktionsmitteln tendenziell zerstört. Es ist kein Zufall, dass Teile des Kleinbürgertums in der Geschichte für reaktionäre Ideen, einschließlich dem Faschismus, besonders anfällig waren.
Zum Großbürgertum kann immerhin potentiell aufgestiegen werden, was durchaus mit einer positiven Bezugnahme auf das privilegierte Leben der Eliten einhergehen kann. Gleichzeitig kann dieses Verhältnis aber auch Neid und Missgunst hervorrufen, da die Klasse des Kleinbürgertums im Vergleich zum Großbürgertum in ihrer Masse eine benachteiligte Klasse bleibt. Wer zugleich aber immer der Gefahr ausgesetzt ist, ins „einfache Volk“ (Arbeiter*innenklasse) hinabzustürzen, kann Ihnen gegenüber ebenfalls ambivalent sein: Etwa mitempfindend, wenn das Leid unverblühmt wahrgeommen wird, aber distanziert und chauvinistisch, wenn man sich abgrenzt und als besser wahrnimmt. Nicht imstande, zur herrschenden Klasse aufzusteigen, ordnete sich das Kleinbürgertum außerhalb von Krisenzeiten historisch immer dem Großbürgertum unter. Teile des Kleinbürgertums schlossen sich jedoch auch der Arbeiter*innenklasse an, wenn diese selbstbewusst Kämpfe führte und als fähig angesehen wurde, eine bessere Gesellschaft zu erstreiten.

Was hat das mit dem Thema Umwelt zu tun?
Wer soziale Bewegungen in einer Klassengesellschaft verstehen will, darf sich nicht damit begnügen, wie sich Akteure selbst zuordnen. Ob man sich als Öko, Autonome*r, Vegane*r oder Kiffer*in definiert, ist für Marxist*innen zweitrangig. Wichtig ist in erster Linie die Stellung im Produktionsprozess und ob sich diese im Bewusstsein der Akteur*innen niederschlägt. Hieraus ergibt sich das revolutionäre Potential der arbeitenden Bevölkerung, wenn sie damit beginnt, sich als gemeinsame Klasse wahrzunehmen und den Kampf für eine sozialistische Veränderung der Gesellschaft aufnimmt. Dann kann sie auch Teile des Kleinbürgertums hinter sich sammeln, die erkennen, dass eine sozialistische Gesellschaft ihnen eine bessere Zukunftsperspektive bieten kann als der Kapitalismus. Vollkommen diametral dazu stehen auch in diesem Beispiel die Interessen des Großbürgertums, das auch hier die Aufrechterhaltung der Produktions- und Eigentumsverhältnisse vor Naturschutz, Menschenleben und Rationalität gestellt wird. Und auch die Sonderrolle des Kleinbürgertums wird relevant: Denn gerade an der Umweltfrage ist das Konfliktpotential zwischen Groß- und Kleinkapital hoch.

Fridays for Future Aschaffenburg 15.03.2019 01.jpg

Während das große Kapital für seinen Profit zum Beispiel ganze Landstriche niederreißt, wird damit die Existenzgrundlage lokaler Handwerker, Händler*innen, Bäuer*innen und des kleinen Gast- und Tourismusgewerbe zerstört. Ein Programm, das das verhindert, kann auch ein Anknüpfungspunkt für das Kleinbürgertum sein, um seine Unterstützung für ein sozialistisches Programm zu gewinnen. Geschieht das nicht, können sich eine politische Führung des Kleinbürgertums oder von ihren Ideen geprägte Akteur*innen zu einer mäßigenden, abwartenden, bremsenden Rolle entwickeln bzw. der Bewegung eine falsche Richtung geben und sich schließlich auch den prokapitalistischen Forderungen des Großbürgertums anschließen.
Für Fridays for Future heißt diese Klassenzusammensetzung z.B., dass sich auch Unternehmer*innen mit „Entrepreneurs for Future“ an den Klimaprotesten beteiligt haben und das Verkehrsunternehmen Flixmobility GmbH kostenlose Busfahrten zu den Demos anbietet. Es bedeutet auch, dass sich viele kleinbürgerliche Kräfte v.a. aus dem Dienstleistungssektor bei „Unternehmen für Fridays for Future“ sammeln. Obwohl das Klein- oder Großbürgertum rein quantitativ oft nur schwach in der Bewegung vertreten sein mag, kann sich ihre Ideologie in Führung und Ideen der Bewegung niederschlagen. Oft sind es z.B. Kinder dieser Klassenangehörigen, die stellvertretend für diese Klasse individualistische und idealistische Lösungsangebote vertreten. Auch wenn in der Bewegung die Arbeiter*innenklasse in der Überzahl ist, besteht in Führung und Ideen gegenwärtig eine Dominanz des Groß- und v.a. des Kleinbürgertums – nicht zuletzt weil die Arbeiter*innen als Individuen an den Protesten teilnehmen und nicht kollektiv, was die Gewerkschaften erreichen könnten, deren Führungen aber auch in dieser Frage versagen.
Dieser Einfluss sollte nicht unterschätzt werden: Viele Fridays for Future-Aktivist*innen übernehmen unkritisch die Forderung nach einer noch viel höheren CO2-Steuer, die v.a. die Arbeiter*innenklasse zur Kasse bittet. Arbeiter*innen würden nach Meinung vieler Aktivist*innen selbst eine wesentliche Schuld an der Misere tragen, weil sie als Konsument*innen die gleiche Rolle im zerstörerischen System spielen würden wie Kapitalist*innen. Appeliert wird so etwa ans Bewusstsein der Konsument*innen, z.B. durch die Propagierung von Fleischverzicht und dem Verbot von Flügen unter tausend Kilometer Länge. Sorgen vor Arbeitsplatzabbau in umweltschädlichem Gewerbe werden in der Regel ignoriert, statt Forderungen nach Lohn- und Beschäftigungsgarantie ggf. in alternativen Branchen aufzustellen. Statt dadurch Beschäftigte in umweltschädlichen Industrien für die Umweltproteste zu gewinnen, werden Arbeiter*innen direkt oder indirekt aufgefordert, ihre unmittelbaren ökonomischen Interessen doch bitte zurückzustellen. Das wird für die Umweltbewegung ein noch viel größeres Problem werden, wenn die wirtschaftlichen Probleme und Zukunftsängste größerer Teile der Arbeiter*innenklasse im Zuge der drohenden Wirtschaftskrise zunehmen. Dann wird die heute in Teilen bestehende Akzeptanz einer „Kostenbeteiligung“ am Kampf gegen den Klimawandel, zum Beispiel durch CO2-Steuer, wieder abnehmen.
Die Folge dieser Konstellation ist zwar eine positive Resonanz bei bürgerlichen Medien, aber eine Spaltung, statt breite Mobilisierung der (gesamten!) Arbeiter*innenklasse. Klar wird auch, dass viele kleinbürgerliche Kräfte mit „System Change“ nicht einen wirklichen Systemwechsel, hin zu einer demokratisch geplanten Wirtschaft, meinen.

Die klassenbewusste Alternative
Wer lieber davon redet, individuelles Verhalten zu sühnen, statt große Unternehmen, ihre Lobbygruppen und den Kapitalismus als ökonomisches System zu verurteilen, nimmt die Hauptschuldigen aus dem Visier. 71% der globalen Treibhausgasemission stammt von nur 100 Unternehmen. Seit dem Jahr 1751 lassen sich 63% der globalen Emission auf nur 90 Unternehmen herleiten und alleine 30% der gesamten Emission auf lediglich 20 Unternehmen!
Konkrete Maßnahmen gegen konkrete Unternehmen sind notwendig und nur eine demokratisch geplante Wirtschaft kann diese Aufgaben angehen. Das geht nicht ohne eine revolutionäre Veränderung der Gesellschaft und einer globalen Bewegung für Klima, Arbeit und Wohlfahrt auf Basis einer sozialistischen Programmatik.
Sozialist*innen sollten deshalb auch in der Umweltbewegung einen Klassenstandpunkt einnehmen. Das bedeutet unter anderem: die Verantwortlichen am Klimawandel klar benennen, keine Forderungen unterstützen, die die Arbeiter*innenklasse für den Kampf gegen den Klimawandel bezahlen lassen würden, sondern Übergangsforderungen aufstellen, die deutlich machen, dass die Kapitalist*innenklasse nicht nur für die notwendigen Maßnahmen zahlen soll, sondern auch, dass es nötig ist Privateigentum an Produktionsmitteln und kapitalistische Profitwirtschaft zu überwinden.
Eine Linke kann ein solches notwendiges Programm nur aufstellen, wenn sie selbst eine Klassenpolitik betreibt, also die Arbeiter*innenklasse als die entscheidende, potenziell revolutionäre Kraft wahrnimmt wird und nach einer möglichst breiten Vereinigung zur Klasse für sich strebt.

Fridays for Future Aschaffenburg 15.03.2019 25.jpg

Kämpfende Arbeiter*innen und Menschen, die ideologisch auf der Seite der Arbeiter*innenklasse stehen, finden sich zu Hauf bei den gegenwärtigen Umweltprotesten. Es wäre Aufgabe von Sozialist*innen, diese Menschen anzusprechen und die Klassendifferenzen in der Bewegung aufzuzeigen. Erst aus einer klassenbezogenen Selbstverortung entsteht die Möglichkeit, sich Klasseninteressen bewusst zu machen und daraus schließlich auch politische Schlussfolgerungen zu ziehen. Statt die Klassenunterschiede in der Umweltbewegung ignorierend Umweltharmonie zu predigen und „die“ Umweltbewegung als Ganze unkritisch abzufeiern, gilt es für Sozialist*innen aufzuzeigen, dass es im unmittelbaren Interesse der Arbeiter*innen liegt, mit der Profitgier dieses Systems, mit dem Raubbau an der Natur, mit diesem Staat als Institution der herrschenden Klassen und damit auch mit den prokapitalistischen Kräften in der Bewegung ein für alle mal zu brechen.
Sollte die Arbeiter*innenklasse als eigenständige Kraft auftreten, könnte ihre rein quantitative Überlegenheit in der Bewegung auch eine neue politische Führung entstehen lassen, die der Umweltbewegung einen proletarischen, statt kleinbürgerlichen Charakter verleiht und die kleinbürgerlichen Schichten in ihren Sog mitzieht.
Dafür reicht es aber nicht, sich allein am Thema Umwelt abzuarbeiten, sondern auch die anderen Hauptanliegen von Arbeiter*innen, z.B. das Thema Wohnen oder konkrete Lohnkämpfe in den Blick zu nehmen und vor allem verschiedene Kämpfe der Arbeiter*innenklasse zu vereinigen, um wirklich schlagkräftig zu werden.
Dazu gehört eine Orientierung darauf, die Gewerkschaften auch in soziale Bewegungen wie die Umweltproteste einzubeziehen und Agitation auch in den Betrieben zu leisten. Vor allem sollten solche kämpferischen und antikapitalistische Kräfte in den Gewerkschaften unterstützt werden, die sich dem systemtragenden Kurs der Gewerkschaftsspitzen in den Weg stellen.
Und es heißt für die Partei DIE LINKE, hier mutig voranzuschreiten, Vorschläge zu entwickeln und an die Umweltkämpfe mit einem klaren sozialistischen Programm heranzutreten!

akl - Antikapitalistische Linke

—————————————————————-

Grafikquellen        :

Oben       —        Protest against IAA in Frankfurt. #aussteigen

2.) von Oben    —     Protest against IAA in Frankfurt. #aussteigen

—————————

3.) von Oben       —       Fridays for Future, Demo in Aschaffenburg, 15.03.2019

——————————–

Unten       —       Fridays for Future, Demo in Aschaffenburg, 15.03.2019

Abgelegt unter International, Kultur, P. DIE LINKE, Umwelt | Keine Kommentare »

Solidarität unter Studenten

Erstellt von DL-Redaktion am 11. Dezember 2019

 Hallo Hongkong  – Schaut auf diese UNI !

Datei:Eingangsgebaeude TU Darmstadt.jpg

Aus Darmstadt von Kevin Culina

Studierende der TU Darmstadt solidarisieren sich mit den Protesten in Hongkong. Darunter zwei Austauschstudenten aus China. Anderen Landsleuten geht das zu weit.

Es ist eine erstaunliche Kooperation: Lee aus Hongkong, groß und mit Brille, der sagt, dass er für Frieden und Demokratie in Hongkong bete. Und Franklin aus China, etwas kleiner, der schnell und aufgeregt spricht und seine Argumente mit unzähligen Videos zu untermauern sucht. Beide studieren in Darmstadt und sorgen sich um die Zukunft Hongkongs. So sehr, dass sie zu drastischen Worten greifen. „Ich sehe hier, von außen, wie meine Hongkonger Freunde vielleicht vernichtet werden“, sagt Lee und wirkt dabei sehr ergriffen. Die beiden Austauschstudenten haben beschlossen, nicht mehr länger zusehen zu wollen, wie die Demokratie in der Sonderverwaltungszone vor die Hunde geht.

Seit Mai dieses Jahres protestieren immer wieder Zigtausende Hongkonger gegen den zunehmenden politischen Einfluss aus China. Die Peking-nahe Regierung geht gewaltsam gegen die Proteste vor, Demonstrant*innen liefern sich immer wieder Straßenschlachten mit der Polizei. Zum Sinnbild des Protestes wurde die gewaltsame Räumung der Polytechnischen Universität. Weltweit solidarisierten sich Politiker*innen, Künstler*innen und natürlich Hochschulen mit den Hongkonger Studierenden (siehe Spalte).

Einstimmig für Resolution

So auch in Deutschland. Unter anderem in Lüneburg, Heidelberg und Berlin haben sich Studierendenvertretungen solidarisch mit Hongkong erklärt – und dank Lee und Franklin auch in Darmstadt. Mit vier weiteren Mitstreiter*innen initiierten sie eine Resolution. „Solidarität mit Protesten in Hongkong“ heißt sie und wurde am 20. November einstimmig vom Studierendenparlament der Technischen Universität Darmstadt beschlossen. Doch wie auch an anderen Hochschulen sind nicht alle mit dieser Resolution einverstanden.

In Darmstadt sei eine über 10-köpfige Delegation des Vereins der Chinesischen Wissenschaftler und Studenten in Darmstadt (VCWSD) in den Büroräumen der Studierendenvertretung aufgetaucht und habe eine Rücknahme der veröffentlichten Resolution gefordert, erinnert sich AStA-Vorstand Felix Ziegler. „Das Auftreten war teilweise feindselig“, beschreibt er den Besuch. Man habe versucht, im Gespräch den Entstehungsprozess verständlich zu machen, aber „aus dem Gespräch ist keine Versöhnung mehr entstanden“. Die Delegation habe angekündigt, „weiter gegen uns vorgehen zu wollen und Proteste zu planen“, so Ziegler.

Unter ausländischen Studierenden an deutschen Universitäten ist die Gruppe der Chinesen am größten, 42.676 waren es im Wintersemester 2018/19. Wie viele Chinas Rolle in Hongkong kritisch sehen, ist schwer zu sagen. Lee und Franklin zumindest sind zwei von ihnen. Lee studiert Informationstechnik, arbeitet zudem bei einem großen deutschen Technikunternehmen. Seinen vollen Namen will er nicht in der Zeitung lesen. Er hat Angst vor Verfolgung. Anlass dazu geben ihm die hitzigen Diskussionen über die Rolle Chinas in Hongkong, die nicht nur an seiner Hochschule entbrannt sind. So berichtet der AStA der TU Berlin von Morddrohungen nach ihrer Soli-Aktion mit Hongkong. Einschüchtern wolle man sich jedoch nicht lassen.

191001 HK police draws gun against protesters 01.jpg

Auch Franklin ist besorgt. Der 23-Jährige, der eigentlich anders heißt, wohnt erst seit Kurzem in Darmstadt, studiert Maschinenbau. Das Leben in Deutschland ermögliche ihm „persönliche und akademische Freiheit“, die er aus China nicht kenne. In seiner Heimat sieht Franklin derzeit keine Zukunft für sich. „Mir war früh klar, dass ich raus will aus China“, sagt der im Südwesten des Landes aufgewachsene junge Mann. „Das chinesische Regime bedroht die Freiheit der Welt“, sagt er. Und, „wir müssen etwas gegen die aufstrebende Macht der Regierung unternehmen“, insbesondere an einem auch für China so wichtigen Technikstandort wie Darmstadt.

Bei vielen seiner Kommiliton*­innen stoßen Lee und Franklin mit ihrem Anliegen auf offene Ohren. So bewundert das Studierendenparlament in seiner Resolution den „Mut“ der Demonstrant*innen, „trotz der lebensbedrohlichen Umstände für ihre Grundrechte und die Menschenrechte in Hong Kong einzustehen“, und verurteilt „die kompromisslose, gewalttätige und menschenrechtsverletzende Vorgehensweise der Regierung und der Polizei“. Außerdem solle die TU Darmstadt prüfen, ob Kooperationen und Austauschprogramme mit den Partneruniversitäten in Hongkong angesichts der Polizeigewalt „noch ethisch tragbar sind“.

Die TU Darmstadt sieht jedoch „keinen Anlass“, die Kooperationen mit den Partner­uni­versitäten in Hongkong „in irgendeiner Weise einzuschränken“, heißt es in einer Stellungnahme. Man betrachte „enge internationale Beziehungen zwischen Hochschulen unter demokratischen Bedingungen als sehr sinnvoll“ und schätze die „‚Brücken bauende‘ Funktion von Netzwerken“, heißt es. Man biete Darmstädter Austauschstudierenden jedoch eine umgehende Rückholung an. Einer von vier hätte dieses Angebot angenommen.

Ähnlich zurückhaltend ist auch die Hochschulrektorenkonferenz (HRK): „Nach aller Möglichkeit sollten die Kommunikationskanäle, gerade auch in schwierigen Zeiten, offen gehalten werden“, heißt es auf Anfrage der taz. Der Zusammenschluss deutscher Hochschulen und Universitäten wolle den „akademischen Austausch“ aufrechterhalten und „gerade jetzt eine wichtige Stütze sein“, so die HRK. Fast wortgleich plädiert auch der Deutsche Akademische Austauschdienst (DAAD) für die Fortführung bestehender Programme.

 

Quelle         :      TAZ       >>>>>          weiterlesen

Taiwan bietet Asyl und Studienplätze

2019-10-01 Demonstration Hong Kong 08.jpg

Aus Thaipeh von Felix Lee

Nirgendwo ist Unterstützung für die Hongkonger Demokratiebewegung so groß wie auf der Nachbarinsel. „Wir wollen zeigen, wie gastfreundlich wir Taiwaner sind“. Chou Chia-pei, NTU-Vizepräsidentin.

Von außen ist der Presbyterianischen Kirche von Taipeh nicht anzusehen, dass sie ein Hort des Widerstands ist. Die Kirche steht neben dem Parlamentsgebäude im Zentrum von Taiwans Hauptstadt. Gegenüber erstreckt sich das weitläufige Geländer der NTU, der renommiertesten Universität des Inselstaats. In einem Lagerraum der Kirche stehen Kisten mit Helmen und Gasmasken. Die Kirche wolle die Kisten demnächst nach Hongkong transportieren, sagt Hsu Hanyu. Mit den Gasmasken sollen sich die Demokratieaktivisten vor dem Tränengas der Polizei schützen können.

Hsu, 27, ist Mitglied der Sozialdemokratischen Partei Taiwans und war 2014 Teil der Sonnenblumen-Bewegung. Ihre Anhänger:innen hatten damals für mehrere Wochen das Parlamentsgebäude besetzt. Sie protestierten gegen die Annäherung der prochinesischen Regierung unter der konservativen Partei Kuomingtan (KMT). Seit vier Jahren ist mit der Demokratischen Fortschrittspartei (DPP) allerdings eine Regierung im Amt, die den China-freundlichen Kurs der Vorgängerregierung ablehnt und für eine offizielle Loslösung Taiwans von der mächtigen Volksrepublik eintritt, die Taiwan als „abtrünnige Insel“ betrachtet. Umso stärker setzt sich Hsu nun für die Demokratiebewegung in Hongkong ein. „Wir haben schließlich denselben Feind.“

Quelle          :         TAZ         >>>>>          weiterlesen

—————————————————————

Grafikquellen       :

Oben         —           Das Foto zeigt das neue Eingangsgebäude („Karo5“, Vordergrund), das Verwaltungsgebäude (rechts) und das Audimax-Gebäude (links) der TU Darmstadt.

Urheber Che010      /  Quelle    :    Eigenes Werk

Ich, der Urheberrechtsinhaber dieses Werkes, veröffentliche es als gemeinfrei. Dies gilt weltweit.

———————–

2.) Von Oben      —    Police draws gun against protesters, then shot warning rounds to the sky.

Unten      —       Hongkong    –     Demonstration against extradition bill, 1 October 2019

Abgelegt unter Asien, Bildung, Deutschland, Hessen, Mensch | Keine Kommentare »

Bauern finden Frau

Erstellt von DL-Redaktion am 11. Dezember 2019

Monsanto finanzierte Glyphosat-Studien in Deutschland

Bundeshauptveranstaltung des Tag der Regionen 2018 mit Julia Klöckner.jpg

Und nun hält die Frau ihr Maul ?

Quelle          :      INFOsperber CH.

Von  Tobias Tscherrig

Dokumente zeigen, dass Monsanto auch in Deutschland im Geheimen Studien finanzierte, um Glyphosat ins richtige Licht zu rücken.

Wie Recherchen von «LobbyControl» zeigen, finanzierte der Chemiekonzern Monsanto zwei wissenschaftliche Studien über den Unkrautvernichter Glyphosat. Mit derartigen Studien, die bei Zulassungsverfahren eine wichtige Rolle spielen können, sollten vor allem die Vorteile des in der Öffentlichkeit stark kritisierten Produkts unterstrichen werden: Seit Jahren steht der Unkrautvernichter Glyphosat im Verdacht, krebserregend zu sein. Trotz der starken Verdachtsmomente, verlängerte die EU-Kommission die Zulassung des Pestizids 2017 für fünf Jahre.

Es ist nicht neu, dass Monsanto wissenschaftliche Studien über eigene Chemieprodukte mitverfasste oder finanzierte. Allerdings betrafen die Fälle, die bisher publik wurden, allesamt die USA. «LobbyControl» liegen nun Dokumente vor, die beweisen, dass Monsanto auch in Deutschland verdeckt Studien finanzierte. In der Schweiz haben grosse Zeitungen bisher nicht darüber berichtet.

Bezahlte Studie als Hauptargument

Monsanto und andere Glyphosat-Hersteller stellten sich in der Vergangenheit auf den Standpunkt, dass Glyphosat-Verbote in der EU Wohlstandsverluste in Milliardenhöhe zur Folge hätten. Eine Aussage, die mit einer vermeintlich unabhängigen Studie vom Institut für Agribusiness (IAB) aus Giessen untermauert wurde. Die Recherchen von «LobbyControl» zeigen nun, dass die entsprechende Studie von Monsanto, dem Hersteller von Glyphosat, mitfinanziert wurde.

Der Chemiekonzern Bayer, der Monsanto für 66 Milliarden Dollar übernommen hatte, hat die Recherchen von «LobbyControl» inzwischen bestätigt. Dies, nachdem Michael Schmitz, einer der Studienautoren und ehemaliger Institutsleiter, gegenüber «LobbyControl» das Gegenteil behauptet hatte. Der Agrarökonom ist inzwischen emeritiert und lehrte bis 2015 an der Universität Giessen, wie der «Spiegel» berichtet. Er sei zudem als Sachverständiger für das Bundeslandwirtschaftsministerium tätig gewesen und habe als Gutachter für die Deutsche Forschungsgemeinschaft gearbeitet.

Institut fällt nicht zum ersten Mal negativ auf

Die Absicht der Chemie-Industrie ist klar: Ein allfälliges Verbot von Glyphosat würde den betroffenen Unternehmen empfindliche Umsatzeinbussen bescheren. Deshalb erstaunte es auch nicht, dass Monsanto Millionen in Lobbyarbeit investierte, als in der EU die Wiederzulassung von Glyphosat kontrovers diskutiert wurde. Zu den umstrittenen Lobby-Methoden gehörten auch die Finanzierung von deutschen Wissenschaftlern. So setzte Monsanto zum Beispiel Kronzeugen mit Professorentitel ein, um den Interessen des Konzerns mehr Gewicht zu verleihen. «LobbyControl» bilanziert: «Der Fall belegt einmal mehr, mit welch unethischen Lobbymethoden Monsanto in den politischen und gesellschaftlichen Grosskonflikt um Glyphosat eingreift.»

Das Institut für Agribusiness, dass die Studien herausgegeben hatte, war «LobbyControl» bereits in der Vergangenheit negativ aufgefallen: So liess es sich unter anderem eine Studie zu den volkswirtschaftlichen Schäden von Fleischverzicht von der Geflügelwirtschaft bezahlen. Das ist kein Zufall: Das Institut wurde von Vertretern aus Politik und Agrarindustrie begründet.

Interne Dokumente belegen Finanzierung durch Monsanto

Im Zusammenhang mit einer Recherche zur Studie über die volkswirtschaftlichen Schäden von Fleischverzicht, befragte «LobbyControl» Schmitz auch nach zwei Studien zum Thema Glyphosat. Die zwei Studien erschienen in den Jahren 2011 und 2015, warnten vor Milliardenschäden bei einem allfälligen Glyphosat-Verbot und stellten den ökologischen Nutzen des Unkrautvernichters für die Landwirtschaft ins Zentrum.

Die Studien seien aus eigenem Forschungsinteresse und ohne Finanzierung durch Dritte entstanden, habe Schmitz damals auf die Anfrage von «LobbyControl» geantwortet. Nun liegen dem Team von «LobbyControl» aber interne Unterlagen vor, die das Gegenteil beweisen. In einem Auszug aus einem Protokoll des Vereins für Agribusiness-Forschung aus dem Jahr 2012 steht: «Das IAB hat unter finanzieller Förderung durch das Unternehmen Monsanto (Brüssel) die ökonomischen Aspekte in Deutschland für die landwirtschaftliche Produktion, für die Volkswirtschaft sowie für die Umwelt analysiert.»

Als «LobbyControl» Michael Schmitz mit den neuen Erkenntnissen konfrontierte, blieben die entsprechenden Fragen unbeantwortet. «LobbyControl» sei voreingenommen, soll Schmitz argumentiert haben. Er beantwortete nur inhaltliche Fragen zur Studie.

Anders der Chemie-Konzern Bayer, der die Finanzierung der Studien eingeräumt hat. Trotzdem sehe das Chemie-Unternehmen zum jetzigen Zeitpunkt keinen Anlass, an den Methoden, Inhalten oder Ergebnissen der Studien zu zweifeln. Gleichwohl entspreche der fehlende Hinweis auf die Unterstützung durch Monsanto nicht den Grundsätzen von Bayer. Der Chemie-Riese habe erklärt, den Hinweis auf die Finanzierung durch Monsanto auf der eigenen Internetseite nachzuführen, schreibt «LobbyControl». Stattdessen sei die betreffende Studie ganz entfernt worden.

«Wissenschaftliche» Belege fliessen in Lobbyarbeit

Die von Monsanto finanzierten Studien wurden nach ihrer Veröffentlichung durch das Institut zusätzlich in Form von Aufsätzen in zwei Fachzeitschriften publiziert – wovon eine von einem Bundesforschungsinstitut herausgegeben wird, das dem Landwirtschaftsministerium untergeordnet ist. Die Finanzierung durch Monsanto wurde dabei mit keinem Wort ausgewiesen, ausserdem wurde als Autorenschaft die Universität Giessen angegeben. Nun sahen die Aufsätze wie das Resultat universitärer Forschung aus, selbst die Verbindung zum Institut für Agribussines fiel unter den Tisch.

Nachdem die beiden Studien der Öffentlichkeit zugänglich gemacht wurden, spielten sie eine wichtige Rolle in der Lobbyarbeit der Chemie-Industrie. Denn obwohl die scheinbar unabhängigen und wissenschaftlichen Studien keine Rolle bei der Frage spielen, wie sich Glyphosat auf Gesundheit und Umwelt auswirkt, thematisieren sie den Nutzen für die Wirtschaft und die Landwirtschaft. Und natürlich verwendete die Chemie-Industrie diese «wissenschaftlichen» Argumente in der Lobbyschlacht um die Glyphosat-Zulassung in der EU, was diverse Prospekte, Broschüren und Veröffentlichungen belegen.

Weiter verwendete die Chemie-Industrie die Studie nicht nur, ohne die Finanzierung durch Monsanto anzugeben – sondern nutzte die Studienergebnisse in einseitiger oder verzerrter Form. Etwa, in dem die wirtschaftlichen Schäden, die gemäss Studie aufgrund eines Glyphosat-Verbots für die EU entstehen würden, nur anhand der extremsten Szenarien berechnet wurden.

Studien ziehen Kreise in Medien und Politik

Wie «LobbyControl» schreibt, war es aber nicht nur die Chemie-Industrie, die die Studien weiterverbreitete. Die Studienergebnisse wurden in Medienberichten thematisiert, auf sie wurde im Glyphosat-Artikel im deutschsprachigen Wikipedia verwiesen. Sie schafften es gar auf eine Literaturliste des Bundestags. In der Folge verwies zum Beispiel die agrarpolitische Sprecherin der FDP-Fraktion, Christel Happach-Kasan, in einer Bundestagsdebatte auf die Untersuchungen der Universität Giessen. «LobbyControl»: «Dass sie sich dabei auf Monsanto-finanzierte Studien bezog, war ihr vermutlich nicht bewusst.»

Die von Monsanto finanzierten und in Deutschland erschienenen Studien über Glyphosat sind der nächste Fall von aggressiven, ethisch und moralisch verwerflichen Lobby-Methoden, wegen denen der Konzern bereits seit Jahren immer wieder in der Kritik steht. «LobbyControl» fordert von Bayer als neuem Monsanto-Eigentümer Transparenz. Der Konzern müsse umfassend offenlegen, «welche Wissenschaftler und Studien Monsanto für Lobbyzwecke finanzierte». Es reiche nicht, wenn nach einzelnen Recherchen stückchenweise die intransparente Zusammenarbeit mit einzelnen Instituten oder Wissenschaftlerinnen und Wissenschaftlern eingeräumt werde. Weiter wird eine Zusage von der Industrie gefordert, «bei allen Studien im jetzt beginnenden Prozess zur Wiederzulassung von Glyphosat 2022 die Finanzierung klar zu benennen.»

Bayer muss reagieren

In der Zwischenzeit nimmt zumindest die Universität Giessen den Fall zum Anlass, um zu prüfen, ob möglicherweise Regeln zur Angabe von Finanzierungsquellen in der Auftragsforschung in ihre Satzung aufgenommen werden sollten. Auch die Herausgeber der Fachzeitschriften, in denen die entsprechenden Aufsätze erschienen waren, wollen reagieren. Ebenso die Veranstalter einer Pflanzenschutz-Tagung, bei der einer der Autoren 2012 die erste der Glyphosat-Studien vorgestellt hatte.

Was fehlt, ist die Reaktion von Bayer. Der Konzern liess weitere, wichtige Fragen von «LobbyControl» unbeantwortet. Denn Bayer kann nicht behaupten, von den unsauberen Methoden von Monsanto nichts gewusst zu haben: Gemäss «LobbyControl» war Bayer CropScience selbst im Vorstand des Trägervereins des Instituts für Agribusiness vertreten und arbeitete mit dem Institut und mit Schmitz zusammen. Zwischen 2006 und 2016 habe Bayer CropScience sechs Studienprojekte beim Institut in Auftrag gegeben. Kostenpunkt: 63’000 Euro.

***************************************************************

Themenbezogene Interessen (-bindung) der Autorin/des Autors
keine
FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

—————————————————————–

Grafolquellen         :

Oben      —       Bundeshauptveranstaltung des Tag der Regionen 2018 mit Bundeslandwirtschaftsministerin Julia Klöckner

————————————

2.) von Oben     —

Épandeur adapté à l‘épandage sur les vignes.

—————————-

Unten      —          politischen Schmusereihe

Julia Klöckner (links) beim CDU-Parteitag (2014)

  • CC BY-SA 3.0 deHinweise zur Weiternutzung
  • File:CDU Parteitag 2014 by Olaf Kosinsky-12.jpg
  • Erstellt: 2014-12-09 15:21:37

Abgelegt unter Mensch, P.CDU / CSU, Regierung, Umwelt | Keine Kommentare »

Klima und Umweltpolitik

Erstellt von DL-Redaktion am 11. Dezember 2019

Wir brauchen eine Klima und Umweltpolitik frei von Kapital- und geopolitischen Interessen.

Bonn, Bundeskunsthalle, Achim Mohné, 010 - K.jpg

Quelle       :       Scharf  —  Links

Klimadebatte  –   Von G. Karfeld

Vorab zwei Aussagen
1. Deutschlands Anteil des Weltweiten CO2 Ausstoß beträgt 2,2 bis 2,5 Prozent.
2. Ein höherer CO2 Gehalt fördert, das ist unbestritten, das Pflanzenwachstum.

Was können wir also für das Klima tun?
Ich bin kein Klimawissenschaftler, ich beurteile die Situation nach meinen Beobachtungen in

der Natur, durch studieren der natürlichen Kreisläufe, verbunden mit den Eingriffen des Menschen.

Ich beginne mit dem Mikroklima (Kleinklima). Die Südseite eines Hauses hat ein anderes Mikroklima als die Nordseite. Jedes Tal hat ebenfalls je nach Lage und Beschaffenheit, Anteil an Wald, Wiesen, bebautes Land und der Höhe des Grundwasserspiegels, der einen fundamentalen Einfluß auf die Vegetation hat, sein eigenes Mikroklima. Der Grundwasserspiegel eines Tales beeinflußt auch den Wasserhaushalt der höher gelegenen Ebenen. Wo sich in der Regel die Wälder befinden. Wenn also im Tal der Grundwasserspiegel durch Baumaßnahmen abgesenkt wird hat das Einfluß auf die Wasserversorgung in den Höhenlagen. Das ist auch mit ein Grund für das Waldsterben.

Das Mikroklima wird überlagert vom Makroklima, das ist das Klima einer ganzen Region oder eines Kontinents. Auch das Weltklima mit den globalen Windströmungen und die Bedingungen der Meeresströme gehören dazu.

Ein höherer CO2 Gehalt fördert das Pflanzenwachstum. Da wir keinen Einfluß auf den weltweiten CO2 Ausstoß haben, sollten wir diese Eigenschaft des CO2 nutzen. Dazu ist ebenfalls unbestritten Feuchtigkeit sprich Wasser notwendig, wie das derzeitige massive Waldsterben wegen Trockenheit zeigt. Der Mensch hat durch Bebauung, Begradigung der Flüsse und Bäche, Trockenlegung der Moore und Sümpfe massiv in den natürlichen Wasserhaushalt des Ökosystems eingegriffen. Die Folge ist, eine zunehmende Trockenheit, damit verbunden die massive Zunahme des Waldsterben sowie die Gefährdung der Nahrungsmittelsicherheit in der Zukunft. Wir haben keinen Einfluß auf den CO2- Ausstoß in China, Indien oder sonst wo, aber wir haben einen Einfluß auf die Umweltpolitik im Eigenen Land und in der Region in der wir leben. Wir können also das Mikroklima gestalten. Geschieht das im ganzen Land oder gar in ganz Europa, hat das Einfluß auf das Makroklima. Wenn hohe CO2- Werte die Temperaturen erhöhen, wirkt eine hohe Verdunstung von Wasser dieser Erhöhung entgegen.

Annie France-Harrar schreibt in ihrem Buch „Die letzte Chance für eine Zukunft ohne Not“ eine mittelgroße Birke (Betula) schafft an einem schönen Sommertag durchschnittlich 400 Liter Wasser aus der Erde herauf und gibt es in kurzer Frist zum größten Teil wieder an die Luft ab. Und ein Hektar Buchenwald saugt sogar von einem heißen und trockenen Sommermorgen bis zum Abend 30 000 Liter auf.

Daraus wird ersichtlich, dass z.B. ein solcher Buchenwald einen Einfluß auf das Mikroklima vor Ort hat. Er erhöht die Feuchtigkeit in seiner Umgebung. Eine höhere Verdunstung von Wasser führt zu einer Steigerung des Wasserkreislaufs. Verdunstung, Aufstieg in höhere und kühlere Luftschichten, Kondensierung und daraus folgend mehr Niederschlag. Dadurch vermehrte Wolkenbildung, dies führt wiederum zu einer Beschattung und damit zu einer niedrigeren Temperatur. Der dadurch erhöhte Niederschlag aus der kühlen Atmosphäre führt zu einer Abkühlung der Erdoberfläche. Jeder kann dies bei einem Gewitterregen selbst nachvollziehen und in der Realität erleben. So ein Gewitterregen erzeugt häufig eine Abkühlung von 10 bis 12°C. Dies zeigt, dass ein Feuchtes Klima mit einem hohen CO2- Gehalt in der Atmosphäre zurecht kommt. Es fördert das Pflanzenwachstum, was wiederum zu einer vermehrten Speicherung von CO2 führt. Dies ist der Kreislauf der Natur der sich selbst regelt, wenn der Mensch nicht massiv in diesen Regelkreis eingreift. Wir haben in diesen Regelkreis eingegriffen, aber nicht was den CO2- Wert betrifft. Die fossilen Rohstoffe sind gespeicherte CO2 aus früheren Zeiten. Wenn sie jetzt zum Problem werden dann nur weil die Vegetation und der Wasserhaushalt des Ökosystems durch den Menschen stark gestört ist. Wir müssen also über den Wasserhaushalt, die Vegetation auf der Erde wieder in Gang setzen.

Es sollte auch geprüft werden welche Auswirkung die riesigen Plastikteppiche im Meer auf die Verdunstung von Meerwasser haben. Ein Plastikverbot in der Verpackungsindustrie ist überfällig. Warum ist der CO2- Ausstoß der Kunststoffindustrie kein Thema? Der Verpackungsfreie Supermarkt ist heute jeder Zeit realisierbar.

Das E- Auto bringt, was die CO2- Bilanz betrifft, nur wenige Vorteile gegenüber dem Verbrennungsmotor. Mit einrechnen muss man aber noch die dazu notwendige Infrastruktur, die Entsorgung und der Aufwand des Recycling der massenhaft anfallenden Batterien. Dies ist noch gar nicht erforscht. Trotzdem wird die Technik bereits mit Steuergeldern subventioniert. Hier werden nur die Gewinninteressen großer Konzerne bedient. Wasserstofftechnik wird unterdrückt, da Wasserstoff ein Rohstoff ist, bei dem die großen Konzerne sich keinen Claim abstecken und sich ihn aneignen können um den Markt zu kontrollieren und mit ihrem Kartell die Massen auszuplündern.

Karikatur von Gerhard Mester zum Thema Klimawandel gibt es nicht O12816.jpg

Jeder von den Massenmedien propagierte Weg aus der Klimakrise ist unweigerlich mit den Interessen der kapitalistischen Eliten verbunden. Jeder dem die Umwelt und damit ein Leben ohne Not der nachfolgenden Generationen am Herzen liegt, sollte sich in der Sache informieren und die natürlichen Kreisläufe versuchen zu verstehen, was natürlich in diesem komplexen Thema immer nur zum Teil gelingen kann. Die größte Hürde in unserer kapitalistischen Gesellschaft ist aber eine ehrliche Sachlage unabhängig von den Interessen der kapitalistischen Eliten dargestellt zu bekommen. Die verschiedenen Prioritäten auf Grund von Interessen verhindern jeglichen umweltpolitischen Fortschritt. Solange die Umwelt und Klimapolitik für Gewinn- und geopolitische Strategien benutzt wird, ist jeglicher Fortschritt nur sehr schwer zu erreichen. Die Klimapolitik ist auch sehr stark von geopolitischen Interessen des globalen Kapitals beeinflußt. Man muss sich überhaupt von der kapitalistischen Denkweise, die zu den heutigen Umwelt und Klimaproblemen geführt hat, lösen um ihrer Lösung näher zu kommen. Es ist nicht nur ein gutes sondern auch ein besseres Leben ohne die heutige kapitalistische Konsum- und Wettbewerbsgesellschaft möglich. Man muss es nur wollen. Zu gerne sind wir bereit Scheinlösungen zu akzeptieren um den eigenen sozialen Status, mag er auch noch so miserabel sein, zu erhalten. Solange wir am Status Quo festhalten schließen wir jegliche Lösung der Probleme aus und bürden sie den nächsten Generationen auf, die dann für ihre Lösung sehr viel größere Opfer bringen müssen.

Entweder wir fügen uns in unserem Wirken und Leben in den natürlichen Kreisläufen der Natur ein, oder die Menschheit, oder zu mindestens ein großer Teil davon, wird an sich selbst scheitern.

https://www.bav-versand.de/Die%20letzte%20Chance%20f%C3%BCr%20eine%20Zukunft%20ohne%20Not.html?ddb.sessionid=405011574074074429414050115741

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

    ——————————————————————-

Grafikquellen     :

Oben         —         Bonn, Bundeskunsthalle, Achim Mohné, 0,0064 MEGAPIXEL – PLANET EARTH IS BLUE AND THERE‘S NOTHING I CAN’T DO

—————————

Unten            —        Karikatur von Gerhard Mester zum Klimawandel

Abgelegt unter Energiepolitik, International, Positionen, Umwelt | Keine Kommentare »

Nobelpreis für Peter Handke

Erstellt von DL-Redaktion am 11. Dezember 2019

Am Arsch der Hölle

Graves srebrenica bosnia and herzegovina.jpg

Kommentar von Doris Akrap

Peter Handke ist ein Kretin, ein Arschloch. Dass er mit dem höchsten Literaturpreis geehrt wird, hat aber etwas Gutes.

Peter Handke ist ein Kretin. Er hat die Opfer des schwersten Verbrechens im postfaschistischen Europa verhöhnt, das Verbrechen geleugnet, sich mit einem überaus unappetitlichen Regime gemein gemacht und seine Worte und Urteile weder in aller gebotenen Eindeutigkeit und Lautstärke zurückgenommen noch mit aller gebotenen Schamesröte im Gesicht bei den Opfern und ihren Angehörigen um Entschuldigung gebeten.

Peter Handke ist ein Kretin, ein Arschloch. Dennoch hat die Entscheidung, dem österreichischen Schriftsteller am 10. Dezember in Stockholm den Nobelpreis für Literatur zu verleihen, etwas ausgelöst, das gut war.

Für die Überlebenden des Massakers von Srebrenica im Jahr 1995 ist die Nobilitierung eines Mannes, der als „Genozidleugner“ bezeichnet wird, eine „existenzielle Kränkung“, so formuliert es der aus dem belagerten Sarajevo 1994 nach Deutschland geflohene Schriftsteller Tijan Sila.

Aber, und das ist das Gute, diese Entscheidung blieb nicht unkommentiert. Noch einmal musste die ganze Welt darüber reden, dass es mitten in Europa nach dem Ende des Nationalsozialismus einen Genozid gegeben hat. Noch einmal musste die ganze Welt sich fragen, wie das trotz der Losung „Nie wieder“ eigentlich passieren konnte. Noch einmal musste die ganze Welt zur Kenntnis nehmen, dass sie im Bosnienkrieg versagt hat.

Dass es dazu kam, ist der Vehemenz, der Unerbittlichkeit und der Akribie zu verdanken, mit der dem Auszuzeichnenden seine eigenen Worte um die Ohren gehauen wurden.

Noch in den 1990ern und bis in die nuller Jahre hinein hätte ich das nicht ganz so gesehen. Ich bin in meinen Ansichten zum blutigen Zerfall Jugoslawiens gefühlt drei bis fünf Mal um den Block gelaufen. Und ich kann nicht ausschließen, dass ich vielleicht nochmal rummuss.

Ich hatte nie auch nur die leisesten Sym­pathien für den restjugoslawischen hyper­nationalistischen Autokraten, den serbischen Staatschef Slobodan Milošević. Aber genauso wenig hatte ich die für sein kroatisches Pendant Franjo Tuđman. Mein Vater hatte mir 1991 den jugoslawischen Pass abgenommen und durch einen kroatischen ersetzt.

Das aber ersetzte nicht meine Ansicht, dass das ursprüngliche jugoslawische Modell wesentlich friedlicher, kosmopolitischer, demokratischer und cooler war als diese von Nationalismus, Antisemitismus und ethnischem Testosteron aufgepumpte kroatische Unabhängigkeit.

Das war keine exklusive Haltung als deutsche Linke. Im Gegenteil. Während der eine Teil im wiedervereinigten Deutschland den Sieg über den Kommunismus feierte, kämpften die Nichtsodeutschen und Linken mit dem gesamtdeutschen Nationalismus, Rassismus und neonazistischer Gewalt – Baseballschlägerjahre ist das aktuelle Stichwort dafür. Diese Gruppe sah im neuen Deutschland das alte. Und dazu passte auch das Verhalten der deutschen Regierung in den jugoslawischen Zerfallskriegen ab 1991.

50 Jahre Manuskripte - Alfred Kolleritsch und Peter Handke.jpg

Von Bild bis Joschka Fischer, deutsche Medien und Politiker sahen in Serbiens Präsident Hitlers Wiedergänger, im Kosovo ein neues Auschwitz und bombardierten zum dritten Mal in diesem Jahrhundert Belgrad (1999). Und das alles, nachdem man den Massakern im Bosnienkrieg (1991 bis 1995) quasi zugeguckt hatte und der deutsche Außenminister Kroatien im Alleingang als unabhängigen Staat anerkannt hatte (1991).

Hans-Dietrich Genscher ist in Kroatien der einzige Politiker, nach dem zu Lebzeiten Straßen und Plätze benannt wurden. Schützenhilfe alter Verbündeter aus faschistischen Zeiten – so redeten wir damals.

Quelle         :           TAZ         >>>>>           weiterlesen

———————————————————-

Grafikquellen       :

Oben         —        New graves for victims of the Srebrenica genocide in 1995. Burial took place on 11 July 2010.

Abgelegt unter Bildung, Deutschland, Europa, Schicksale | Keine Kommentare »

SUV und das Klima

Erstellt von DL-Redaktion am 9. Dezember 2019

SUVs fressen alle CO2-Einsparungen von PKW auf

File:Platz da für mein SUV 07.jpg

Quelle        :     INFOsperber CH.

Von Daniela Gschweng

Der Trend zum «Strassenpanzer» hält an. SUVs verbrauchen so viel Sprit, dass es alle CO2-Einsparungen bei Kleinwagen aufwiegt.

Mehr als ein Drittel aller verkauften Personenwagen sind SUVs. 39 Prozent aller Konsumenten weltweit kauften im vergangenen Jahr einen der Stadt-Offroader, wenn sie ein neues Auto brauchten, Tendenz seit Jahren steigend. Diese Zahl hat die Internationale Energieagentur IEA Mitte Oktober als Vorabmeldung zum «World Energy Outlook 2019» veröffentlicht. Die Agentur bewertet jedes Jahr den Weltenergiekonsum und prognostiziert in drei möglichen Szenarien die zukünftige Entwicklung.

In den vergangenen zehn Jahren hat sich der Anteil der SUVs weltweit verdoppelt, stellt die Energieagentur fest. In der EU ist schon jeder dritte Neuwagen ein SUV, in den USA fast jeder zweite. Auch die wohlhabende Schweiz setzt auf den allradgetriebenen Wagen: Laut «Blick» haben inzwischen die Hälfte aller Neuwagen 4×4. Für Geländefahrten sind sie meist nicht gedacht, eher für das raue Zürcher Pflaster. Ihre Fahrer loben vor allem das hohe Sicherheitsgefühl und die – im wörtlichen Sinne – gute Übersicht.

Die Vorliebe für grosse, schwere Autos macht sich in Folge an der Tankstelle und auch auf dem Konto bemerkbar: SUVs verbrauchen etwa ein Viertel mehr Energie als ein Mittelklassewagen. Der durchschnittliche CO2-Ausstoss eines Fahrzeugs steigt dadurch drastisch an – so sehr, dass er alle «Gegenmassnahmen» wie effizientere Motoren und sparsamere Autos in der Summe glatt ausradiert.

Fast so schädlich wie die Kohleverbrennung

Die immer grösseren und schwereren Vehikel schaden der Umwelt erheblich mehr als kleinere und leichtere Autos. Trotz aller Massnahmen, die Treibstoff-Verbrennung sauberer und weniger umweltschädlich zu gestalten, ist der globale Treibstoffbedarf zwischen 2010 und 2018 um 5,3 Milliarden Liter (3,3 Millionen Barrels) täglich (!) gestiegen, was ausschliesslich auf SUVs zurückzuführen ist. Das ist die zweitgrösste Steigerung im CO2-Ausstoss nach den Emissionen der Elektrizitätserzeuger (Power).

Verbesserungen bei kleineren Fahrzeugen haben im gleichen Zeitraum zu einer Einsparung von 3,2 Milliarden Liter (2 Millionen Barrels) täglich geführt. Elektrofahrzeuge entlasten die Umwelt noch vergleichsweise wenig – durch den Nicht-Verbrauch von etwa 16 Millionen Litern Treibstoff pro Tag.

Personenwagen mit alternativen Antrieben sind zwar auf dem Vormarsch, noch ist der Marktanteil von Elektro-, Hybrid- und Wasserstoffautos aber gering. Bis 2025 werden etwa 350 Modelle auf dem Markt sein, schätzt die IEA. Dabei handelt es sich vor allem um Kleinfahrzeuge.

Die Präsentation des zukünftigen Pick-ups der Firma Tesla erfuhr kürzlich zwar viel Aufmerksamkeit, ist aber eher die Ausnahme als die Regel.

Den Schweizer Kunden ist das egal: Selbst beim kleinen Marktsegement der Elektro- und Hybridfahrzeuge machten SUVs hierzulande den grössten Anteil aus. Je nach Stromquelle ist auch das keine grosse Entlastung für das Klima. Es sei denn sie specken ab (siehe auch Infosperber: «Warum die Effizienz im Strassenverkehr gesunken ist»).

Die weltweit meisten SUVs sind jedoch Benziner und werden es voraussichtlich auch noch eine Weile bleiben. Wenn der Bedarf weiterhin mit ähnlicher Geschwindigkeit zunimmt wie in den vergangenen zehn Jahren, würden benzingetriebene SUVs bis 2040 die CO2-Einsparungen von fast 150 Millionen Elektroautos zunichtemachen, rechnet die IEA aus.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

keine

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

———————————————————————-

Grafikquellen:

Oben       —             The Platz da für mein SUV?! protest promoted a city limit of 70 and a minimum speed of 250 kph on the Autobahn

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: C.Suthorn / cc-by-sa-4.0 / commons.wikimedia.org
It is not permitted to upload this file to Facebook, Youtube, Twitter and many other social networks!
This file has been released under a license that is incompatible with the terms of service and licensing terms of Facebook, Youtube, Twitter etc.More information is provided by the Legal Team of the Wikimedia Foundation.

This file cannot be used at any pages which use different terms than the license granted here.

 ——————————-

Unten      —       „Kinder wollen Klimagerechtigkeit“

Abgelegt unter Bildung, Energiepolitik, International, Umwelt | Keine Kommentare »

Ein Bericht aus Hongkong

Erstellt von DL-Redaktion am 8. Dezember 2019

Unterwegs mit Helm und Gasmaske

Hung Hum 2011.jpg

Von Verna Yu

Für die Sieben-Millionen-Stadt ist das Unvorhersehbare zum Normalzustand geworden. Ein persönlicher Bericht.

Mir geht es seit Monaten wie vielen Menschen hier: Wir schauen zu, wie sich unsere Stadt von Tag zu Tag mehr in einen Kriegsschauplatz verwandelt. Ein Gefühl von Hilflosigkeit und Furcht nimmt überhand. Jedesmal, wenn ich die Wohnung verlasse, um als Reporterin zu arbeiten, mahnen mich meine Kinder zur Vorsicht: „Pass bloß auf dich auf!“ Wann immer ich Helm und Gasmaske einpacke, fühlt es sich an, als würde ich mich auf ein Schlachtfeld begeben.

Meine Gefühle fahren Achterbahn, noch nie konnte ich so viele Wochen hintereinander nachts nicht schlafen, war ich appetitlos und unfähig an etwas Anderes zu denken als an Straßen, von denen man ständig annehmen muss, dass sie zu Kampfzonen werden. Besonders spürbar war der seelische Ausnahmezustand im Oktober, als die Behörden den Betrieb der U-Bahnen tagelang einstellten. Mich überkam ein surreales Gefühl von Unbehagen. Es stand außer Frage, dass man die Wochenendaktivitäten der Kinder absagen musste, schließlich waren alle öffentlichen Freizeiteinrichtungen geschlossen.

Zugänge verriegelt

Also fuhr ich mit meiner Familie im Taxi ans Meer. Ins Wasser zu gehen, war nicht ohne Risiko, denn kein Rettungsschwimmer tat mehr Dienst. Auf dem Weg zurück hielten uns Straßenbarrikaden auf, die von Demonstranten errichtet waren. Die Kinder wurden unruhig und hatten Angst, dass gleich die Polizei aufkreuzen und Tränengas einsetzen würde. Daher stiegen wir aus dem Taxi und machten uns schnell wie möglich durch die Menge davon. Es blieb eine erste Ahnung, dass diese Art des Bedrohlichen und Unvorhersehbaren zum Normalzustand werden könnte. Als es zuletzt den Sturm auf das Universitätsgelände gab, um die Studenten dort zu vertreiben, war ein Großteil der Stadt wie gelähmt. Beide Seiten, Demonstranten wie Polizisten, blockierten Straßen. Wieder fuhr kein Bus, und die meisten U-Bahn-Zugänge blieben verriegelt.

Sobald die Auseinandersetzungen auch nur aufflackern, bedeutet das: Menschen sind zuhause gefangen und können nicht zur Arbeit erscheinen. Wer das trotzdem schafft, kann nie sicher sein, am gleichen Tag wieder nach Hause zu kommen. Von den Angestellten im Finanzdistrikt, wagt es kaum noch jemand, zum Lunch nach draußen zu gehen. Man ist auch dort vor Tränengas nicht mehr sicher. Wenn Restaurants deshalb schließen oder Konzerte und andere Veranstaltungen abgesagt oder früher beendet werden, erliegt jedes soziale Leben. Auch wenn sie gar nicht verhängt worden ist, man lebt wie unter einer Ausgangssperre. Sogar Hochzeiten werden durchkreuzt – Freunde von mir mussten sich eine andere Kirche suchen, um ihre Gäste nicht Straßen voller Tränengas auszusetzen.

Nur noch auswandern

HongKong market amk.jpg

Alle sind hochgradig erregt, sodass zwischenmenschliche Beziehungen notgedrungen belastet und Familien oder Freundeskreise gespalten werden. Eltern und Kinder reden nicht mehr miteinander. Es wird vermieden, beim Abendessen über Politik zu sprechen. Die Geister scheiden sich an der Frage, ob man sich zum gelben (pro Protest) oder blauen Lager (pro China) bekennt. Ich habe Bekannte, die zur Auswanderung entschlossen sind, eher heute als morgen. Sie fürchten, dass ihre Kinder in einer Gesellschaft aufwachsen, in der es keine Grundwerte mehr gibt. Als überall in der Stadt Schulen geschlossen waren, freuten sich Hongkongs normalerweise stark akademisch gedrillte Kinder über Tage des freien Spielens im Park. Ich wusste nicht, sollte ich lachen oder weinen, wenn ich sie „schwarze Polizisten“ gegen „Demonstranten“ spielen sah.

Quelle         :       Der Freitag          >>>>>       weiterlesen

Verna Yu | The Guardian      —    Übersetzung Carola Torti 

Der Freitag ist Syndication-Partner der britischen Tageszeitung The Guardian

———————————————————————–

Grafikquellen       :

Oben         —        Hung Hum in 2011

————————

Unten      —      Market in Mong Kok, Hong Kong

Abgelegt unter Asien, Feuilleton, Kultur, Umwelt | Keine Kommentare »

Die Müllverursacher

Erstellt von DL-Redaktion am 7. Dezember 2019

AfD – größter aller Umweltverschmutzer/in

Keine AFD 1.png

Von Stefan Weinert

Machen wir uns nichts vor. Bei all dem Streit innerhalb des Diskurs‘ „Klimawandel – Klimaerwärmung – Klimanotstand“, ja oder nein, und wie bekommen wir das in den Griff ?, übersehen wir alle womöglich den gröpßten Umweltvergifter im Land. Das nämlich ist die so genannte „Alternative für Deutschland“, die AfD!!

Wer den Bundesparteitag der AfD in Braunschweig verfolgt hat – bis hin zu dem ZDF-Interview am Sonntag-Abend mit dem neuen und verlogenen AfD – Vorsitzenden Tino Chrupalla (Umvolkung), der sich wenige Stunden zuvor bei seiner Kandidatenrede noch ganz ehrlich, seriös und zahm gab; wem klar ist, dass dieser, so wie auch Jörg Meuthen als weiterer Vorsitzender vom sogenannten völkischen Flügel des Björn Höcke mitgetragen werden und das auch bei den Stellvertreterposten sich mit dem Thüringer Stephan Brandner ebenfalls ein Höcke-Freund durchsetzen konnte, —> der/die weiß, was die Stunde geschlagen hat. 
 
Da nützt es auch nichts, wenn der halbe Saal dem Holocaust-Leugner Gedeon bei seiner Bewerbungsrede (!) zum Parteivorsitz den Rücken kehrt und/oder ihm die Rote Karte zeigt. Da nützt es ebensowenig, wenn Herr Meuthen wieder und wieder sein „Credo“ betet, das da heißt: „Ich dulde in der  AfD keine Rechtsnationalen, keine Holocaustleugner  und keine Antisemiten – für eine solche Partei stehe ich nicht zur Verfügung.“ tut er aber, und wie !! 
 
Bereits im Jahre 2016 habe ich – damals noch auf Facebook und generell im Internet – behauptet, die Afd sei die ideologische Nachfolgepartei der NSDAP von 1922 bis 1945. Die Bezeichnung NSAFD wäre – wenn schon ehrlich –  für diese Rechtsaußenpartei der passende und programmatischste Name . Was nützt dir und mir und unseren Kindern und Enkeln ein lebenswertes Ökosystem für das wir kämpf(t)en, wenn wir politisch und ideologisch im braunen Sumpf versinken. 
File:GarbageLibreville.JPG
 
Wer wirklich meint, das könnte in Deutschland nie wieder passieren, hat die Zeichen der Zeit und die Wirkkraft des faschistischen Virus nicht erkannt. Genauso, wie am 30. Januar 1933 von Papen meinte, mit Hitler leichtes Spiel zu haben und sagte: „In zwei Monaten haben wir Hitler in die Ecke gedrückt, dass er quietscht!“ Die AfD gehört verboten – nichts anderes!!
 
Im Folgenden habe ich alphabetisch die bekanntesten  Verursacher der Umweltvergiftung aufgelistet. Nicht rein zufällig steht hier die AfD an der Spitze.

Der größte Umweltverschmutzer ist/sind:

Auflistung alphabethisch

AfD

Atomkraftwerke

Benziner

Bundeswehr

Diesel

E-Mobile

Flugzeuge

Haushalte

Industriebetriebe

Kohlekraftwerke

Kreuzfahrtschiffe

Landwirtschaft

LKW

Mobilfunkstrahlung

Reisebusse

Tanker

Zigarettenraucher/innen

———————————————————–

Grafikquellen        :

Oben      —         Keine Alternative für Deutschland. Aufkleber gegen die Partei Alternative für Deutschland.

————————————–

Unten     —             Müllproblem in Libreville, der Hauptstadt des Gabun (2013)

Author Oshilumbu5 at German Wikipedia

This work has been released into the public domain by its author, Oshilumbu5 at German Wikipedia. This applies worldwide.

Abgelegt unter Baden-Württemberg, Deutschland, P.AfD, Umwelt | Keine Kommentare »

KOLUMNE MACHT

Erstellt von DL-Redaktion am 7. Dezember 2019

Alter? Ist doch ganz egal

File:Maischberger - 2016-12-14-7439.jpg

Von Bettina Gaus

Jüngere sind nicht automatisch doof, weil sie jünger sind. Und Ältere nicht, weil sie älter sind. Widmen wir uns also der Sache – und ziehen keine Schlüsse aus Geburtsdaten.

Junge Leute haben gemeinsam, dass sie jung sind, und das ist weder eine tolle Eigenschaft noch eine schlechte. Überzogene Hoffnungen, die Ältere oft mit ihnen allein wegen des Geburtsdatums verbinden, sind vor allem eines: Kitsch. Während Kritik an ihrer mangelnden Erfahrung meist ohne weitere Argumente auskommt, sondern sich lediglich nörglerisch und schlecht gelaunt präsentiert.

Thomas Mann war etwas jünger als Rezo, der erfolgreichste deutsche YouTuber dieses Jahres, als er die „Buddenbrooks“ veröffentlichte. Gerade das Bildungsbürgertum sollte nicht panisch reagieren, wenn sich Leute mit Mitte 20 oder Anfang 30 zu Wort melden und gehört werden. Sonst ist es mit der Bildung offenbar nicht weit her. Das Video „Die Zerstörung der CDU“, mit dem Rezo die Union in Not brachte, ist inzwischen mehr als 16 Millionen Mal geklickt worden. Damit lässt sich kein Nobelpreis gewinnen. Aber durchaus der Anspruch ableiten, ernst genommen zu werden.

Sebastian Kurz wurde im Alter von 31 Jahren österreichischer Bundeskanzler. Gegen seine Politik fällt mir vieles ein. Sein Alter ist mir egal. Übrigens hat er sein ganzes bisheriges Leben als Erwachsener in der Politik verbracht und sein Studium nie abgeschlossen. Genau wie der deutsche Juso-Vorsitzende Kevin Kühnert, 30. Viele der Argumente, die in den letzten Tagen gegen diesen ins Feld geführt wurden, sagen mehr über die – meist männlichen – Leserbriefschreiber und Nutzer sozialer Medien aus als über ihn. Der hat doch noch nie gearbeitet, der soll mal früh um sechs auf den Bau gehen müssen.

Ich wünsche all denen, die so etwas schreiben, dass sie einmal mit der Führung einer Organisation betraut werden, die etwa 80.000 Mitglieder hat. Wie die Jusos. Kevin Kühnert hat es nicht nur geschafft, den Laden zusammenzuhalten, sondern sogar, ihn wieder zu einer wichtigen politischen Kraft zu machen. Kompliment.

2018-02-23 Kevin Kühnert 0087.JPG

Das ändert allerdings nichts daran, dass seine Öffentlichkeitsarbeit in den letzten Tagen überraschend dämlich war. Wer sich mit ihm solidarisieren wollte, hatte es nicht leicht. Zwei Saltos rückwärts, einige Ausfallschritte und ein Purzelbaum nach vorne lösten Ratlosigkeit aus. Was will er denn nun? Groko ja, Groko nein – oder hat er in diesem Zusammenhang niemals eine Forderung gestellt? Auch nicht die, den Koalitionsvertrag neu verhandeln zu wollen?

Quelle         ;       TAZ         >>>>>         weiterlesen

—————————————————————

Grafikquelle          :Oben     — 

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: © Raimond Spekking / CC BY-SA 4.0 (via Wikimedia Commons)

——————————-

Unten        —     Kevin Kühnert, deutscher Politiker (SPD) und Bundesvorsitzender der Jusos. Hier während seiner Tour durch Deutschland in Sachen #NoGroKo am 23.02.2018 in München (TV-Interview). Titel des Werks: „Kevin Kühnert (2018 in München)“

Abgelegt unter Kultur, Medien, Mensch, Überregional | Keine Kommentare »

Eine exemplarische Debatte?

Erstellt von DL-Redaktion am 6. Dezember 2019

Die Armut der Kritik am Anarchismus

File:Jahve meets anarchy.jpg

Quelle       :        untergrund-blättle      CH.

Von Mona Alona

In der Erfurter Zeitung „Lirabelle“ hätte eine Debatte zur vermeintlichen Kritik am Anarchismus und seiner Verteidigung stattfinden können.

Teaser

Auslöser waren die Vorurteile, Diffamierungen welche die Autorin Minna Takver verbreitete, in Verbindung mit ihrer hanebüchenen Unkenntnis ihres Gegenstandes. Anstatt sich der Auseinandersetzung wirklich zu stellen, lehnte die Redaktion der Lirabelle den zweiten Teil der „Armut der Kritik des Anarchismus“ von Mona Alona ab. Da es sich um eine beispielhafte Reaktion handelt und es Formen solidarischer, respektvoller und konstruktiver Auseinandersetzungen weiter zu üben gilt, lohnt es sich, diese schriftliche Provinz-Debatte als Beispiel vor Augen zu führen. Und selbstverständlich, weil der zweite Teil der „Armut der Kritik am Anarchismus“ ja auch irgendwo noch auftauchen sollte und das Ganze ein gewisses Lesevergnügen bereitet.

Wer sich den billigen Szene-Gossip ersparen will, kann die Texte von Minna Takver auch überspringen. Wer den zweiten Teil der Entgegnung lesen möchte, kann ins letzte Viertel scrollen…

Kritik aktueller anarchistischer Praxis in Jena. Teil I

(http://lirabelle.blogsport.eu/2019/05/22/kritik-aktueller-anarchistischer-praxis-in-jena-teil-i/)

Als Hotspot linksradikaler Politik in Thüringen birgt die anarchistische Szene Jenas auch kritikwürdige Aspekte. Minna Takver widmet sich in zwei Teilen der anarchistischen Strategie und ihrer Auswirkungen. Dieser erste Teil beleuchtet Anthropologie und Aktionen, der zweite Teil Identifikation und Geschichtskonstruktion. Die Autorin ist Mitglied im Club Communism.

A! In Jena; da ist was los!

So die Antwort auf die Frage, wo denn in Thüringen linksradikal am meisten geht, wenn der Eindruck entsteht, es gibt allerorten nur FaschistInnen und andere Menschenfeinde; die stetige berechtigte Angst vor Übergriffen inklusive. Viele in der Jenaer Szene eint, dass sie sich selbst unter der Bezeichnung anarchistisch verorten lassen oder durch ihre Politik dort zugeordnet werden können. Es gibt dort seit Jahren eine intensive Auseinandersetzung mit anarchistischer Theorie, an der sich jede_r beteiligen kann.

Mindestens genauso lange gibt es anarchistisch geprägte Aktionen im öffentlichen Raum, die linken Belangen Sichtbarkeit verschaffen, zum Beispiel, wenn es um die Frage nach Räumen zum Leben für Alle geht. Auch ganz konkret anarchistischen Raum gibt es, der offen ist, durch die Angebote, sowie durch seine hervorragende Lage in der Stadt. Es gibt mehrere anarchistische Medien, sowohl analog als auch digital. Und vor allem gibt es anarchistische Menschen, die solidarisch kochen, die sich in ihrer Betroffenheit als Eltern/-teile austauschen, die bei staatlicher Repression helfen, die sich nicht scheuen mit jüngeren oder neuen Gesichtern ins Gespräch zu kommen, die den Blick auf linksradikale Praxis über die deutschen Grenzen hinaus wagen, die Gefangene unterstützen, die sich mit der (radikalen) linken Geschichte in Jena und Umland auseinandersetzen, die gemeinsam wandern gehen, die unentgeltlich beim Stress mit der Lohnarbeit helfen, die Bücher und Wissen teilen und dabei stets versuchen, für antifaschistische, feministische und antirassistische Belange einzutreten. Dabei begegnet man den Leuten in ihrem Alltag, sei es Lohnarbeit, Familie oder Freizeit, was aller Kritik zum Trotz die dominante Realität ist.

Anarchist_innen in Jena schauen Filme, hängen ab, feiern gemeinsam und nehmen sich Zeit für ein Bier/eine Brause in lauschiger Umgebung, politisch interessante Gespräche inklusive. Es werden allgemein Menschen angesprochen, die irgendwie links sind, und mit den Gefangenen Leute unterstützt, die dem Staat in spezieller Weise ausgeliefert sind und auf „die draussen“ angewiesen sind. Durch die Aktionen und Räume tritt mit den Anarchist_innen in Jena linksradikale Politik unbestreitbar und dankenswerterweise aus ihrem Versteck heraus. Gerade weil diese Form der Praxis keine Selbstverständlichkeit unter den gegebenen Bedingungen ist, drängt sich die Frage auf, wie das möglich ist und welche Konsequenzen das hat. Bei näherer Betrachtung lässt sich in der anarchistischen Praxis eine Strategie entdecken, die diese antreibt, und deren Schwächen und Auswirkungen Sorge bereiten.

„Die Keimzelle einer neuen Gesellschaft“

Besagte Strategie möchte ein Umfeld zur politischen Radikalisierung und Betätigung schaffen. Es soll möglichst viele Bereiche menschlichen Lebens abdecken, um alle interessierten Menschen zu erreichen. Dazu wurden und werden Stützpunkte geschaffen, wie sie es schon länger in Jena gibt. Sie zu doppeln kann also nur den Zweck haben, sich vom Rest der radikalen Linken abzusetzen. Dadurch besteht die Gefahr der Schwächung strömungsübergreifender politischer Strukturen. Die besagten Stützpunkte bilden die wesentlichen Eckpfeiler des anarchistischen Zusammenhangs, in dem sich Menschen radikalisieren können sollen, um dann in den Rest der Gesellschaft hinein wirken zu können, mit dem Ziel eine Bewegung aufzubauen, die die Verhältnisse umstürzt. Dabei wird vernachlässigt, dass es auch in sogenannten Freiräumen kein Aussen von dieser Gesellschaft gibt und es geht damit eine Vorstellung von Menschen einher, die durch die Gesellschaft verblendet seien und in der richtigen Umgebung zu politischem Bewusstsein kämen.

Hauptgegner der Anarchist_innen sind Staat und Faschismus. Der Umkehrschluss daraus ist, dass jegliche Zusammenarbeit mit dem Staat korrumpiert. Konkrete Verbesserungen mit dem Staat (mit den FaschistInnen auch für die Autorin undenkbar) werden als reformistisch heruntergespielt. Zentral ist der Aufbau der anarchistischen Blase, nicht die Menschen, wodurch konkrete Verbesserungen ihrer Lebensumstände nur erkämpfenswert sind, weil sie gegen den Staat oder FaschistInnen durchgesetzt werden könn(t)en. So ist die Blase nur sehr eingeschränkt offen für Menschen, die für eine progressive Politik eintreten, ohne dass diese revolutionär ist. Auch schliesst sich die Blase gegen eine selbstkritische Infragestellung ab, wie sie notwendig sein wird, wenn ihre Stützpunkte nicht mehr der eigenen Gesellschaftsanalyse adäquat oder der eigenen Politik zweckmässig sind.

Es wird auch ausgeblendet, dass Stützpunkte primär von aussen bestimmt sind. Anarchistische Stützpunkte in Jena werden vorbehaltlos gefeiert, ohne offen zuzugeben, wie prekär ihre Existenz im Angesicht staatlicher Repression ist oder dass es sie ohne Bezug szeneexterner Ressourcen schwerlich geben kann. Die anarchistische Blase gibt sich autark gegen alles andere und macht sich damit selbst zu einer leichten Beute staatlicher Repression, da sie weder einen zivilgesellschaftlichen Deckmantel besitzt noch bürgerlichen Rückhalt will: kündigt ihnen die Vermieterin auf medialen oder politischen Druck hin, haben sie nichts in der Hand; werden ihre Vereinsstrukturen als staatsfeindlich verboten, gibt es wenig Gegenargumente vor Gericht.

„Konkrete Kämpfe gegen diese Verhältnisse“

Mit der Vorstellung von Menschen, als durch die richtigen Umstände radikalisierbar, geht auch einher, dass solche Umstände gezielt hergestellt werden könnten. Zentral hierfür ist die Konfrontation mit den beiden Hauptgegnern Staat und FaschistInnen, durch die Menschen ein (im linksradikalen Sinne) positives politisches Bewusstsein entwickeln würden. Staatliche Repression gilt dabei im Zweifelsfall als Bestätigung der eigenen Strategie. Mit dieser Strategie der direkten Konfrontation liegt es nahe, ohne Rücksicht auf Verluste vorzugehen, sei es für die Verhinderung eines Fascho-Aufmarsches oder das Erkämpfen eines selbstverwalteten Hauses.

Leider zielte die reale Aktion selten ernsthaft darauf: kein Haus wurde in Jena in den letzten Jahren besetzt, mit der Absicht es hinterher tatsächlich zu behalten. Die existierenden Stützpunkte sind alle auf legalem Weg eingerichtet worden. Und zwar aus gutem Grund: da sie nicht in der Konfrontation erkämpft wurden, sind sie bisher auch nicht so in den Fokus von Staat oder FaschistInnen geraten, dass sie in ihrem Bestehen gefährdet wären. In der Deckung zu agieren, war im Falle der Stützpunkte definitiv erfolgreicher als die direkte Auseinandersetzung mit dem Staat (und anderen Grundeigentümer_innen).

Gleiches gilt für Fascho Aufmärsche: sich nicht dabei erwischen lassen, wie man einen Kabelbrand verursacht oder vorab anonym Informationen für die bürgerliche Öffentlichkeit zu publizieren, wäre im provinziellen Thüringen wirksamer, als mit ein bis zwei Dutzend Anderen nur unzureichend vermummt den Versuch zu wagen, gegen die Materialübermacht der Bullen anzurennen oder in der direkten Auseinandersetzung Schaden davon zu tragen. Darüber hinaus gibt es keine grösseren Aktivitäten Jenaer Anarchist_innen, um FaschistInnen das Leben schwer zu machen. Letztere werden immer erst dann konkret relevant, wenn sie in der Stadt politische Veranstaltungen machen und anlässlich des staatlichen Aufgebots sich der Erfahrungsraum der direkten Gruppen Konfrontation eröffnet.1 Eine solidarische Masse in die Auseinandersetzung mit Polizei oder Justiz zu ziehen, indem man die Unterstützung zum Beispiel bei Hausbesetzungen einfordert, nur um eine politische Radikalisierung hervorrufen zu wollen, ist so gefährlich wie kein anderer Teil der anarchistischen Strategie.

109 tramsigt klotter (39037057).jpg

Die Wahrscheinlichkeit, dass Menschen aus solchen Konfrontationen beschädigter heraus kommen als vorher, ist so viel höher als die, dass sie sich entschliessen hinterher ihr politischen Engagement auszudehnen. Der deutsche Staat ist leicht dazu in der Lage jede_n von uns zu brechen, geschundene Körper, zerstörte Privatexistenzen und traumatisierte Psychen bleiben. Die Sicherheit jedes einzelnen Menschen aber sollte aufgehoben sein in radikaler Politik und nicht durch sie hinweg gewischt werden. Jede politisch emanzipatorische Aktion muss vorher mit den Risiken, die sie birgt, mit den Bedürfnisse, der an ihr Beteiligten, und ihren Zielen abgewogen werden. Das geht nur im Dialog und sei es dadurch, dass man als Initiator_innen Risiken und Ziele transparent macht. Selbstkritik verhütet womöglich, dass wir noch härter gegen uns selbst und damit noch härter gegen andere werden.

Die Armut der Kritik am Anarchismus. oder: A macht Wissen (Teil 1)

(http://lirabelle.blogsport.eu/2019/10/08/die-armut-der-kritik-am-anarchismus-oder-a-macht-wissen-teil-i/)

Ohne Freude arbeitet sich Mona Alona an Minna Takvers Text in der letzten Lirabelle ab, weil sich dieser als paradigmatisch für die Armut der Kritik am Anarchismus dafür anbietet. Und weil es einiger Richtigstellungen bedarf.

Starke Irritation rief der Artikel von Minna Takver bei mir hervor. Im Gespräch stellte sich heraus, dass dies Freund*innen ähnlich ging, die etwa äusserten, sie wüssten nicht, ob sie in der gleichen Stadt wie die Autorin leben. Insgesamt vermisse ich in Takvers Text den Ansatz, einer politischen Szene tatsächlich Selbstreflexion zu ermöglichen und sie organisatorisch, strategisch oder theoretisch weiterzuentwickeln. Dies könnte erstens gelingen, wenn es sich um eine selbstkritische Perspektive handeln würde, zweitens, wenn der Text von Minna Takver nicht zur Hälfte aus Unterstellungen bestehen würde und wenn in ihm schliesslich, drittens, überhaupt sein Gegenstand erfasst werden würde, den er bedauerlicherweise zur Gänze verfehlt. Anstatt über Ethik, Organisation und Theorie des Anarchismus zu schreiben, würde ich mich lieber mit „konkreten Kämpfen gegen diese Verhältnisse“ befassen. Die hanebüchene Unkenntnis des Anarchismus‘, die langweiligen Vorurteile und der nahezu historische Abgrenzungsreflex ihm gegenüber, lassen mein Schreiben jedoch schon fast als eine solche (leider notwendige) Auseinandersetzung erscheinen. Deswegen lohnt es sich, mich fragend durch Takvers Text voran zu graben:

Die rein negative Kritik, welche Takver formuliert, ist der Abglanz einer untergehenden Epoche. Einer, in der Menschen traumatisiert von ihrem Vernichtungspotenzial waren und damit einen Umgang finden mussten. Dies ist verständlich und dem ist nichts hinzuzufügen. Es war aber auch eine, deren Nachgeborenen es sich in gewisser Weise leisten konnten, sich in ihrem Selbsthass zu suhlen, einen allzu deutschen Zynismus zu kultivieren und ihre politische Praxis zu weiten Teilen in schmutzigen Grabenkämpfen zu sehen. Damit meine ich wohlgemerkt nicht die zivilgesellschaftlichen Schützengräben in den Herrschaftsverhältnissen, sondern die Differenzen zwischen an sich vernünftigen Leuten. Darum schreibe ich es in diesem Zusammenhang in aller Deutlichkeit: Eine gesellschaftliche Linke, die nicht mehr aufzubieten hat, als allein ihre negative Kritik, wird künftig keinerlei Relevanz mehr beanspruchen können, sondern als krude Marotte abgewiesen werden. Als zu gross, zu tief, zu umfassend stellt sich die multiple gesellschaftliche Krise dar. Übrigens nicht allein für Personen in linksradikalen Kreisen.

Dies führt zum zweiten Punkt, dem falschen Verständnis von gesellschaftlicher Totalität. Takver – und ich beziehe mich hier stellvertretend auf sie – bedarf ihrer. Sie scheint fast existenziell auf sie angewiesen zu sein, um mit dem Gefühl ihrer eigenen Ohnmacht zurecht zu kommen und jenem einen Sinn zu verleihen. Doch das Ohnmachtsgefühl in dieser Gesellschaft ist, ebenso wie die Angst vor „Konfrontationen“, ein Produkt derselben. Wie zurecht bemerkt wurde, trifft dies selbstverständlich auch auf das Bedürfnis nach „Handlungsfähigkeit“ oder der Sehnsucht nach „Gemeinschaft“ in diesen vereinsamenden gesellschaftlichen Zuständen zu.

Weil dies jedoch der Fall ist, zeigt sich dadurch, dass es durchaus unterschiedliche Möglichkeiten gibt, mit den ökonomischen, sozialen, kulturellen, politischen Verhältnissen umzugehen, auf sie zu reagieren oder gar in ihnen zu agieren. Dass im Anarchismus agency und community betont werden, ist nicht vorrangig naiv oder eine Verkennung der Umstände, sondern ebenfalls Teil der Realität – mit ihren jeweiligen Potenzialen und Problemen. Hierbei ist es kein Zufall, dass zeitgemässe progressive links-emanzipatorische Texte mit dem wörtlichen – also vulgären – Verständnis von gesellschaftlicher Totalität brechen und sich stattdessen auf die Suche nach Verhältnissen begeben, die parallel zu den dominanten ebenfalls vorhanden sind.

Drittens. Was versteht Takver nicht alles unter „Anarchismus“? In Kürze: Alles, was irgendwie in der linken Szene herum springt und Aspekte von Selbstorganisation aufweist. Solidarisches Kochen, wie auch immer finanzierte oder betriebene selbstorganisierte Räume oder das Teilen einer gemeinsamen (zu unterschiedlichen Graden politisierten) Lebensrealität, hat aber zunächst einmal nichts mit Anarchismus zu tun. Vielmehr handelt es sich um Praktiken, die wahrscheinlich in jeder linken Szene von Jena bis nach Sydney gelebt werden. Es stimmt, dass Anarchist*innen solche Dinge als Formen potenziell egalitärer Selbstorganisation betonen und diese als „Keimzellen einer neuen Gesellschaft“ betrachten.

Es stimmt aber ebenso, dass die gesamte sozialistische Bewegung – historisch betrachtet – selbstorganisierte Institutionen und Beziehungen in einem solch beachtlichen Umfang hervorbrachte, dass die Vorstellung, damit die zukünftige Gesellschaft bereits aufzubauen, für viele keineswegs als abwegig angesehen wurde. Takver kritisiert nicht „den“ Anarchismus, wie sie behauptet. Ihr Szene-Gossip ist keine Kritik. Sie wettert gegen linke Szenen allgemein, wo denn noch welche zu finden sind. Aus ihrer Darstellung müsste konsequenterweise geschlussfolgert werden, dass der Anarchismus die einzige verbleibende sozialistische Strömung ist. Was zweifellos unsinnig wäre. Mit der Handvoll tatsächlicher Anarchist*innen setzt sie sich nicht auseinander.

Deswegen sollte Takver, viertens, wenn sie meint, Politik-Beratung für Jenaer Szene-Angehörige betreiben zu müssen, auch einen Schimmer von dem haben, wovon sie schreibt. Völlig fehlgeleitet ist ihre Unterstellung, Anarchist*innen in Jena würden die vermeintliche Übermacht des Staates in einer „direkten Konfrontation“ verkennen. Allein ihrer Fantasie entspringt es, dass sie uns andichtet, wir würden mit den Bullen kämpfen wollen – quasi so „Mann gegen Mann“, wie irgendeine bescheuerte maoistische Gruppierung andernorts. Gleichwohl gibt es ein ganzes Bündel emanzipatorischer Wege, „weder von der Macht der anderen, noch von der eigenen Ohnmacht sich dumm machen zu lassen“ (Adorno). Neben anarchistischen Ansätzen werden diese in Jena dankenswerterweise auch von einer guten feministischen Organisierung gepflegt.

Ob absichtsvoll oder unbewusst entsprechen sie dem Konzept von sozialer Revolution. Dieses meint eine prozesshafte, umfassende und radikale Transformation der Gesellschaft auf verschiedenen Ebenen. Die soziale Revolution geht von den vorfindlichen gesellschaftlichen Bedingungen und Beziehungen aus, bezieht sich nicht auf den Staat und kritisiert deswegen auch rein politische Handlungsmodi. Dass dies innerhalb linksradikaler Kreise schwer vermittelbar zu sein scheint, ist keineswegs der Unzulänglichkeit oder Unverständlichkeit anarchistischer Theorien geschuldet. Vielmehr zeugt diese Vermittlungsschwierigkeit von der Armut an Vorstellungskraft, Motivation, Selbstbewusstsein, Aufrichtigkeit und Erfahrung in den Teilen der deutschen gesellschaftlichen Linken, die ich hiermit adressiere.

Wenn Takver sich nur etwas mit anarchistischem Denken befassen würde, könnte sie auch, fünftens begreifen, dass ihre Behauptung, Jenaer Anarchist*innen würden im „Staat“ und „Faschismus“ ihre „Hauptgegner“ sehen, völliger Humbug ist. Sicherlich ist der libertäre Sozialismus das diametrale Gegenstück zum Faschismus. Aus diesem Grund betreiben Anarchist*innen Antifaschismus aus Notwendigkeit, aber nicht als Selbstzweck. (Dies gilt übrigens auch für alle anderen Aktivitäten.) Wir sind in einer historisch-politischen Konstellation angekommen, wo blosse Versuche der Abwehr des Faschismus diesen nicht mehr verhindern (werden). Deswegen braucht es (oftmals schwache und teilweise widersprüchliche) Ansätze, wie wir die bestehende Gesellschaft überwinden können. Denn der Faschismus kommt nicht von „rechts aussen“, sondern entsteht bekanntlich in ihrer Mitte.

Im Unterschied zu den meisten marxistisch geprägten Linksradikalen, meinen Anarchist*innen eine solche Aussage nicht als hohle Phrase, um dann praktisch sozialdemokratische Politik zu machen. Umgekehrt bedeutet dieser Anspruch allerdings, unser tägliches Handeln sozial-revolutionär auszurichten. Das ist ziemlich unspektakulär und es gibt dafür auch keine moralischen Bewertungsmassstäbe, wer dies zu welchem Grad tut. Eigentlich ist dies auch der Hauptgrund für eine kollektive Organisierung: Sich gemeinsam zu bewegen – etappenweise, verbunden mit unseren konkreten Lebenssituationen und -umfeldern und als die bestimmten Personen, die wir sind.

Als absoluter Quatsch erweist sich in diesem Zusammenhang Takvers Aussage, eine wäre „gefährlich“ eine „solidarische Masse in die Auseinandersetzung mit Polizei oder Justiz zu ziehen, indem man die Unterstützung zum Beispiel bei Hausbesetzungen einfordert, nur um eine politische Radikalisierung hervorrufen zu wollen“. Jedes Wort ist hierbei hohl und giftig. Traurig ist, dass die Autorin offenbar nie Solidarität erfahren hat. Ihre Behauptung, das Ziel einer Soli-Kundgebung wäre das Hervorrufen einer „Radikalisierung“ ist ein Affront. Lieber lässt sie Menschen in ihrer Betroffenheit allein, als sie darin zu unterstützen. Dies mag seinen Grund darin haben, dass sie Leid gar nicht überwinden möchte, weil sonst die Grundpfeiler ihrer Identität bröckeln würden. Ich befürchte, gerade daraus entwickelt sich der instrumentelle Charakter, den sie nun anderen unterstellt.

Um abschliessend zu Takvers Lieblingsthema zu kommen, den sogenannten „Stützpunkten“. Die hierbei mitschwingende militärische Denkweise wird sicherlich von den meisten (der paar) Anarchist*innen in Jena abgelehnt, weswegen wir sie uns nicht einfach zuschreiben lassen sollten. Der Begriff „Freiräume“ hat allerdings ebenfalls seine Nachteile. In jüngeren Diskussionen wird dagegen viel von „Zwischenräumen“ gesprochen, was ich erst mal für einen guten Arbeitsbegriff halte. Takvers Vorstellung, ein Raum, wie beispielsweise das FAU-Lokal könnte sich nur durch indirekte staatliche Gelder finanzieren, ist eine blosse Diffamierung, die der Verleumdung als „Antifa e.V.“ wenig nachsteht. Das Lokal wird von den Mitgliedern vollständig selbst getragen. Es ist so anfällig gegenüber staatlicher Repression wie jeder Raum in der Öffentlichkeit. Selbst Linkspartei-Büros sind davon bekanntlich nicht ausgenommen. Wenn Takver den „Jenaer Anarchist*innen“ also empfehlen sollte, ein Haus in der Innenstadt zu kaufen und Eigentümer zu werden, so wären sie sicherlich nicht dagegen. Sie würden es bloss für utopisch im schlechten Sinne halten.

Kritik aktueller anarchistischer Praxis in Jena. Teil II

(http://lirabelle.blogsport.eu/2019/10/08/kritik-aktueller-anarchistischer-praxis-in-jena-teil-ii/)

Als Hotspot linksradikaler Politik in Thüringen birgt die anarchistische Szene Jenas auch kritikwürdige Aspekte. Minna Takver widmet sich in zwei Teilen der anarchistischen Strategie und ihrer Auswirkungen. Der erste Teil beleuchtet Anthropologie und Aktionen, dieser zweite Teil Identifikation und Geschichtskonstruktion. Die Autorin ist Mitglied im Club Communism.

„Historische Tradition und Werte des Anarchosyndikalismus“

Auf den Gegenprotesten zu Fascho Demos in black block Kluft herum rennen birgt einen Reiz, dem sich weder Autorin noch Jenaer Anarchist_innen entziehen können: dadurch fühlt man sich als Teil von etwas grösserem, es gibt einen Zusammenhang zwischen mir und jeder anderen, die so herum rennt (auch wenn es kaum Sinn macht ausserhalb eines konkreten black block). Mit dem hoch gezogenen Tuch über Mund und Nase bin ich anders als die anderen Normalos, ich bin ein Vorschein auf die Zukunft. Dazu bleibt nur zu sagen: hoffentlich nicht!

Nicht nur in Demo Aktionen schaffen sich Jenaer Anarchist_innen eine gemeinschaftsstiftende Identität. In ihrer Blase werden Menschen Identifikationsangebote gemacht: es gibt diverse kulturelle Aktivitäten, konsumierbare Waren und die Konstruktion einer fast schon mythischen, heroischen anarchistischen/autonomen/antifaschistischen Geschichte durch Entdeckung immer neuer Held_innen in Jena/er Umland/Thüringen. Dabei dient die Auseinandersetzung mit der eigenen linksradikalen Geschichte nicht dazu, sich ihr Scheitern einzugestehen und aus ihren Fehlern und theoretischen Sackgassen zu lernen. Stattdessen wird im anarchistischen Umfeld für Jena eine historische Kontinuität hergestellt, die letztlich als Legitimation für das heutige Wirken dient, statt Legitimität durch die Vertretung der eigenen Politik herzustellen (die dann freilich sich ihrer gesellschaftlich marginalen Position bewusst sein müsste).

Auch durch den engen, solidarischen Bezug auf süd/süd-ost/osteuropäische gegenwärtige anarchistische Praxis wird Identität gemacht, wobei die Schwächen der anderen Anarchismen unsichtbar bleiben. Eine kritische Haltung zu revolutionärer Praxis oder Theoriegeschichte und ihre Transformation sind dabei nicht in Sicht. Die Konstruktion von Gefangenen als einer zu befreienden Gruppe von Unterdrückten, mit denen eine kontinuierliche Zusammenarbeit möglich ist, ist ebenfalls Teil anarchistischer Identität. Selbst wenn Gruppen im anarchistischen Spektrum in einem Staatsbetrieb für bessere Arbeitsbedingungen kämpfen, sind sie trotz ihrer staatlich hoch legalistischen Mitteln (Klagen vor Gericht, angemeldete Kundgebungen) keiner Kritik innerhalb der anarchistischen Szene Jenas ausgesetzt. Daran lässt sich wohl am deutlichsten ablesen, dass die gemeinsame Identität wichtiger ist als die konkrete politische Praxis.

Gleiches gilt für die immer wiederkehrende Diffamierung einer so genannten „Staatsantifa“, unabhängig davon, ob sie die Lebensbedingungen von Menschen verbessert oder nicht. Die Gegner von Anarchist_innen und „Staatsantifa“ sind die gleichen: FaschistInnen; aber nur erstere agieren wahrhaft authentisch gegen sie, da sich Zweitere mit dem anderen Hauptgegner (Staat) verbünden. Und wieder gibt es keine interne Auseinandersetzung mit dieser zweifelhaften Selbstbeweihräucherung. Die anarchistische Blase Jenas neigt wie alle Blasen dazu szene- und/oder subkulturförmig zu werden und sich damit gegen Kritik abzuschliessen. An dieser Stelle drängt sich die unbeantwortete Frage auf, wie Solidarität mit noch lebenden und bereits verstorbenen Menschen aussehen kann, die für die Emanzipation streiten/stritten, ohne dass es in Verklärung dieser Menschen abdriftet?

Diese Frage betrifft nicht nur Anarchist_innen. Weiter steht die Frage im Raum für wen ein solches Identitätsangebot attraktiv ist: In Jena gibt es eine enge Verknüpfung des grösseren anarchistischen Dunstkreises mit der studentischen Lebensrealität, die weitgehend abgekoppelt ist von der Freizeit- und Lohnarbeits-/Schulrealität des Rests der Gesellschaft. Dabei herrscht die bereits erwähnte Mentalität von „GANZ ODER GAR NICHT“ vor, welche sich mit dieser Lebensrealität einfacher vereinbaren lässt. Leider lässt sie sich nach dem Ende des Studiums auch einfach wieder ablegen und so wählt der grössere Dunstkreis Option 2, der harte Kern Option 1. Eine politische Betätigung grösserer Zusammenhänge über die Zeit des Studiums hinaus wird so nicht realisierbar.

Keine Lösung

Aus der identitätsstiftenden Blase heraus gibt es gelingende Kooperation mit und gegenseitige Unterstützung von verschiedensten nicht anarchistischen linksradikalen Menschen und Gruppen in der Kleinstadt Jena. Resigniert lässt sich vermuten, dass das aus der eigenen Schwäche der anarchistischen Blase und einem Mindeststandard linker Politik resultiert. Die Sorge bleibt, dass die Anarchist_innen uns im Stich lassen, wenn sie stark geworden sind, weil wir keine Anarchist_innen sind. Die Stärke der anarchistischen Szene in Jena ist ihre Aktivität. Ihre Schwäche die geringe Selbstkritik. Ihre Gefährlichkeit der kompromisslose Hunger nach Widerspruchslosigkeit. Mit der Kritik daran verbindet sich die Hoffnung, dass doch noch alles für alle gut wird, denn eine andere Lösung hat die Autorin nicht.

Die Armut der Kritik am Anarchismus oder: A macht Wissen. Teil II

Gespannt wartete Mona Alona auf die letzte Ausgabe der Lirabelle, um zu lesen, ob es Minna Takver gelingen würde, ihren haltlosen Szene-Gossip auf die Ebene von Kritik zu hieven. Doch wiederum wurde sie massiv enttäuscht. Mona hätte es nicht für möglich gehalten, dass der zweite Teil von Takvers vermeintlicher „Kritik aktueller anarchistischer Praxis in Jena“ tatsächlich ebenso problematisch wie der erste ist. Daher fühlte sie sich dazu getrieben, diese Steilvorlage zu nutzen, um Grundlagenwissen zu vermitteln.

1887 wurde ein Buch veröffentlicht, das den reisserischen Titel Der Anarchismus und seine Träger. Enthüllungen aus dem Lager der Anarchisten trägt. Sein junger Autor, Rudolf Emil Martin, positioniert sich darin als vehementer Anti-Anarchist. Er reiste im Stile eines schmierigen Boulevard-Journalisten nach London um die dortige #anarchistische Szene – in ihr viele exilierte Deutsche und Russen – vorgeblich investigativ zu studieren. Aufgrund seines übertrieben bürgerlichen Bewusstseins, seiner mangelnden Lebenserfahrung, wie auch seiner fetischistischen Staatsgläubigkeit, besteht sein Buch jeweils zu einem Drittel aus blossen Erfindungen, aus falsch eingeordneten Wahrnehmungen, sowie aus kontextlosen Zitaten von anarchistischen Flyern und Zeitungen. Bis 1919 entwickelte sich Martin zum Anhänger der Sozialdemokratie ohne irgendwelche Kontakte zu sozialen Bewegungen zu haben. Nur diese könne nach dem grossen Krieg noch das Chaos der Anarchie verhindern, glaubte er. So wie Martin ist Minna Takver nicht ansatzweise in der Lage, ihren Gegenstand zu erfassen und sich mit Menschen auseinanderzusetzen, die ihn tatsächlich kennen. Im Unterschied zu ihm versteht sie sich vermutlich nicht (mehr) als kleinbürgerliche Sozialdemokratin, sondern als sowas wie Kommunistin. Umso trauriger, dass sie offensichtlich nicht in der Lage ist, selbst irgendeine inhaltliche Positionen zu beziehen. Stattdessen ernährt sie sich wie ein Zombie durch die Diffamierung von Menschen, die ihre potenziellen Genoss*innen sein könnten. Aus diesem Grund wird ihre Ideologie auch untot bleiben und nie eine progressive emanzipatorische Rolle spielen können. Nun aber im Detail zur Wiederlegung von Takvers herbeiphantasierten Behauptungen:

Identität scheint für Takver ein Reizwort zu sein. Umso erstaunlicher ist es, dass sie „der anarchistischen Szene in Jena“ Identifikationen zuschreibt, von denen sie offensichtlich jedoch keinerlei Ahnung hat. Unter der Überschrift „Historische Tradition und Werte des Anarchosyndikalismus“ schreibt sie völlig zusammenhangslos davon, dass sie es sinnlos findet, wenn sie selbst unorganisiert und ziellos im black block herumläuft. Was das mit Anarchismus zu tun haben soll, ist mir schleierhaft, ebenso wie die blosse Erfindung, Anarchist*innen würden sich irgendwelcher Heldenmythen bedienen. Wenn wir uns nicht das Scheitern auch von Geschichten ansehen würden, an denen Anarchist*innen beteiligt waren, hätten wir 2014 keine Veranstaltungsreihe unter dem Motto „Gekonnt scheitern“ organisiert, um genau dies zu thematisieren.

Von „theoretischen Sackgassen“ des Anarchismus zu sprechen, steht Takver dabei absolut nicht zu, weil sie keine Ahnung von anarchistischer Theorie hat, wie sich in ihren Texten überdeutlich zeigt. Die Bezugnahme auf eine historische Tradition würde die Legitimation für das Handeln im Hier und Jetzt herstellen, lesen wir weiter. So what? Genau die Beschäftigung mit der eigenen Geschichte ermöglicht ja erst ein Lernen und die Selbstreflexion, zu welcher Takver nicht fähig ist. Im Übrigen „legitimieren“ wir uns durchaus vorrangig durch das, was wir tun und nicht durch irgendwelche vorgetragenen Phrasen, wie es Takver oder irgendwelche rot-roten Gruppen tun.

Erneut zeigt sich, dass Takver durchgängig von sich auf andere schliesst, somit also die Beschäftigung mit ihren eigenen Widersprüchen vermeidet. Anstatt selbst zu denken – oder auch mal nachzufragen – ringt sie wie im ersten Text mit ihrer eigenen Orientierungslosigkeit und bringt nicht den Willen auf, gegen ihre Ohnmachtsgefühle handlungsfähig zu werden. Anarchismus ist etwas Bestimmtes. Seine ethischen Wertvorstellungen, Organisationsprinzipien und theoretischen Grundsätze entspringen nicht dogmatischen Festlegungen oder idealistischen Konstruktionen, sondern den jahrzehntelangen Erfahrungen in sozialen Bewegungen. Position zu beziehen, die über das Anti-Irgendwas hinausgeht – dafür steht der Anarchismus heute wie auch in den sozialistischen Geschichten.

Auch die praktizierte antinationale Solidarität namentlich mit „süd/süd-ost/osteuropäischen“ anarchistischen Gruppen hält Takver fälschlicherweise für einen Aspekt unserer Identititätskonstruktion. Eigentlich kennen nur einige von uns Leute, die Leute kennen und das ist alles. Sich auf den osteuropäischen Kontext zu beziehen ist jedoch auch darüber hinaus sinnvoll, um auch nach 30 Jahren von der post-realsozialistischen Situation zu lernen, das heisst, auch weiterhin die Irrwege des Staatssozialismus zu kennen und zu benennen. Ausserdem wissen jene, die ansatzweise antinational unterwegs sind, dass es emanzipatorische Kräfte in osteuropäischen Ländern noch deutlich schwerer haben, als hierzulande. Mit den „Kommunist*innen“ dort ist keinerlei emanzipatorische Politik zu machen. Seit seiner Entstehung war der Anarchismus eine globale Bewegung, die sich zugleich lokale Verankerungen schaffte. Antinationale Solidarität zu praktizieren ist auch heute wichtig und sollte möglichst auf direkten Kontakten statt auf antiimperialistischen Projektionen beruhen.

Persönlich angesprochen fühlte ich mich, als Takver vom Staatsantifaschismus schrieb, denn das ist eines meiner vielen Lieblingsthemen. Ob jemand „authentisch“ gegen den Faschismus handelt oder nicht ist mir dabei ziemlich egal. Wie bei allen sozialen Kampffeldern wäre allerdings mein Wunsch, dass Antifaschismus (wieder) autonomer geschieht. Dies ist eine strategische Frage, die nichts mit einer angeblichen „Selbstbeweihräucherung“ zu tun hat. Bekanntermassen verhinderten die staatlichen Präventionsprogramme gegen Rechtsextremismus nicht, dass in den letzten Jahren ein neuer Rechtsterrorismus entstanden ist.

Die Gewaltbereitschaft, der Waffenbesitz, die Kampferfahrung und die militante Organisierung von Neonazis und anderen Faschisten haben noch einmal deutlich zugenommen. Die staatlichen Repressionsbehörden unternehmen – trotz ihrer geheimdienstlichen Erkenntnisse – wenig und nur sporadisch etwas dagegen. Die Gründe dafür liegen auf der Hand: rechtsterroristische Verschwörungen reichen bis in die Kreise von Elitesoldaten, Polizei und Innenministerien. Tendenziell dienen sie autoritären staatlichen Interessen, weil sie sich vorrangig gegen Nicht-Staatsbürger*innen und emanzipatorische soziale Bewegungen richten.

Wie man nach den Erfahrungen mit dem Verfasssungsschutz im Nachgang des NSU-Terrors noch naiv den Staat als Verbündeten gegen den Faschismus begreifen kann, ist mir unklar. Und dennoch nutzen wir selbstverständlich die Mittel, die wir zur Verfügung haben. Möglicherweise arbeitete sogar die eine oder andere von uns bei der „Staatsantifa“. Vielleicht sogar für Lohn! Wir sind so grossherzig, dass wir sie dennoch nicht aus unserem identitären Klüngel ausgeschlossen haben – Stell dir das mal vor, Minna Takver! Also lass uns diese onging debate des Verhältnisses zum Staat gerne weiterführen.

Über Szenen und die vermeintlich studentische Blase schrieb ich ja schon im vorherigen Teil. Wiederholt zeigt Takver, dass sie nicht „den“ Anarchismus kritisiert, sondern die linke Szene in Jena. Damit betreibt sie also eine Gleichsetzung, die für alle Beteiligten völlig unangemessen ist. Zudem behauptet sie damit einen Standpunkt ausserhalb der Szene einzunehmen, den sie offensichtlich nicht hat, da sie gegen „den“ Anarchismus pöbelt, um sich mit ihren eigenen Identitätsproblemen nicht auseinandersetzen zu müssen. Überhaupt ist ihre Rede von einer „anarchistischen“ Szene völliger Unsinn. Wo fängt die denn an?

Wenn sich fünf Leute in einer Gruppe treffen oder jemand ein A an deine Hauswand gemalt hat? Warum kreierst du so ein krudes Bild, Minna? Du weisst doch genau, wie das läuft: Es gibt Leute, die sich treffen, bestimmte Ansichten haben und vielleicht gelegentlich irgendwelche Sachen machen. Das ist bei euch vermeintlichen Kommunist*innen doch überhaupt nicht anders. Allerdings bin ich es Leid, deine blossen Behauptungen auf Papier zu lesen. Eine Unterscheidung von einem „harten Kern“ und einen diffusen „Dunstkreis“ in der angeblichen Szene entspringt lediglich deiner Phantasie oder den „Erkenntnissen“ des Verfassungsschutzes. Ich ziehe die Parallele nicht ohne Grund, weil die Diffamierungen in deiner diffusen Argumentation bedauerlicherweise einen harten autoritären Kern aufweisen.

Ist dies auch der Grund, warum Takver uns einen Maximalismus andichtet? Eine Mentalität des „GANZ ODER GAR NICHT“ nehme ich in meinem Umfeld eigentlich nicht wahr. Vielmehr versuchen wir uns wo es geht auf die Kritik und Praxis im Handgemenge zu konzentrieren. Es mag sein, dass einzelne Personen in ihrem Verbalradikalismus und einer vorgetragenen absoluten Haltung in der Vergangenheit über die Stränge geschlagen haben. Das macht mich selbst skeptisch, denn wer sich zu weit aus dem Fenster lehnt, begibt sich in die Gefahr, tief zu fallen.

Meiner Erfahrung nach legen sich jugendliche Allmachtsfantasien jedoch, sobald sich Personen langfristig in „konkrete Kämpfe gegen diese Verhältnisse“ einbringen. Auch hierbei handelt es sich keineswegs um ein spezifisches Problem des Anarchismus. Dass eine solche Hybris Minna Takver besonders aufstösst, ist allerdings nicht einer solidarisch-kritischen Haltung geschuldet, sondern ihrer Affirmation der Ohnmacht als zentralem Bestandteil ihrer negativen Identität.

Als wäre es nicht langsam genug, suggeriert Takver darüber hinaus jedoch, dass wir uns zukünftig mit der linken Szene entsolidarisieren könnten. Klar, aufgrund historischer und persönlicher Erfahrungen entsolidarisieren wir uns von Parteipolitik, autoritären Gruppierungen oder von Menschen, die lediglich Vorurteile und Unterstellungen für uns übrig haben. Niemals jedoch von Personen, die unter der bestehenden Herrschaftsordnung leiden und gegen sie mit emanzipatorischen Anliegen rebellieren. Wer das nicht weiss, sollte mit uns in Kontakt und Austausch treten, um sich davon zu überzeugen. Wiederum offenbart Takver hierbei ihren instrumentellen Charakter mit welcher sie ihre Diffamierungen auf Papier geschmiert hat. Mit einer manipulativen Einstellung unterstellt sie uns, was sie selbst betreibt.

101 polismur utanfor hvitfeldtska (39037040).jpg

Nach diesem Ritt muss ich auch den letzten Punkt entschieden zurückweisen: Es ist schlichtweg nicht der Fall, dass Anarchist*innen einen „kompromisslosen Hunger“ nach Widerspruchsfreiheit haben. Auch hierbei handelt es sich um eine leicht durchschaubare Projektion, wenn Takver wirklich glaubt, uns von ihrer vermeintlichen Position des Ausserhalb bewerten und beurteilen zu können. Schon wer nur ein klein wenig Ahnung von Anarchismus als sozialer Bewegung oder auch politischer Theorie hat, weiss, wie sehr diese Behauptung an den Haaren herbeigezogen ist. Takver widerspricht sich ja auch direkt selbst mit ihrer Annahme, die Widersprüchlichkeit im Anarchismus würde durch Identitätskonstruktionen gekittet werden. Ja was denn nun?

Meiner Erfahrung nach gehen Menschen sehr unterschiedlich mit den gesellschaftlichen Widersprüchen um uns herum und in uns um. Tatsächlich stellen sie uns vor ungeheurere Herausforderungen, wenn wir in-gegen-und-jenseits dieser Verhältnisse agieren wollen. Und zwar nicht um die Widersprüche der Herrschaftsordnung abzufeiern, sondern, um sie abzubauen und zu überwinden. Damit handelt es sich jedoch um etwas grundlegend anderes, als die von Anarchist*innen begrüsste Pluralität. Denn jene bringt zwangsläufig unterschiedliche Positionen hervor und macht deswegen eine – manchmal konfliktbehaftete, manchmal versöhnliche – permanente und nie abgeschlossene Suche nach den Gemeinsamkeiten erforderlich. Eben darin besteht Anarchie als produktiver Prozess auf den wir uns hier und heute einlassen können. Daher wünsche ich Minna Takver ehrlich, dass sie ihre konservative Sehnsucht danach überwindet, „dass doch noch alles für alle gut wird“. Erst der schmerzhafte Bruch mit dieser romantischen Vorstellung, könnte sie von ihren sozialdemokratischen Illusionen befreien und sie zum Mitwirken an solidarischen, egalitären, libertären Beziehungen und Organisationen motivieren.

Es tut mir Leid wenn das arrogant rüberkommt, Minna, aber wesentlich mehr noch, dass du mir dafür die Steilvorlage geliefert hast: Du hast versucht Kritik zu üben und bist daran kläglich gescheitert. Doch wir Anarchist*innen mögen Versuche. Und wir hüten uns vor einfachen Antworten. Deswegen setzen wir uns mit dir auseinander. Du brauchst nicht weiterhin billige Diffamierungen zu streuen und wie auf dem Pausenhof in der Schule oder innerhalb der sozialistischen Familie über uns zu lästern. Denn wir laden dich ein, ebenfalls in die Auseinandersetzung zu gehen und gemeinsam mit uns sozial-revolutionär zu werden. Deine „Kritik“ ist ein Armutszeugnis. Wir aber sind und bleiben dem reichen Leben auf der Spur.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————-

Grafikquellen         :

Oben     —          Jahve meets anarchy, Przedmieście Oławskie, Wrocław

Author Patryk Wojciechowski 1992
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

————————

2.) von Oben      —          109_tramsigt_klotter

————————

Unten       —     101_polismur_utanfor_hvitfeldtska

Abgelegt unter Bildung, International, Kultur, Mensch | Keine Kommentare »

Endspiel in Syrien

Erstellt von DL-Redaktion am 5. Dezember 2019

Auf Kosten der Kurden ebnen Erdoğan und Putin den Weg

Azez’den Akçakale’ye gelen ve Geçici Barınma Merkezi'ne getirilen ÖSO konvoyu.jpg

 für die endgültige Stabilisierung des Assad-Regimes

von Akram Belkaïd

Unterstützt von syrischen Milizen ist die türkische Armee am 9. Oktober in die autonome Demokratische Föderation Nordsyrien (Rojava) einmarschiert. Rojava wurde seit 2013 von der Partei der Demokratischen Union (PYD), dem syrischen Ableger der Arbeiterpartei Kurdistans (PKK),1 kontrolliert. Die „Operation Friedensquelle“, die mit heftigen Luftangriffen – auch gegen die Zivilbevölkerung – eröffnet wurde, führte schnell zur Einnahme mehrerer Grenzstädte, darunter Tall Abyad.

Damit hat Präsident Erdoğan ein lang angestrebtes Ziel erreicht: die territoriale Einheit der demokratischen Föderation von Rojava zu zerbrechen.2 Am 22. Oktober traf er sich mit Putin in Sotschi, wo beide einen 10-Punkte-Plan beschlossen, der vorsieht, dass sich die Volksverteidigungseinheiten (YPG), der bewaffnete Arm der PYD, auf eine Distanz von 30 Kilometern von der türkisch-syrischen Grenze zurückziehen und dass Ankara die Kontrolle über das Gebiet zwischen Tall Abyad und Ras al-Ain übernimmt (siehe Karte).

Während die Türkei die PKK ihrer Rückzugsmöglichkeiten berauben und ihren Einfluss über ihre Südgrenze hinaus ausdehnen will, hat Assad die Verletzung der syrischen Souveränität zwar verurteilt, nutzt aber die Chance, um die bislang von der PYD kontrollierten Gebiete zurückzugewinnen.

Russland wiederum will seine Schiedsrichterrolle absichern, was dadurch erleichtert wird, dass Präsident Trump die USA erklärtermaßen aus dem „syrischen Sumpf“ zurückziehen will. Am 6. Oktober kündigte Trump in einem Telefonat mit Erdoğan den Abzug der US-Soldaten an. Drei Tage später marschierte die Türkei in Syrien ein.

Durch die Invasion sahen sich die kurdischen Verbände gezwungen, die syrische Armee um Hilfe zu bitten. Die YPG und ihre arabischen Verbündeten zogen sich aus mehreren Orten zurück (auch aus der Stadt Kobani, aus der die YPF im Januar 2015 den IS vertrieben hatte), um Assads Truppen Platz zu machen. Der Angriff löste im Westen zwar eine Welle der Empörung aus, weil mit den Kurden die treuesten Verbündeten der USA im Kampf gegen den IS fallen gelassen wurden.

Aber das war es dann auch. Washingtons europäische Verbündete hakten den Rückzug der USA ab, und Frankreich brachte seine in der Region stationierten Soldaten in Sicherheit. Trump leugnete unterdessen, dass er grünes Licht für den türkischen Angriff gegeben habe, und verstärkte die Verwirrung durch widersprüchliche Botschaften. Erst drohte er Erdoğan mit Vergeltungsmaßnahmen, dann kündigte er verschiedene Sanktionen an, die aber nie in Kraft traten.3 Am 17. Oktober handelte US-Vizepräsident Mike Pence schließlich eine Waffenruhe zwischen der türkischen Armee und den kurdischen Streitkräften aus, die der Er­do­ğan-Putin-Plan fünf Tage später bestätigte – unter der Bedingung, dass sich die kurdischen Kämpfer von der Grenze zurückziehen.

Seit 2015 agitiert Ankara gegen die kurdische Autonomie in Nordsyrien, die durch das Militärbündnis zwischen den syrischen Kurden und dem Westen am Leben erhalten wurde. Doch aus Sicht der Türkei, die vorgibt, den Terrorismus zu bekämpfen, konnte ein syrisches Kurdengebiet als Rückzugsbasis für die Aktivisten der in den USA und der EU verbotenen PKK dienen. Oder sogar zur Basis eines künftigen Kurdistans als Vereinigung von türkischen und syrischen Kurden werden.

Ein weiteres unausgesprochenes Motiv: Ankara will nicht, dass das demokratische Projekt einer Konföderation Rojava das internationale Image der PYD und der PKK verbessert, die sich nach ihrer Verabschiedung vom Marxismus-Leninismus seit 2005 zum „demokratischen Konföderalismus“ des Ökoanarchisten Murray Bookchin (1921–2006) bekennt.4

Am 24. September kündigte Er­do­ğan vor der UN-Generalversammlung in New York an, er wolle im syrischen Norden eine 400 Kilometer lange und 30 Kilometer breite Pufferzone schaffen. Die Idee ist nicht neu. Schon im Oktober 1998 hatten die Türkei und Syrien nach drei Jahren diplomatischer Spannungen und einigen militärischen Scharmützeln das sogenannte Adana-Abkommen unterzeichnet. Erdoğan und Putin haben dieses Abkommen, das die Schließung der PKK-Ausbildungslager im Norden Syriens und das Recht der Türken auf Intervention in einem sechs Kilometer breiten Grenzgebiet vorsah, mit der Vereinbarung von Sotschi eigentlich nur reaktiviert.

Washington und Ankara hatten sich bereits am 7. August auf die Einrichtung einer „Sicherheitszone“ in Rojava verständigt, wenn auch nur vage. Dennoch hätte die kurdische Autonomieverwaltung schon damals alarmiert sein müssen. Aber die PYD-Führung war überzeugt, dass es zu dieser Sicherheitszone und zum Abzug der US-Truppen aus Syrien nicht kommen werde.

Rojava als Beute für Erdoğans Business-Freunde

Barış Pınarı harekâtı sonrası Kamışlı'da yaralandıktan sonra bir ayağı kesilen diğer ayağı da kırılan 8 yaşındaki Sarah.jpg

Die Türkei versucht bereits seit drei Jahren, Rojava mit gezielten Angriffen zu destabilisieren. Mit der „Operation Euphrat-Schild“, die sich vor allem gegen die YPG, aber auch gegen den IS richtete, errang die türkische Armee im Sommer 2016 die Kontrolle über die Stadt Dscharabulus. Im Januar 2018 eroberte sie nach Abschluss der „Operation Olivenzweig“ mit Afrin einen der drei Rojava-Kantone.

Quelle :          Le Monde diplomatique         >>>>>           weiterlesen 

———————————————————————-

Grafikquellen        :

Oben        —         Azez’den Akçakale’ye gelen ve Geçici Barınma Merkezi’ne getirilen ÖSO konvoyu.

Abgelegt unter Asien, Kriegspolitik, Kriminelles, Mensch | Keine Kommentare »

„Jetzt reden wir – 2.0“

Erstellt von DL-Redaktion am 5. Dezember 2019

Erster flüchtlingspolitischer Kongress war erfolgreich!

File:Alassa Mfouapon mit Adelheid Gruber.jpg

Alassa Mfouapon mit Adelheid-Gruber.

Quelle    :     Scharf  —  Links

Von Adelheid Gruber

180 Teilnehmer aus 20 Nationen folgten am vergangenen Samstag der Einladung von Alassa Mfouapon, seinem Rechtsanwalt Roland Meister und dem Freundeskreis Alassa & Friends zu einem Flüchtlingspolitischen Kongress, der wohl der erste seiner Art war.

Alassa Mfouapon war bundesweit bekannt geworden als Sprecher der Flüchtlinge in Ellwangen, die sich 2018 gegen Abschiebung und Kriminalisierung wehrten. „Das Vorhaben, den engen Schulterschluss zwischen der Selbstorganisation der Flüchtlinge mit anderen demokratischen, humanistischen bis hin zu revolutionären Kräften zu organisieren ging auf und begeisterte die Teilnehmer, die von München bis Hamburg angereist waren und für eine große Bandbreite von gesellschaftlichen Gruppen, Initiativen und Organisationen standen.

Einzigartig, wie hier die Erfahrungen der Flüchtlinge über Fluchtbedingungen, Ankommen in Deutschland und dem Leben hier, wie ihre kompetenten Kenntnisse über die Fluchtursachen, ihr konkreter Kampf gegen Diskriminierung, gegen die Angst vor Abschiebung, die tagtägliche Erfahrung, als Menschen zweiter und dritter Klasse behandelt zu werden, zusammen kamen mit Berichten flüchtlingssolidarischer Menschen, die selbst auch die Erfahrung von Kriminalisierung und Diffamierung machen und nach Auswegen und Lösungen suchen“, so Adelheid Gruber, eine der Sprecher*innen des Freundeskreises.

Vier Impulsreferate zu den Themen „Über die Flüchtlingspolitik der EU und der BRD“, „Weltweite Fluchtursachen und Gegenstrategien“, „Die Lage der Geflüchteten und Proteste dagegen“ und „Handlungsperspektiven“ boten viel Stoff zu Diskussion und Erfahrungsaustausch. Das Referat eines Aktivisten aus Togo über Fluchtgründe und Diskussionsbeiträge über Kamerun und seine Geschichte wiesen nach: Europa und die westliche Welt haben mit ihrer Sklaverei- und Kolonialherrenvergangenheit Afrika um Jahrhunderte zurückgeworfen und entscheidend zur heutigen dramatischen Lage der Jugend in afrikanischen Ländern beigetragen. „Die Unterdrücker haben nur die Hautfarbe gewechselt“ so der Referent aus Togo, denn den Reichtum Afrikas beuten heute internationale Monopolkonzerne aus – mit Wissen und Zustimmung korrupter afrikanischer Regierungen.

Widerstand dagegen wird nicht zuletzt mit militärischer Hilfe aus Europa unterdrückt. „Die massive Rechtsentwicklung der Regierung, die die EU abschottet vor den Menschen, die vor den Folgen der neokolonialen und imperialistischen Politik fliehen, fordert uns heraus: wir wollen keine einzige Diskriminierung, keinen behördlichen Rassismus, keine ungerechte Abschiebung unwidersprochen lassen! Wir stehen ein für ein Recht auf Flucht! Mit einer gemeinsam beschlossenen Erklärung bringen wir zum Ausdruck: Die Angst, die nach der unerhörten Kriminalisierung der Ellwanger Flüchtlinge wirkte, kann durch den engen Schulterschluss und wachsende Zusammenarbeit der Flüchtlings- Bleiberechts-, antirassistischen, demokratischen und revolutionären Bewegung überwunden werden“ so Adelheid Gruber über das Ergebnis des Kongresses. „Jetzt reden wir! hat mit diesem Kongress eine neue Etappe 2.0 eröffnet. Die Ellwanger Schule wird weiter Schule machen.“

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————

Grafikquelle       :          Alassa_Mfouapon_mit_Adelheid_Gruber.jpg

Alle unsere eigenen Veröffentlichungen, Werke, Fotos, Grafiken unterliegen keinem Copyright und können frei unter Nennung der Quelle verwendet werden.

Quelle    :       Arbeit  –  Zukunft-online

Abgelegt unter Baden-Württemberg, Flucht und Zuwanderung, Kultur, Mensch | Keine Kommentare »

US-Botschafter in Berlin

Erstellt von DL-Redaktion am 4. Dezember 2019

So kuscht die Bundesregierung vor den USA

 

Sind es nicht alle die gleichen Schlaumeier aus der Politik welche sich die viel zu großen Bälle gegenseitig um die Ohren werfen ?

Quelle        :        INFOsperber CH.

Von Gabor Steingart

Richard Grenell, US-Botschafter in Deutschland, vertritt nicht nur die Interessen der US-Regierung, sondern setzt sie auch durch.

Red. Gabor Steingart war Wirtschaftsjournalist in Berlin und Miteigentümer der deutschen Handelsblatt-Gruppe. Heute gibt er den Newsletter «Morning Briefing» heraus, dem wir folgenden Beitrag entnehmen.

Deutschland wird von US-Präsident Donald Trump bevorzugt behandelt. Andere Länder bekommen von ihm einen normalen Botschafter, nach Berlin schickte er eine originalgetreue Kopie. Der ehemalige «Fox News»-Kommentator Richard Grenell ist konservativ wie Trump, nur bekennend homosexuell und jünger. Ansonsten stammen beide aus der gleichen Fertigungshalle, vor allem der Kopf ist baugleich.

Grenell ist ein «America First»-Kämpfer aus Edelstahl, er schiesst scharf und hasst Übungsmunition. Er beherrscht wie das Original die Methode kalt/warm, das heisst, binnen Sekunden kann er von Charmeur auf Pitbull umschalten.

So wie andere ihre Freundschaften pflegen, pflegt Grenell seine Feindschaften – mit dem «Spiegel», mit SPD-Aussenminister Heiko Mass und mit Kanzlerin Angela Merkel. Mit den Worten «You gonna love this guy» hatte Trump ihr Grenell vorgestellt. Humorbegabte Kanzlerberater geben zu: Das war nicht übertrieben.

Grenell quält und piesackt die Regierung, wie zuletzt Wirtschaftsminister Peter Altmaier. Der CDU-Mann hatte bei «Anne Will» eine Beteiligung von Huawei am Ausbau des 5G-Mobilfunks nicht rundweg abgelehnt und dann auch noch das demokratische Amerika mit dem diktatorischen China verglichen. Altmaier unplugged:

Auch die USA verlangen von ihren Firmen, dass sie bestimmte Informationen, die zur Terrorismusbekämpfung nötig sind, dann mitteilen.

Grenell traute seinen Ohren nicht. Unverzüglich ging er zum Gegenangriff über. In einer von der US-Botschaft verbreiteten Botschaft heisst es:

Die jüngsten Äusserungen hochrangiger Vertreter der deutschen Regierung, die Vereinigten Staaten seien vergleichbar mit der Kommunistischen Partei Chinas, sind eine Beleidigung für die Tausenden amerikanischen Soldatinnen und Soldaten, die dazu beitragen, die Sicherheit Deutschlands zu gewährleisten

Grenell ist für Trump Bauchredner, Bodyguard und Scharfschütze in einem. Im Unterschied zu US-Botschaftern wie John Kornblum, der mehrere deutsche Regierungen beschmuste und sich bis heute als das «andere Amerika» vermarktet, kommuniziert Grenell nicht nur die Interessen der US-Regierung, er setzt sie auch durch.

Seine Erfolgsbilanz kann sich sehen lassen:

► Auf dem Nato-Gipfel in Wales im Jahr 2014 stellte der damalige Aussenminister Frank-Walter Steinmeier Militärausgaben von zwei Prozent des Bruttoinlandsprodukts in Aussicht. Doch Deutschland liegt noch immer erst bei rund 1,4 Prozent – was Grenell empört: «Wir fordern Deutschland auf, sein Zwei-Prozent-Versprechen zu erfüllen», mahnte er auf dem Deutschlandtag der Jungen Union im vergangenen Jahr. Immerhin: Die Verteidigungsministerin fühlt sich dem verpflichtet. Zwar wird sie das Ziel bis 2024 nicht erreichen können, da es Mehrausgaben von rund 17 Milliarden Euro gegenüber dem Ist-Zustand 2019 bedeutet. Bis 2031 aber will sie das Versprechen einlösen. So ist es im Haushalt nun geplant.

► Der chinesische Netzwerkausrüster Huawei ist den USA ein Dorn im Auge. Im März 2019 schrieb Grenell einen Brief an Minister Altmaier, in dem er mit einem Boykott sicherheitsrelevanter Informationen von CIA, NSA und FBI drohte, sollte Huawei am Aufbau des deutschen 5G-Netzes beteiligt werden. Die Folgen: Huawei ist in den Mittelpunkt der öffentlichen Debatte gerückt. Auch der CDU-Parteitag in Leipzig befasste sich mit dem Thema. Grenell konnte neben AKK auch den führenden CDU-Aussenpolitiker Norbert Röttgen für die US-Position gewinnen.

► Seit Jahren fordern die USA eine stärkere Führungsrolle Deutschlands in der Weltpolitik. AKK, die gerade US-Aussenminister Mike Pompeo traf, hat mit dem Vorstoss für eine von deutschen Soldaten bewachte «Schutzzone» in Syrien erstmals einen gedanklichen Ausflug in diese Richtung unternommen. Grenell teilte ihr seine Hochachtung mit.

► Auch in Sachen Nord Stream 2 meldete sich der Trump-Vertreter zu Wort: Im Mai dieses Jahres drohte er an der umstrittenen Ostsee-Pipeline beteiligten deutschen Unternehmen mit einem «erhöhten Sanktionsrisiko». Ein Hintergrund des Streits: Die USA wollen keinen Einfluss von Putin auf die Energieversorgung der Deutschen. Der zweite Hintergrund: Amerika will sein teures Flüssiggas nach Übersee verkaufen. Mittlerweile hat die Bundesregierung zugesagt, den Bau von Hafen-Terminals für das US-Gas zu fördern.

► Auch in der Handelspolitik macht Grenell Druck. Bisher verlangen die USA für europäische Importautos 2,5 Prozent Einfuhrzoll, die EU erhebt zehn Prozent. Der US-Statthalter in Berlin thematisiert diese Ungleichheit in fast jedem Gespräch mit deutschen Konzernchefs – mit Erfolg. Ein kleinlauter Altmaier bietet mittlerweile eine Absenkung der EU-Industriezölle auf null an. Auch die Autozölle könnten sinken.

► Der Streit über die iranische Fluggesellschaft Mahan Air endete ebenfalls mit einem Punktesieg für die Amerikaner: Die iranische Regierung wird der Terrorunterstützung verdächtigt. Grenell fragte die Bundesregierung schon im September 2018 via Twitter, warum die Fluglinie noch in Düsseldorf und München landen dürfe. Im Januar 2019 entzog die Bundesregierung der Airline die Landeerlaubnis.

Die deutsche Regierung kann Grenell getrost weiter verfluchen. Mit gleichem Recht kann sie ihn aber auch für Raffinesse und Durchsetzungskraft bewundern. Man wünschte sich, der deutsche Aussenminister wäre mit der Durchsetzung deutscher Interessen im Ausland nur halb so effektiv.

Die Deutschen schauen derweil skeptisch auf die trans-atlantischen Beziehungen. Eine repräsentative Studie der Körber-Stiftung zeigt: Nur noch eine knappe Mehrheit von 55 Prozent der Befragten befürworten Deutschlands Zugehörigkeit zur westlichen Wertegemeinschaft. 31 Prozent bevorzugen eine aussenpolitisch neutrale Haltung ihres Landes – sieben Prozent wünschen sich sogar eine Annäherung an andere Länder oder Wertegemeinschaften. Diese sieben Prozent möchte man besser nicht näher kennenlernen.

Die Amerikaner wiederum, das ergab diese Studie ebenfalls, schauen auf denselben Sachverhalt – aber mit anderen Gefühlen. 75 Prozent der befragten Amerikaner empfinden die Beziehungen zu den Deutschen als «gut» oder «sehr gut», derweil fast zwei von drei Deutschen (64 Prozent) der Ansicht sind, das Verhältnis zu den Amerikanern sei «schlecht» oder «sehr schlecht».

Fazit: Die Beziehung der Deutschen zu den Amerikanern ist nicht beendet, nur gestört. Ferdinand Piëch würde sagen: Wir leben auf Distanz zueinander. Verantwortungsvolle Politik sollte diesen Zustand der Entfremdung nicht beklagen, sondern verändern.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Keine

—————————–

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

——————————————————————

Grafikquelle        :         Richard Grenell (2018)

Abgelegt unter Amerika, Kriegspolitik, Mensch, Regierung | Keine Kommentare »

Die Offenheit der Sprache

Erstellt von DL-Redaktion am 3. Dezember 2019

Eine Chance, kein Arschloch zu sein

File:Berkhof J.jpg

Non Mareice Kaiser

In der aktuellen Diskussion um Meinungsfreiheit heißt es häufig, unsere Debattenkultur sei elitär. Doch bei diskriminierungsfreier Sprache geht es nicht um Bildung, sondern um die Offenheit, anderen wirklich zuzuhören.

Wie laut es in einem Schweinestall ist, wusste ich schon als Kind. Welche Welt Bücher eröffnen können, erst sehr viel später. Wo ich aufgewachsen bin, gibt es mehr Schweine als Bücher und mehr Kühe als Menschen. Dass ich aufs Gymnasium gehen wollte, wurde als „Extrawurst“ bezeichnet, das Thema „Studium“ war ein rotes Tuch. Das Geld, das mein hart arbeitender Vater verdiente, reichte immer gerade so und eben nicht für Extrawürste oder rote Tücher. Als „bildungsfern“ würden einige das Umfeld, in dem ich aufwuchs, bezeichnen. Ich bin ein Arbeiterkind, sage ich heute. Den Begriff musste ich auch erst einmal lernen.

In unserer Straße wohnte auch meine Freundin Anika. Zuerst lebte sie dort mit ihrer Mutter und ihrem Vater. Irgendwann mit zwei Müttern, denn die Frau, die ich als ihren Vater kennengelernt hatte, war eigentlich ihre Mutter. Das erzählte sie uns – also dem ganzen Dorf – bei einem Dorffest. Ich weiß noch, dass meine Eltern mir erklärten, dass Anikas Vater sich dazu entschieden habe, als Frau zu leben und jetzt Anikas Mutter sei und einen anderen Namen habe.

Zu Anika habe ich heute keinen Kontakt mehr, deshalb kann ich sie oder ihre Mütter nicht fragen, wie das damals für sie war. Ich weiß nicht, wie es sich angefühlt hat, die Transition in unserem kleinen Dorf zu verbringen. Was ich aber weiß: Die Leute aus unserem Dorf hielten sich an die Bitte, Anikas zweite Mutter bei ihrem neuen Namen anzusprechen. Und zwar alle.

Die Frage, wie man heute sprechen soll, stellen sich aktuell viele Menschen. „Wie war nochmal das korrekte Wort?“, steht über einem Artikel der Zeit zum Thema Meinungsfreiheit. Die These: Unsere Debattenkultur sei elitär und schließe Menschen aus bildungsfernen Milieus aus. Das sehe ich anders.

Das Gefühl der Ausgeschlossenheit resultiert aus einem Unwohlsein. Menschen, die viele Jahre ihres Lebens sprachen, wie ihnen der Schnabel gewachsen war, bekommen heute Widerspruch zu hören, werden gar kritisiert. Das fühlt sich dann an, als könne man nicht mehr alles sagen. Dabei kann man einfach nur nicht mehr jeden Scheiß sagen, ohne mit einem Echo rechnen zu müssen.

„Die Klage von angeblichen Meinungsverboten kommt auffallend oft von Leuten, die es gewohnt waren, unwidersprochen zu bleiben. Wenn man nachhakt, stellt sich meist raus, dass Kritik und Widerspruch mit Meinungsverbot gleichgesetzt wird“, twitterte die Soziologin Franziska Schutzbach. Laut unserem Grundgesetz können wir alles sagen, was nicht die Würde eines anderen Menschen verletzt. Und das ist der Punkt: Man sollte nicht alles sagen, wenn man kein Arschloch sein will.

Wenn man das nicht sein will, ist es eigentlich gar nicht so schwer: Es braucht keinen besonderen Bildungsabschluss, kein Hochschulstudium und keinen Doktortitel, es braucht einfach nur eine Frage: „Wie ist es gut für dich?“ Und dann die Offenheit, die Antwort wirklich hören zu wollen und sich dementsprechend zu verhalten.

Das ist die Grundlage dafür, diskriminierungsfreie Sprache zu nutzen. Übrigens: Arschloch ist zwar eine Beleidigung, dabei aber nicht diskriminierend. Diskriminierende Sprache erkennt man daran, dass sie eine bestimmte Gruppe mit negativen Eigenschaften belegt. Meist sind das Gruppen, die eh schon von Benachteiligungen betroffen sind. Eine benachteiligte Gruppe von Arschlöchern gibt es meines Wissens nach nicht. Schade eigentlich.

Ich war vielleicht zehn Jahre alt und mir wäre überhaupt nicht in den Sinn gekommen, Anikas zweite Mutter nicht als solche anzusprechen. Klar, am Anfang war das ungewohnt, ich stolperte noch manchmal über den alten Namen oder sagte, wenn ich mit Anika sprach,„dein Papa“ statt „deine Mama“. Aber dann entschuldigte ich mich dafür. Nach kurzer Zeit hatte ich mich daran gewöhnt. Meine Sprache hatte sich angepasst. Genau wie es unsere Sprache macht, wenn wir versuchen, diskriminierungsfreier zu sprechen.

Immer mehr Stimmen werden in den Medien und der Politik sicht- und hörbar, die lange Zeit nicht gesehen und gehört wurden. Diesen Stimmen haben wir es zu verdanken, dass wir immer mehr und immer weiter nachdenken können, wie wir sprechen wollen. Menschen, die von Rassismus betroffen sind, Menschen, die von Behindertenfeindlichkeit betroffen sind, Menschen, die von Sexismus betroffen sind. Sie sagen: So wollen wir nicht bezeichnet werden, das tut uns weh. Oder auch: Wir kommen in den Wörtern nicht vor, wir brauchen neue.

Die sich daraus ergebene neue Vielfalt der Sprache ist für uns alle eine große Chance. Wir können mit der Entwicklung unserer Sprache mit mehr Menschen kommunizieren als bisher. Unsere Welt wird größer und auch die der anderen. Wir schließen nicht mehr aus, sondern schließen Menschen ein. Wir haben die Möglichkeit, Menschen sicht- und hörbar zu machen. Dadurch, dass wir Worte verwenden – und auf andere verzichten.

Quelle          :            TAZ            >>>>>          weiterlesen

———————————————————————–

Grafikquellen        :

Oben       —            Idyllischer Ortskern von Berkhof

Author Jürgen Friede       —         Source   :  Own work
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

———————-

Unten       ––     Urheber Sampix

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Bildung, Kultur, Mensch, Positionen | Keine Kommentare »

Richternd

Erstellt von DL-Redaktion am 3. Dezember 2019

Schöffe am Amtsgericht in Euskirchen

File:1031616 Amtsgericht Euskirchen.jpg

Quelle       :         untergrund-blättle     CH.

Von   Richard Albrecht

Im letzten Jahrzehnt war ich vor einigen Jahren einige Jahre lang ehrenamtlicher Richter. Genauer: (Hilfs-) Schöffe an einem Amtsgericht in der Rheineifel.

Euskirchen, historisch Oiskirchn, ist das Tor der Eifel. Aber nicht alle Euskirchner sind Eifler Toren. Es hat auch dort einige Autoren.

Das dortige Amtsgericht ist baulich neu und liegt zentral für alle, die mit dem Zug oder dem Auto anreisen. In den Kleinen Saal wurde in Handschellen reingebracht ein Angeklagter, den ich gut ein Jahrzehnt vor der Verhandlung einmal beobachtete wie er am Bach Frösche fing und mit dem ich über die Jahre auch zwei, drei Sätze irgendwas sprach.

Was er getan haben sollte Jahre bevor er als Angeklagter befragt wurde fiel unters Jugendstrafrecht.

Merkwürdig war, dass Monate vergingen bevor er nach erster polizeilicher Auffälligkeit vor seinen ersten Richter kam. Ich fragte nach. Der Berufsrichter am Amtsgericht war lange Jahre lang Direktor des nahegelegenen Hauses, in dem ich später 15 Tage als Busse für die angebliche „Beleidigung“ eines Rechtsadvokaten abbüssen sollte. Er liess als Vorsitzender pausieren und erklärte im Beratungsraum wortreich, warum´s so war damit das wirken konnte, was Pädagogik genannt wird.

Ob der – nun – junge Mann, den ich – wieder´n paar Jahre später – noch einmal zwischen Regalen in einem Supermarkt sah und den ich an seinen so hellen wie wachen Augen wiedererkannte, nun schlussendlich wegen seines ersten Altdelikts verurteilt wurde oder auch nicht, kann ich nicht wissen.

Die Verhandlung, an der ich laienrichterlich teilnahm, musste aus formalen Gründen vertagt werden.

Die letzte Gerichtsverhandlung, an der ich, ehrenamtlich überhöht sitzend, teilnahm, war geheim: „aus Gründen“ des Jugendschutzes wurde was „die Öffentlichkeit“ heisst ausgeschlossen.

Der alte Mann war das erste Mal in seinem Leben öffentlich angeklagt. Er fühlte sich unschuldig und schämte sich nicht. Sondern hatte Angst vor seiner Frau. Denn er sollte, so staatsanwaltschaftliche Ermittlungen, von hinten eine Minderjährige begrapscht haben.

Diese erschien gross und prall. Die Gutachterin wissend und eifernd.

Der Mann war nicht nur ein alter, sondern auch ein kleiner Mann. Würde er wie allseits beredt behauptet die Titten nicht nur von hinten, sondern auch von oben begrabscht haben, hätte er auf einer kleinen Leiter oder auf einigen Telefonbüchern der Kreise Bergheim-Düren-Euskirchen stehen müssen.

Als ich dies, ehrenamtlich-richternd und gutachterlich-kritisch, anmerkte – herrschte sekundenlang so kundiges wie beredtes Schweigen.

Was den Vorsitzenden trotz Advokatenprotest nicht hinderte, wie Basta durchzuziehen. Und den kleinen alten Mann, der seine Unschuld beteuerte und den die Angst vor seiner Frau schwitzen machte, zu einer milden Geldstrafe zu verurteilen.

Die Verhandlung wurde weder zur Beratung unterbrochen noch später ausgesetzt.

Diesen Berufsrichter sah ich erst Monate später in anderem Zusammenhang im selben Amtsgericht während meines eigenen, von ihm beförderten, Prozesses wegen angeblicher „Beleidigung“ eines Bonner Rechtsadvokaten ebendort wieder – in der Gerichtskantine, nachdem der gegen mich als Angeklagten veranlasste Prozess wegen Besorgnis berufsrichterlicher Befangenheit vertagt wurde.

Seitdem ward er von mir nimmer gesehen.

Und das war und das ist auch nur gut so.

Diese Kurzerzählung erschien zuerst im Sammelband des Autors HELDENTOD. Kurze Texte aus Langen Jahren (Aachen: Shaker Media, 2011).

—————————————————————-

Grafikquelle          :         Amtsgericht Euskirchen, Sept. 2007

Author Wikoli       —        Source  :  Own work

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Justiz-Kommentare, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »

Bitte nicht klatschen

Erstellt von DL-Redaktion am 3. Dezember 2019

          Sobald Männer ein Baby füttern, gelten sie als feministische Ikonen

Helden:  Von Nicole Schöndorfer

Vor einiger Zeit gingen Bilder des neuseeländischen Parlamentspräsidenten Trevor Mallard viral, die ihn dabei zeigten, wie er sich liebevoll um das Baby eines Abgeordneten kümmerte. Mallard fütterte das Baby, während der Abgeordnete eine Rede hielt. Von CNN bis India Today berichteten alle, in den sozialen Medien überschlug man sich vor Lob, manche witterten den Untergang des Patriarchats. Spiegel Online twitterte ein Video mit Herzchenaugen-Emoji.

Ein Mann, der ein Kleinkind fürsorglich in den Arm nimmt, anstatt es irgendwo liegen zu lassen, ist nichts, worüber sich Feminist*innen beschweren würden. Es sollte mittlerweile aber auch nichts mehr sein, was von der Gesellschaft als feministischer Fortschritt verklärt wird. Dass es nach wie vor so ist, sagt viel über ihren Zustand aus. Abgesehen davon, dass es immer wieder Fälle gibt, in denen Mütter mit ihren Babys aus Parlamenten (so etwa die Thüringer Politikerin Madeleine Henfling im Sommer letzten Jahres und die dänische Abgeordnete Mette Abildgaard im März dieses Jahres) und anderen öffentlichen Räumen (man denke an die Reaktionen auf stillende Mütter) ausgeschlossen werden, ist es typisch, dass „weiblich“ konnotierte Aufgaben, wie Kindererziehung, für fast beängstigend überschwängliche Begeisterung sorgen, wenn Männer sie ausführen.

Erde an Mommy, echt jetzt?

Wenn es heißt, dass Feminist*innen für eine erfolgreiche feministische Bewegung auch die Männer „ins Boot holen“ müssen, ist das immer eine Form von Täter-Opfer-Umkehr. Es bedeutet nämlich im Wesentlichen, dass Feminismus auch die ohnehin privilegierte Lebensrealität der Unterdrücker verbessern soll, damit diese für die Unterdrückten schlussendlich nicht mehr so bedrohlich sind und sie mehr oder weniger diskriminierungsfrei leben können. Was soll das für ein Deal sein?

Ja, auch Männer können in gewisser Weise unter den Erwartungen und Zwängen des Patriarchats leiden. Aber wenn es notwendig ist, das immer wieder zu betonen, um sie vom Sinn einer feministischen Gesellschaft zu überzeugen, macht das ihr antipatriarchalisches Engagement schnell unglaubwürdig. Sobald solche Engagements an Bedingungen geknüpft wird, die sie als gesellschaftlich dominante Gruppe selbst formulieren, ist es wertlos. Wenn es erst heikel wird, wenn noch die Unterdrücker vom vorherrschenden System nicht mehr nur profitieren, ist der vermeintlich feministische Einsatz nicht auf Gleichstellung, sondern auf Aufrechterhaltung der Verhältnisse unter einem fortschrittlicheren Label ausgelegt.

File:Male Couple With Child-01.jpg

Gleich vorweg: Feministische Männer können selbstverständlich glaubwürdige Verbündete in feministischen Anliegen sein, doch eine gewisse Skepsis ihnen gegenüber ist allein aufgrund des strukturellen Machtungleichgewichts zwischen den Geschlechtern angebracht. Das zeigt sich auch an der Bewertung nicht systemkonformen Verhaltens von Männern. Man denke an die Geschichte der deutschen Astronautin Insa Thiele-Eich, deren Ehemann sich um die gemeinsamen Kinder sorgt, um ihr ihre Reise ins Weltall zu ermöglichen, und dafür einen mit 5.000 Euro dotierten Preis als „Spitzenvater des Jahres“ bekam. Das klingt wie ein Witz aus einem pseudo-progressiven Comedy-Programm, ist aber leider so passiert. Nun sind nicht Ehemann Thiele-Eich und Parlamentspräsident Mallard, die sich vielleicht wirklich aus einer feministischen Selbstverständlichkeit heraus und nicht für ein bisschen Internet-Ruhm engagieren, das Problem. Es ist die Gesellschaft, die klatscht, wenn ein Mann das Mindeste tut. Das heißt nicht, dass man sich nicht freuen darf über solche Bilder, man sollte sich nur fragen, ob man parallel auch einer Frau, die ihr Baby füttert, so zujubelt.

Quelle           :       Der Freitag       >>>>>          weiterlesen

—————————————————————-

Grafikquellen        :

Oben        —         General Volker Wieker (2015)

—————————-

Unten      —        Gay Couple with Child

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on February 28, 2008 by the administrator or reviewer File Upload Bot (Magnus Manske), who confirmed that it was available on Flickr under the stated license on that date.
Author Kurt Löwenstein Educational Center International Team from Germany
This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Abgelegt unter Feuilleton, Kultur, Mensch | Keine Kommentare »

Was kostet die Welt?

Erstellt von DL-Redaktion am 2. Dezember 2019

Klimapolitik – noch schlechter als ihr Ruf

File:FridaysForFuture Demonstration in Berlin, Berlin, 29.11.2019 (49147056171).jpg

Quelle        :    untergrund-blättle CH.

Von Kritik im Handgemenge

Viele Menschen auf der ganzen Welt machen sich Sorgen über die Erderwärmung.

Zu Recht: Die Wissenschaft gibt immer dramatischere Prognosen über die immensen Schäden des Klimawandels ab. Die Auswirkungen sind aber längst bemerkbar. Dafür tut sich erstaunlich wenig in Sachen Schadstoffreduktion: Kaum ein Staat senkt den Ausstoss tatsächlich. Und was auf nationaler und internationaler Bühne angekündigt wird, bleibt weit hinter dem Pariser Klimaabkommen zurück.

Der weltweite Protest von Fridays For Future fordert von der Politik ein, das einzuhalten, was sie sich vorgenommen hat. Dafür kriegt er viel Lob und Unterstützung. Komischerweise auch von denen, die der Protest kritisiert. Die Lage ist ernst. Da wäre es klug, sich damit auseinander zu setzen, an wen man da appelliert. 30 Jahre Klimapolitik – deren Ergebnisse und Gründe – geben Aufschluss darüber, dass der Staat kein guter Ansprechpartner ist, wenn es darum geht, den Planeten zu retten.

Mensch und Natur – wofür sind sie gut?

Mittlerweile hat es sich bei Vielen rumgesprochen: Wenn die Erderwärmung gebremst werden soll, müsste sich ziemlich viel ändern. Der Ausgangspunkt aller Klimapolitik waren und sind – trotz aller moralischer Appelle in Sachen Urlaubs-Flugreisen und Avocados – die kapitalistischen Unternehmen. Von denen hängt das gesamte Leben (Lohn, Steuern, Staatsschulden, Qualität einer Währung) einer bürgerlichen Volkswirtschaft ab. Daran will keine verantwortungsbewusste Regierung von links bis rechts etwas ändern.

Dass „die Wirtschaft“ florieren muss, da sind sich alle einig. Und das geht so: Unternehmen wollen mit dem, was sie herstellen, mehr einnehmen, als sie dafür ausgegeben haben. Dafür wird Einkauf, Produktion und Verkauf darauf getrimmt, den Gewinn zu steigern. Lohnarbeiter*innen bekommen das zu spüren, wenn sie für weniger, gleichen und manchmal auch mehr Lohn immer mehr zu leisten haben. Genauso gehen Unternehmen auch mit der Natur um: Herausholen, was geht, so günstig wie möglich. Energie- und Rohstoffgewinnung und Abfallentsorgung sind nur Kostenpunkte. Vergiftung der Böden, Flüsse und auch der Atmosphäre kostet die Unternehmen erstmal nichts.

Recycling wird dann gemacht, wenn es sich lohnt, z. B. wenn die Rohstoffe teuer sind – aber wenn nicht, dann nicht. Energie einsparen für den gleichen Output wird dann gemacht, wenn es sich lohnt – wenn nicht, dann nicht. Damit die Geldvermehrung immer umfangreicher vollzogen werden kann, muss die Produktion immer weiter wachsen und damit letztlich auch der Energieverbrauch. Das alles liegt nicht daran, dass Unternehmer*innen oder Manager*innen zu doof oder zu gierig sind, sondern daran, wie die Wirtschaft hierzulande organisiert ist und was ihr Zweck ist: Private Gewinnvermehrung mittels Produktion für den zahlungsfähigen Bedarf.

Die Wirtschaft – wofür ist die gut?

Auch die Politik ist nicht blind, konfliktscheu oder korrupt, wenn sie genau dieses Wirtschaftswachstum auf Kosten von Mensch und Natur fördert. Die Staaten (und Regierungen) der Welt setzen auf die kapitalistische Produktion als eine historisch unvergleichbare Machtquelle. Nie zuvor hat eine Produktion einer Herrschaft so viel Reichtum zugespielt, um ihre Zwecke zu verwirklichen (z.B. Beamte bezahlen, Infrastruktur organisieren). Von A wie Arbeitsagentur bis Z wie Zulassungsstelle benutzt der Staat das Steuergeld, um die Gesellschaft am Laufen zu halten. Damit das gut und immer besser funktioniert, kümmern sich Staaten darum, dass für die Unternehmen genug Energie zuverlässig und billig vorhanden ist. Und dass ihren Unternehmen die ganze Welt als Markt offen steht. Man denke nur an Deutschland mit seiner Autoindustrie, die ihre Karren weltweit absetzt.

Damit andere Staaten, die das gleiche Interesse für ihre Wirtschaft haben, da nicht zwischenfunken, versucht jeder Staat, sich andere Staaten unterzuordnen: In Handels-verträgen versuchen sie der eigenen Wirtschaft möglichst viele Vorteile zu verschaffen. Der Staat macht sich zum Mittel der kapitalistischen Wirtschaft, weil er dadurch stark (die Grünen würden sagen „handlungsfähig“) wird. Der Erfolg der heimischen Wirtschaft ist dabei wiederum das Mittel der Staaten, um sich gegen andere Staaten durchzusetzen. In dieser Konkurrenz um Über- und Unterordnung, die für den Erfolg der eigenen Unter-nehmen geführt wird, ist der Erfolg der eigenen Wirtschaft das entscheidende Machtmittel. Nicht umsonst ist Deutschland als die Wirtschaftsmacht in Europa auch die Führungsmacht.

Umweltschutz – was kostet der Abfall?

Dass die Umwelt bei diesem volkswirtschaftlichen Programm vor die Hunde geht, wird dabei durchaus wahrgenommen. Mehr Leute, die sterben oder Landstriche, die nicht mehr ohne weiteres benutzt werden können, werden hochgerechnet in Kosten für die Volkswirtschaft. Wo die Unternehmen die Menschen und die Umwelt eher als Umsonstladen benutzen, sorgt sich der Staat darum, dass beides auch morgen noch für ihn und die Wirtschaft zur Verfügung steht – deshalb macht er Sozial- und Umweltpolitik.

Dabei hat der Staat ein Problem: Das kostet Geld, ist „eine Belastung für die Wirtschaft“ und verhindert manches profitable Geschäft (z.B. Fracking). Dem Staat stellt sich deshalb immer die Frage, ob das wirklich sein muss. Im Ergebnis wird dann umwelttechnisch manchmal einfach gar nichts gemacht, und stattdessen in öffentlichen Reden die Schäden geleugnet oder kleingeredet. Wenn dann doch was gemacht wird, dann zumeist so: Den Unternehmen wird möglichst viel Zeit gelassen, sich möglichst günstig entsprechend der neuen Vorgaben umzustellen. Im Laufe der Zeit werden dann mal Grenzwerte festgelegt, mal bekommen Verschmutzungen einen Preis – Emissionshandel oder CO2-Steuer.

Klimapolitik – was kostet die Welt?

Wenn die Regierungen der Welt zusammen kommen, um gegen den Klimawandel etwas zu unternehmen, dann sind sie sich in der Regel uneinig. Erstens ganz fundamental darin, wie dringend gehandelt werden muss, denn bis zu welcher Grenze die Erwärmung der Erde noch zu akzeptieren ist, stellt sich für Staaten höchst unterschiedlich dar. Für viele kleine Inselstaaten sind schon 1,5 Grad globale Erwärmung zu viel. Für Länder wie Russland geht selbst eine Erwärmung um 2 Grad sogar mit allerlei erhofften Vorteilen einher. Staaten sind sehr unterschiedlich von den Folgen des Klimawandels betroffen.

Zweitens verfolgen sie unterschiedliche Klimaschutzstrategien, die sich oft genug wider-sprechen und wechselseitig behindern. Denn Staaten verfolgen bestimmte Klimaschutz-Massnahmen sehr gerne und andere wiederum überhaupt nicht – je nach Vorteil für die nationale Wirtschaft. So ist für die meisten Industriestaaten die Abhängigkeit von Öl- und Gaslieferländern schon länger eine ärgerliche Nebenwirkung ihrer Energiepolitik. Die Er-zeugung von Energie jenseits von Verbrennung von Öl und Gas ist deshalb für diese Staaten interessant – und zwar erstmal völlig unabhängig von der Klimapolitik. Zur unabhängigen Energieversorgung der nationalen Wirtschaft setzen deshalb manche Staaten auf die Förderung von erneuerbaren Energien. Je unabhängiger man sich von anderen Energieliefer-anten macht, desto besser kann man gute Öl- und Gaspreise bei den Lieferländern aushandeln.

Wenn dann in diesem Sinne eine neue Industrie aufgebaut wird, ist sofort der wirtschaftspolitische Gedanke da, daraus einen Exportschlager zu machen, wie es mit der Solarenergie in Deutschland bis 2012 versucht wurde. Als Chinas Solarproduktion sich dann doch als konkurrenzfähiger erwiesen hat und von der deutschen Energiesubvention profitierte, wurde die Förderung umgehend wieder eingestellt. Öl- und Gasstaaten und die Transitländer der Rohstoffe finden hingegen die neue Energiepolitik der Industriestaaten naturgemäss nicht gut. Andere Staaten sehen wiederum eine Chance, durch die Bereitstellung grosser Flächen für Biomasse und Solarfelder wenigstens ein bisschen Miete von den kapitalistischen Grossmächten bzw. von deren Unternehmerschaft abzugreifen.

Gibt es in einer Wirtschaft entscheidende Schlüsselindustrien – wie in Deutschland die Autoindustrie – sorgt das für Widerstand gegen Massnahmen, die diese Industrie gefährden. Daher trat die deutsche Regierung, egal ob CDU/SPD, CDU/FDP oder SPD/Grüne, immer wieder auf die Bremse, wenn Frankreich hier ein paar weitergehende Klimaschutzmassnahmen vorschlug. Anders verhält es sich, wenn der deutschen Autoindustrie ihr Spitzenplatz streitig gemacht werden soll, zum Beispiel wenn China die Klima-frage nutzt, um mit nationalen E-Auto-Vorgaben endlich selbst einen Weltautokonzern auf die Beine zu stellen. Da will sich VW nicht abhängen lassen – zu aussichtsreich sind die Absatzchancen in China und darüber hinaus. Das leuchtet auch der Bundesregierung ein, die das Unterfangen unterstützt, bspw. indem sie den Ausbau von Ladestationen beschleunigt.

Fazit – Mit Klimapolitik in die Klimakrise?

So ging und geht die Klimapolitik voran. Massnahmen, die Kostennachteile für die eigene Volkswirtschaft bringen, werden schlichtweg vermieden. Massnahmen, die die eigene Volkswirtschaft voranbringen, zum Beispiel wenn sie Absatzmärkte für eigene „grüne“ Weltmarkt-Champions eröffnen, werden durchgezogen. Der technische Fortschritt ist dabei als Mittel für neues kapitalistisches Wachstum wie immer voll eingeplant – einmal als Mittel für Weltmarktexpansionen nationaler Produkte, und einmal als Hoffnungsträger für zukünftige technische Innovationen. So besteht in der Politik die leise Hoffnung, dass mit einer Erfindung „made in Germany“ der Klimawandel oder seine Folgen abgewendet werden können. Dann erübrigen sich auch Entscheidungen, die schwer fallen, zum Beispiel strenge Emissionsgrenzen.

File:FridaysForFuture Demonstration in Berlin, 20.09.2019 (48895537293).jpg

Das alles meint Merkel, wenn sie die Klimaproteste für ihr ehrenwertes Anliegen lobt und zugleich daran erinnert, dass Vieles zu bedenken ist. „Wir müssen Arbeitsplätze und Wirtschaftskraft auf der einen Seite mit den Zielen des Klimaschutzes versöhnen.“ Und etwas anderes ist auch nicht abzusehen, wenn sich derzeit Bündnis90/Die Grünen fit für die Machtübernahme machen. Trittin als Umweltminister hat in dieser Hinsicht schon mal gezeigt, was zu erwarten ist (Atomausstieg mit langen Laufzeiten, Abwehr von Vorschlägen aus Frankreich für weitergehende Klima-Ziele).

Klimapolitik geht also, aber sie geht in einer kapitalistischen Nationalökonomie ebenso. Dass das ausreichen würde, um Kipppunkte zu vermeiden, ist nicht sehr wahrscheinlich. Von daher ist eine Umweltbewegung, die sich an die Politik wendet, verkehrt. Vielleicht werden durch die Klimapolitik dauerhaft klimaschädliche Stoffe reduziert. Sehr wahrscheinlich ist das nicht. Und wenn, dann mit allen beschriebenen Nebenwirkungen moderner Politik. Es steht daher an, sich gegen die Zwecke und Ziele der herrschenden Politik zu richten. Appelle an Politik und Wirtschaft der Sorte „strengt euch bitte mehr an“ sind dagegen völlig fehl am Platze.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————-

Grafikquellen        :

Oben        —        FridaysForFuture Demonstration in Berlin, Berlin, 29.11.2019

Source FridaysForFuture Demonstration in Berlin, Berlin, 29.11.2019
Author Stefan Müller (climate stuff) from Germany

This image was originally posted to Flickr by Stefan Müller (climate crusty) at https://flickr.com/photos/184802432@N05/48895537293. It was reviewed on 14 October 2019 by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc-by-2.0.

w:en:Creative Commons
attribution
This file is licensed under the Creative Commons Attribution 2.0 Generic license.

—————–

Unten        —         FridaysForFuture Demonstration in Berlin, 20.09.20

Author Stefan Müller

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

This image was originally posted to Flickr by Stefan Müller (climate crusty) at https://flickr.com/photos/184802432@N05/48895537293. It was reviewed on by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc-by-2.0.

Abgelegt unter APO, International, Medien, Umwelt | Keine Kommentare »

Leichen im Keller

Erstellt von DL-Redaktion am 1. Dezember 2019

(Teil 3):  Der vertuschte Quecksilber-Skandal

ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998.tif

Quelle       :          INFOsperber CH.

Von  Frank Garbely

Jahrzehntelang verschwiegen Behörden und die Lonza die Quecksilber-Gefahr. Bis die Deponie saniert ist, können noch Jahre vergehen.

Seit 1978 ist bekannt, dass giftige Chemie- und Industrie-Abfälle der Lonza-Deponie Gamsenried bei Visp das Grundwasser verschmutzen. Doch erst zwölf Jahre später lief die Sanierung der Deponie an. Und es dauerte nochmals rund 20 Jahre, bis die Öffentlichkeit erfuhr, dass die Lonza die Umwelt auch mit Quecksilber verseuchte. Die Walliser Behörden wussten das seit Jahrzehnten, aber sie unternahmen nichts gegen die Quecksilber-Gefahr und vertuschten das Problem. Ob die undichte Deponie überhaupt sanierbar ist, darüber gibt es Zweifel.

Bereits Ende der 1980er Jahre vertrat der Zürcher Geologe Marcos Buser, ein erfahrener Experte im Bereich Entsorgung chemotoxischer Sonderabfälle, die Ansicht, dass sich die Sanierung nicht auf die Deponie beschränken dürfe. Nach seiner Einschätzung war das Grundwasser im Unterstrom der Deponie bis hinunter nach Lalden viel stärker verschmutzt als bisher angenommen. Dabei stützte er sich auf Analysen, welche die Lonza in Auftrag gegeben hatte. Zwischen 1979 und 1986 hatten Forscher der Universität Neuenburg Grundwasser-Analysen durchgeführt. Sie stellten eine starke Verschmutzung des Grundwassers zwischen Gamsen und Lalden fest. Zu den analysierten Stoffen zählten unter anderem: Aniline, Phenol, Ammonium und Chloride.

Die Forscher studierten zudem die räumliche und zeitliche Ausbreitung der diversen Verschmutzungen. Doch die Ergebnisse dieser Analysen wurden nie kommuniziert, sie liegen bis heute unter Verschluss, nicht einmal das Amt für Umweltschutz in Sitten kennt sie. Wie hat sich die Verschmutzung seit den 80er Jahren entwickelt; wie weit talabwärts reicht sie inzwischen, bis Raron oder gar bis Gampel. Oder sackten die Schadstoffe ab und liegen 30 oder 40 Meter tief im Grundwasser?

Experte sagte Scheitern voraus

In seinem Gutachten vom September 1988 zum Sanierungsprojekt gab Marcos Buser der Sanierung kaum Erfolgschancen. Der Experte rechnete damit, dass die Deponie bald wieder das Grundwasser verschmutzen werde. Darum seine Empfehlung: «Sollte die Umweltbelastung durch die Deponie anhalten, werden Sanierungsmassnahmen an der Quelle nötig. Das heisst: Ausräumen der bestehenden Deponie, Nachbehandlung des Lagergutes.»

Nur: Kaum jemand hatte das Gutachten Buser gelesen.

Trotz Bedenken des Gutachters bewilligten Sitten und Brig das Sanierungskonzept. Am 1. Dezember 1990 lief die Sanierung an. In der Folge warteten die Lonza und das Amt für Umwelt regelmässig mit Erfolgsmeldungen auf: Die Sanierung greift. Alles läuft nach Plan.

So geriet die Lonza-Havarie langsam in Vergessenheit, niemand sprach mehr von der Deponie.

Quecksilber auf Wiesen und in Gärten

Doch dann die nächste unliebsame Überraschung: Quecksilberverseuchte Böden zwischen Steg und Visp. Beim Bau der Autobahn stellte man in den Jahren 2009/2010 fest, dass landwirtschaftlich genutzte Felder und private Gärten stellenweise stark mit Quecksilber belastet waren. Woher das Quecksilber kam, war sofort klar: aus der Lonza. Vorerst unklar blieb hingegen: Wie viel Quecksilber lagerte in den Böden?

Die Behörden von Sitten und die Lonza gaben Studien in Auftrag, lieferten eine erste Antwort: 28 Tonnen. Doch diese Zahl war nicht korrekt – einmal mehr. Das zumindest behauptete der Verein Ärztinnen und Ärzte für Umweltschutz (AefU). Er sprach von 200-250 Tonnen Quecksilber. Die Lonza dementierte. Aber der Verein AefU hatte zumindest zum Teil recht. Die Lonza musste ihre eigenen Zahlen nach oben korrigieren, sprach nicht mehr von 28 Tonnen, sondern neu von 50 Tonnen Quecksilber.

Sowohl beim Amt für Umwelt in Sitten wie auch bei der Lonza hatte sich in den letzten zehn Jahren einiges getan. Das Amt in Sitten hatte massiv aufgerüstet, eine ganze Reihe von hochqualifizierten Mitarbeitern angestellt. Und vor allem: Sitten setzte immer stärker auf Transparenz. Das Amt für Umweltschutz richtete eine eigene Website ein, informiert seither laufend über Umweltverschmutzung und den Fortschritt von Sanierungsprogrammen.

Ein ähnlicher Wandel vollzog sich bei der Lonza. Sie kaufte ein ausgewiesenes Spezialisten-Team ein, das besonders grosse Erfahrung mit der Entsorgung von Sondermüll und der Sanierung von Chemie-Deponien mitbrachte. Dieses neue Team begann proaktiv über die Probleme der Lonza mit Umweltverschmutzung zu kommunizieren. Ein schwieriger und auch undankbarer Job. Immer wieder musste und muss das Team geradestehen für Fehler früherer Lonza-Verantwortlicher, für Sünden aus längst vergangener Zeit.

Deponie schon wieder undicht

Die Polemik über das Ausmass der Quecksilber-Verschmutzung sorgte im Wallis jahrelang für heisse Köpfe. Die Lonza kam kaum aus den Schlagzeilen heraus. Dieser Medienrummel um die quecksilber-verseuchten Böden kaschierte einen anderen, womöglich noch grösseren Skandal: Die Lonza-Deponie war erneut undicht.

Die Befürchtungen des Experten Buser hatten sich bewahrheitet. Trotz komplexen und aufwendigen Massnahmen spülte die Deponie weiter Schadstoffe ins Grundwasser. Das zeigten Grundwasseranalysen aus den Jahren 2005-2006. Aber erst ein halbes Jahrzehnt später erfuhr die Öffentlichkeit davon – im Sommer 2011. Damals stufte die Dienststelle für Umwelt die Deponie «als belasteter, sanierungsbedürftiger Standort» ein und verlangte von der Lonza «ein umfassendes Sanierungsprojekt für das ganze Areal der alten Deponie». Die erwähnten Analysen ermittelten im Grundwasser eine ganze Reihe von Schadstoffen, darunter Anilin, Azonol, Phenol, Toluidin, Benzol … Und plötzlich war auch die Rede von Quecksilber.

60 Tonnen Quecksilber lagern in der Deponie

Wie konnte das sein? Warum erst jetzt? Wieso nicht schon 1978, als Geohydrologen festgestellt hatten, dass die Deponie undicht war? Für die Sanierung der maroden Deponie waren damals unzählige Untersuchungen durchgeführt worden. Dutzende von Experten hatten Studien angefertigt. Aber nicht einer hatte im Zusammenhang mit der Deponie Quecksilber erwähnt. Das geschah erst im Jahre 2011. Ein Sprecher der Dienststelle für Umwelt in Sitten erklärt: «Es war unsere Dienstelle, die im Jahr 2011 die Lonza darauf aufmerksam gemacht hatte, dass es auf der Deponie Quecksilber geben muss.» Und plötzlich meldete die Lonza, dass auf der Deponie tatsächlich Quecksilber lagerte, und nicht zu knapp, nämlich 40 bis 60 Tonnen.

Dabei wusste die Lonza: Auf der Deponie lagerte schon immer Quecksilber. Seit dem ersten Tag. Die Deponie war 1918, vor über 100 Jahren, in Betrieb genommen worden.

Quecksilber hatte die Lonza seit 1917 eingesetzt, als Katalysator bei der Produktion von Azetaldehyd. Auch in den 40er Jahren bei der Produktion von Vinylchlorid, zur Herstellung von Gummiersatzstoffen. In den 60er Jahren nahm die Lonza die Petrochemie in Betrieb und konnte so ihre Produktion massiv steigern. Das war aber keineswegs das Ende des Quecksilber-Einsatzes. Im Gegenteil, die Quecksilberverwendung nahm zu und damit schnellte auch der Quecksilberverlust in die Höhe. Erst in jüngster Vergangenheit hat die Lonza jede Nutzung von Quecksilber eingestellt.

Jahrzehntelang vertuscht

Auch die Behörden, speziell die staatlichen Ämter im Bereich Gewässer- und Umweltschutz wussten seit Jahrzehnten, dass die Lonza die Umwelt, u.a. mit Quecksilber, belastete.1) Seit den 1920er Jahren waren in der Rhone zwischen Visp und Leuk immer wieder ganze Fischbestände vergiftet worden. Regelmässig hatte der Staat Experten ins Oberwallis geschickt, um die Ursachen für das Fischsterben zu ermitteln. Das Resultat war jeweils dasselbe: die Industrie-Abwässer der Lonza. Bereits in den 1940er Jahren war im Zusammenhang mit toxischen Abwässern ausdrücklich die Rede von Quecksilber. Spätestens seit 1974 war der Lonza und auch den kantonalen Behörden die Verschmutzung der Rhone mit Quecksilber bekannt. Die Internationale Kommission zum Schutz des Genfersees liess die Sedimente der Rhone untersuchen. Die höchsten Quecksilberwerte wurden im Oberwallis gemessen, und zwar dort, wo die Lonza ihre Abwässer in die Rhone leitete. Die Untersuchungsergebnisse wurden veröffentlicht. Natürlich kannten die Behörden in Sitten diese Untersuchungen, der Kanton war Mitglied der Genfersee Kommission. Doch im Wallis schien niemand beunruhigt, niemand sorgte sich über die massive Quecksilberverschmutzung, niemand stellte Fragen – auch kein Politiker.

Erst seit 2011 ist Quecksilber wieder ein Thema. Erst seit 2011 ist bekannt, dass auf der Lonza-Deponie 40-60 Tonnen Quecksilber liegen und dass die Deponie wieder undicht ist und das Grundwasser verseucht.

Deponie muss dringend neu saniert werden

Jetzt muss die Deponie dringend neu saniert werden. Das kann dauern. Zuerst sind die Experten – Geohydrologen, Chemiker, Bau- und Umwelt-Ingenieure – am Werk. Bis Ende des nächsten Jahres müssen sie eine «Detailuntersuchung» über Inhalt und Zustand der Deponie durchführen, dann eine «Gefährdungsabschätzung» vornehmen, bevor sie die «Variantenstudien» in Angriff nehmen können, um schliesslich ein «Sanierungsprojekt» zu erarbeiten: ein umfangreicher Bericht, der bei den Behörden eingereicht und abgesegnet werden muss. Dann erst wird man beginnen können zu überlegen, welche der vorgeschlagenen Sanierungsmassnahmen ergriffen werden soll. «Die erste Massnahme wird realistischerweise frühestens im Jahre 2022 umgesetzt werden können. Das geht einfach nicht anders», sagt Rémi Luttenbacher, Leiter Umweltprojekte bei der Lonza.

Ist die Deponie überhaupt sanierbar?

Und in dieser langen Zeit werden aus der undichten Deponie weiterhin Schadstoffe ins Grundwasser sickern. Welche Stoffe, in welchen Mengen und in welcher Konzentration? Wie lange noch? Was geschieht mit dem immer stärker verschmutzten Grundwasser? Viele offene Fragen. Genau genommen weiss man noch nicht einmal, ob die 1,5 Millionen Kubikmeter mächtige Deponie überhaupt sanierbar ist. Offen auch die Frage, wer zum Schluss den Schaden bezahlen wird!

Site Lonza de Viège, vu depuis la gare de Lalden 2.JPG

Bleibt noch nachzutragen. Im April dieses Jahres wurde im Grundwasser in Visp und im Bereich der Lonza-Deponie Benzidin, eine hochgiftige und krebserregende Substanz entdeckt. Joël Rossier, der in die Wüste geschickte Chef der Dienststelle Umwelt, schlug Alarm und verlangte sofortige Massnahmen. Die Lonza und auch Rossiers Chef, Staatsrat Melly, dagegen beruhigten. Das Grundwasser sei nicht betroffen, jede Gefahr sei gebannt, erklärten sie wiederholt.

Auch im Fall Benzidin fällt der dürftige Wissensstand der Lonza auf – einmal mehr. Bei der Lonza weiss man zwar, dass das Benzidin von der Deponie ins Grundwasser gelangt. Aber: Wie kam der hochtoxische Stoff auf die Deponie? Das scheint schleierhaft, selbst für die Lonza. «Wir wissen nicht, woher das Benzidin kommt. Die Lonza hatte und hat für keine ihrer Produktionen Benzidin benutzt», sagt ein Sprecher der Lonza.

Was kommt nach Benzidin?

1) Bericht der Geschäftsprüfungskommission (GPK) über das Quecksilberdossier, der dieser Tage veröffentlicht wurde. Der Walliser Grosse Rat (Kantonsrat) wird sich mit dem Bericht in der Dezembersession (10.-13. Dezember) beschäftigen.

———————————-

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

———————————————————-

Teil 1: «Der Fall Rossier»

Teil 2: «Zeitbombe Lonza-Deponie»

Grafikquellen         :

Oben             ––                 ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998

Unten       —      Lonza site of Visp seen from the Lalden station.

Abgelegt unter Kriminelles, Medien, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Angriff auf die VVN-BdA

Erstellt von DL-Redaktion am 1. Dezember 2019

Antifaschismus muss gemeinnützig bleiben! 

Protest again le pen 2002 0241.jpg

Quelle       :          VVN-BdA …

 Von Cornelia Kerth, Dr. Axel Holz

Am 4. November hat das Finanzamt für Körperschaften I des Landes Berlin der Bundesvereinigung der Vereinigung der Verfolgten des Naziregimes – Bund der Antifaschistinnen und Antifaschisten (VVN-BdA) e.V. die Gemeinnützigkeit entzogen. Damit verbunden sind vorerst Steuernachforderungen in fünfstelliger Höhe, die noch in diesem Jahr fällig werden. Weitere erhebliche Nachforderungen sind zu erwarten und auch zukünftig drohen wesentlich höhere steuerliche Belastungen. Damit ist die VVN-BdA in ihrer Existenz bedroht.

Das Finanzamt Berlin handelt damit anders, als das Finanzamt Oberhausen-Süd, das der Landesvereinigung NRW die Gemeinnützigkeit am 22. Oktober gewährt hat. In beiden Fällen war derselbe Vorwurf erhoben worden. Er besteht darin, dass die Landesvereinigung Bayern der VVN-BdA im bayrischen Verfassungsschutzbericht wiederholt als linksextremistisch beeinflusst dargestellt wird. Während das Finanzamt Oberhausen-Süd der Widerrede der VVN-BdA im Anhörungsverfahren entsprach, beharrt das Berliner darauf, dass „der volle Beweis des Gegenteils, als Widerlegung der Vermutung als extremistische Organisation“ nicht erbracht worden sei.

Das bedeutet, dass die Bewertung durch eine nachgeordnete bayrische Landesbehörde, die laut bayrischem Gerichtshof keine Tatsachenbehauptung darstellt, demnach über das Schicksal einer bundesweit arbeitenden zivilgesellschaftlichen Organisation entscheiden dürfen soll.

Von Überlebenden der Konzentrationslager und Gefängnisse 1947 gegründet, ist die VVN-BdA seitdem die größte, älteste, überparteiliche und überkonfessionelle Organisation von Antifaschistinnen und Antifaschisten Deutschlands. Sie vertritt die Interessen von Verfolgten und Widerstandskämpfern, sowie deren Nachkommen, tritt für Frieden und Völkerverständigung ein und hat gegen große gesellschaftliche Widerstände wesentlich dafür gesorgt, dass die Verbrechen des Nazi-Regimes nicht in Vergessenheit geraten sind, u.a. durch den Einsatz für die Errichtung von Gedenkstätten und Erinnerungsorten und vielfache Zeitzeugenarbeit. Sie informiert über aktuelle neofaschistische Umtriebe und organisiert den Widerstand in breiten Bündnissen.

Wir sind entsetzt und empört darüber, dass sich das Berliner Finanzamt die haltlosen Unterstellungen der bayrischen Behörde ungeprüft zu eigen macht. Damit behindert es genau das zivilgesellschaftliche Engagement, das von Regierung und Parteien angesichts schrecklicher rechtsterroristischer Verbrechen allenthalben eingefordert wird.

Wir fordern die Anerkennung der Gemeinnützigkeit für unsere Organisation!

Wir fordern praktische Unterstützung für alle zivilgesellschaftlichen Gruppen und Organisationen, die die Grundwerte des Grundgesetzes gegen rassistische, antisemitische, nationalistische und neofaschistische Angriffe verteidigen

————————————————————–

Grafikquelle          :         Protest against Le Pen, France, 2002.

Abgelegt unter APO, International, Mensch, Umwelt | Keine Kommentare »

Freiheit für Julian Assange

Erstellt von DL-Redaktion am 30. November 2019

Keine Auslieferung an die USA

File:John Pilger, Richard Gizbert, and Julian Assange - The Wikileaks Files - Book Launch - London - 29th September 2015.jpg

Quelle         :        untergrund-blättle CH.

Von Rainer Thiem neue-debatte.com

Am 4. Oktober 2016 feierte Wikileaks in Berlin seinen 10. Geburtstag. Von 2006 bis 2016 wurden über zehn Millionen Dokumente über Korruption, Kriegs- und Umweltverbrechen, über Menschenrechtsverletzungen verschiedener Regierungen, Unternehmen und Institutionen veröffentlicht.

Der Blaue Planet, unser Planet, könnte ein Paradies für alle sein, wenn diejenigen, die die wirtschaftliche und politische Macht haben, sich nicht auf ihren Machterhalt fokussierten, sondern Menschenwürde und Menschenrechte ins Zentrum ihres Denkens und Handelns stellten. Da dies nicht so ist, wird der Kampf um eine gerechte Welt seit Jahrhunderten – oftmals blutvergiessend – ausgetragen.

Hier und da gab und gibt es aufgrund der erbitterten Kämpfe positive Entwicklungen, eine davon ist, dass nicht mehr überall Tyrannen herrschen, sondern Bürgerinnen und Bürger durch Wahlen darüber bestimmen, wer in ihrem Auftrag die Regierungsgeschäfte führt.

Meinungs- und Pressefreiheit

Zu den positiven Entwicklungen sind auch die Fortschritte beim längst noch nicht entschiedenen Kampf um Meinungs- und Pressefreiheit zu zählen. So hat nach Artikel 19, der am 10. Dezember 1948 verabschiedeten rechtlich nicht bindenden Resolution der Vereinten Nationen, „Jeder das Recht auf Meinungsfreiheit und freie Meinungsäusserung; dieses Recht schliesst die Freiheit ein, Meinungen ungehindert anzuhängen sowie über Medien jeder Art und ohne Rücksicht auf Grenzen Informationen und Gedankengut zu suchen, zu empfangen und zu verbreiten.“

Wesentlich rechtssicherer sind Meinungs- und Pressefreiheit in Deutschland durch Artikel 5 des Grundgesetzes geregelt. Hiernach hat „Jeder das Recht, seine Meinung in Wort, Schrift und Bild frei zu äussern und zu verbreiten und sich aus allgemein zugänglichen Quellen ungehindert zu unterrichten. Die Pressefreiheit und die Freiheit der Berichterstattung durch Rundfunk und Film werden gewährleistet. Eine Zensur findet nicht statt.“

Demokratie braucht Wistleblower – und muss sie besser schützen

Ein Qualitätsmerkmal demokratischer Gesellschaften wäre es, wenn Medien Informationen über die Interessen und das Handeln der Regierenden und der Verantwortlichen in der Wirtschaft uneingeschränkt transparent machten. Hierdurch könnte die Öffentlichkeit zeitnah erfahren, ob deren Interessen und das beabsichtige Handeln dem Gemeinwohl dienen. Bei dieser Aufgabe kommt qualifizierten Hinweisgebern beziehungsweise Whistlebowern aus den Hinterzimmern der Macht sowie Enthüllungsplattformen zunehmend eine Schlüsselrolle zu.

Julian Assange und die Enthüllungsplattform Wikileaks

Ein grosser, bleibender Verdienst von Julian Assange und seinen Mitstreitern ist es, dass sie 2006 die Enthüllungsplattform Wikileaks gründeten, um denjenigen zur Seite zu stehen, „die unethisches Verhalten in ihren eigenen Regierungen und Unternehmen enthüllen wollen“.

Dazu wurde nach eigenen Angaben ein System „für die massenweise und nicht auf den Absender zurückzuführende Veröffentlichung von geheimen Informationen und Analysen“ geschaffen.“ [1]

Julian Assange inspirierte Edward Snowden, durch den die Welt erfuhr, wie es um die Sicherheit der digitalen Infrastruktur bestellt ist. Ohne Assange gäbe es vielleicht keinen Snowden, keine Chelsea Mannig und keine weiteren hochrangigen Whistleblower.

Am 4. Oktober 2016 feierte Wikileaks in Berlin seinen 10. Geburtstag. Von 2006 bis 2016 wurden über zehn Millionen Dokumente über Korruption, Kriegs- und Umweltverbrechen, über Menschenrechtsverletzungen verschiedener Regierungen, Unternehmen und Institutionen veröffentlicht. Die Pressekonferenz aus Anlass des Geburtstages fand in der Berliner Volksbühne statt. Die Moderation übernahm die Journalistin Sarah Harrison. Es wurde das Jubiläumsvideo „10 Jahre WikiLeaks“ gezeigt, welches die Zusammenfassung der Top 10 [2] der grössten Veröffentlichungen von WikiLeaks darstellt.

Zu den Top 10 der Wikileaks-Veröffentlichungen gehören:

  • Die „Guantanamo-Akte“, die die systematische und regelmässige Anwendung von Gewalt, die der Genfer Konvention widerspricht, dokumentiert sowie die Inhaftierung von 800 Häftlingen im Alter zwischen 14 und 89 in Guantanamo Bay.
  • Die „Irak- und Afghanistan-Kriegsprotokolle“ zeigen die wahren Zahlen an zivilen Opfern im Irak- und Afghanistankrieg. Es sind die umfangreichsten und detailliertesten Aufzeichnungen von Kriegsverbrechen der Gegenwart. Sie beinhalteten die Misshandlungen und Anwendung von Folter an Häftlingen durch die Polizei und das Militär.
  • Der „Minton-Bericht“ zeigt, wie die niederländische Firma Trafigura extrem giftige Umweltstoffe an der Elfenbeinküste lagerte und damit 108.000 Menschen vergiftete. Durch eine einstweilige gerichtliche Verfügung wurde die Veröffentlichung des Berichtes im britischen Guardian und der BBC verhindert. Aber WikiLeaks veröffentlichte diesen Bericht.
  • „Die kollaterale Ermordung“ ist ein als geheim klassifiziertes Video des US-Militärs, welches die Tötung von 18 Menschen im Irak aus einem bewaffneten US-Helikopter zeigt, darunter waren auch zwei Reuters-Journalisten und Rettungskräfte. Die US-Soldatin und Whistleblowerin Chelsea Manning ist für die Weitergabe dieser geheimen Militärdokumente zu einer 35jährigen Haftstrafe durch ein US-Militärgericht verurteilt worden.

2006 war auch das Jahr, als viele junge technik-affine und politisch interessierte Menschen an Transparenz, das Ende politischer Geheimniskrämerei und die demokratisierende Kraft der digitalen Technik glaubten. Sie machten sich auf den Weg und gründeten weltweit Piraten-Parteien.

Ein Jahr nach dem Wikeleaks-Jubiläum ist aus der Sicht des ZEIT-Kommentators Götz Hamann von der Aufbruchsstimmung nicht mehr viel übrig geblieben geblieben. Unter dem Titel „Himmel und Hölle der Nerd-Bewegung“ [3] in der ZEIT vom 19. Mai 2017 – scheint es für ihn so zu sein, „als wäre das politische Schicksal der Piraten-Parteien mit dem persönlichen von Julian Assange verbunden.“ Ob es einen solchen Zusammenhang gibt, wäre an anderer Stelle zu analysieren.

Worauf aber in diesem Zusammenhang hinzuweisen ist, ist die Erklärung von Patrick Breyer anlässlich der Verhaftung von Julian Assange vom 11. April 2019:

Die Pressefreiheit verbietet eine Auslieferung von Julian Assange

„Egal, was man von Assange persönlich hält: Wegen der auch für elektronische Medien geltenden Pressefreiheit darf kein Pressevertreter für die Veröffentlichung von ‚Staatsgeheimnissen‘ verfolgt werden, auch nicht wegen ‚Anstiftung‘ seines Informanten. Zudem kann Assange vor einem geheimen US-Sondergericht keinen fairen Prozess erwarten. Da die USA internationale Menschenrechte nicht nur in diesen Punkten missachten, darf Assange nicht in die USA ausgeliefert werden. Das würde ein fatales Signal an alle Whistleblower senden. Unbeeinflusst davon sollten die in Schweden erhobenen Vorwürfe von Vergewaltigung rechtsstaatlich geklärt werden.

Dass Assange nach einem Machtwechsel und der Veröffentlichung von Korruptionsvorwürfen gegen den Präsidenten Ecuadors plötzlich ausgeliefert worden ist, lenkt den Blick auf die prekäre Situation auch des berühmten Whistleblowers und Überwachungsgegners Edward Snowden. Snowden ist durch die Aufdeckung illegaler Massenüberwachungsprogramme zum Held geworden und verdient dauerhaft sicheren Aufenthalt in einem Rechtsstaat. Die Bundesregierung, die dies aus Angst vor den USA bisher verweigert, muss sich jetzt bewegen!“ [4]

Patrick Breyer war zum damaligen Zeitpunkt der Erklärung Spitzenkandidat der Piratenpartei Deutschland zur Europawahl 2019 und nun Abgeordneter im Europäischen Parlament. Er ist Europas neue Stimme der Privatsphäre und des freien Internets.

Chelsea Manning erneut verhaftet

Die ehemalige WikiLeaks-Informantin Chelsea Manning, die von einem Militärgerichtsverfahren zu 35 Jahren Haft verurteilt wurde, kam durch einen Gnadenerlass des damaligen US-Präsidenten Barack Obama 2017 vorzeitig frei. Nun ist sie seit dem 8. März 2019 wieder im Gefängnis, weil sie sich weigert, gegen WikiLeaks-Gründer Julian Assange auszusagen.“ [5]

Anfrage aus den USA an Weggefährten aus Deutschland

Am 7. März 2018 erhielt der deutsche Weggefährte, Daniel Domscheit-Berg, einen Brief der US-Ankläger gegen Julian Assange mit der Bitte um eine „freiwillige Vernehmung“. Er müsse alle Fragen beantworten und alle Dokumente aushändigen, die er habe, dafür sichere man ihm im Gegenzug Straffreiheit zu. Domscheit-Berg lehnte ab. „Ich müsste geistig schon sehr minderbemittelt sein, um mich auf so was einzulassen“, sagt er, obwohl er Assange kritisch sieht. [6]

Stand des Verfahrens gegen Julian Assange und die Auswirkungen der Haft

Assange verbüsst gegenwärtig in Grossbritannien eine Haftstrafe von 50 Wochen wegen des Verstosses gegen Kautionsauflagen. Die USA haben offiziell einen Auslieferungsantrag gestellt. Sollte Assange an die USA ausgeliefert werden und sollte ihm dort der Prozess wegen der Straftat „Verschwörung“ gemacht werden, könnten ihn bis zu 175 Jahre Haft erwarten. Assange beruft sich auf die Pressefreiheit und bezeichnet sich selbst als Journalisten.

Der UN-Sonderberichterstatter für Folter, Nils Melzer, hat Assange im Sommer im Gefängnis besucht. Die Bedingungen seiner Haft seien „fundamental inhuman“ schreibt Melzer in seinem Bericht. Assange „zeige alle Symptome eines Menschen, der länger psychischer Folter ausgesetzt“ gewesen sei. [7]

Rainer Thiem
neue-debatte.com

Fussnoten:

[1] https://de.wikipedia.org/wiki/WikiLeaks

[2] https://hpd.de/artikel/top-10-wikileaks-enthuellungen-13598

[3] https://www.zeit.de/digital/internet/2017-05/julian-assange-wikileaks-einfluss-fall

[4] https://www.piratenpartei.de/2019/04/11/die-pressefreiheit-verbietet-eine-auslieferung-von-julian-assange/

[5] https://www.zeit.de/politik/ausland/2019-05/wikileaks-chelsea-manning-erneut-inhaftiert

[6] https://www.tagesschau.de/investigativ/ndr/assange-bini-101.html

[7] https://www.tagesschau.de/investigativ/ndr/assange-bini-101.html

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-ND 4.0) Lizenz.

—————————————————————-

Grafikquelle       :             John Pilger, Richard Gizbert, and Julian Assange – The Wikileaks Files – Book Launch – Foyles, London – 29th September 2015

Author Walej        /     Source     :    Own work
attribution share alike This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

Abgelegt unter Friedenspolitik, International, Justiz-Kommentare, Mensch | Keine Kommentare »

Leichen im Keller

Erstellt von DL-Redaktion am 29. November 2019

(Teil 2): Zeitbombe Lonza – Deponie

9 Visp 120818.jpg

Quelle        :     INFOsperber CH.

Von  Frank Garbely

Der geschasste Walliser Umweltchef Joël Rossier war besorgt wegen Altlasten der Lonza-Deponie. Bei den Behörden fand er kaum Gehör.

Seit 1978 ist den Behörden bekannt: Die Deponie ist undicht und versaut das Grundwasser mit chemischen Schadstoffen. Heute, 41 Jahre später, ist die Deponie noch immer undicht, und sie versaut noch immer das Grundwasser, jetzt auch noch mit Benzidin, einem hochgiftigen und krebserregenden Schadstoff.

Jahrzehntelang haben Lonza und Behörden geschwiegen, dann vertuscht. Jetzt versucht man es wieder einmal mit Sanieren. Doch noch weiss man nicht wie; man weiss nicht einmal, ob eine Sanierung überhaupt möglich ist. Und vor allem, keiner kann sagen, wer zum Schluss den Schaden bezahlen wird.

Bodenmann schlägt Alarm

Zuerst war es nur ein Gerücht. In den Jahren 1977-1979 tauchten immer wieder Hydrologen auf und nahmen im Umfeld der Deponie Grundwasserproben. Hans Kalbermatten, damals Besitzer der Thermalquellen in Brigerbad, geriet in Aufruhr und fürchtete schon um sein Geschäft. Kein Wunder, die Deponie lag in unmittelbarer Nähe seines Thermalbades, dazwischen gab es nur die Rhone. Die Lonza wollte Kalbermatten keine klare Auskunft geben. Selbst das Amt für Umwelt Wallis (DUW) in Sitten, Auftraggeber der Hydrologen, hüllte sich in Schweigen.

Schliesslich war es ein junger Briger Gemeinderat, der für Klarheit sorgte: Peter Bodenmann, der spätere Präsident der SP Schweiz und Walliser Staatsrat. Ende April 1980 informierte er die übrigen Gemeinderäte. Aus dem Gerücht wurde ein handfester Skandal. Bodenmann hatte herausgefunden: Die Deponie war tatsächlich undicht, schlimmer noch, die Lonza und das Amt für Umwelt wussten Bescheid – seit zwei Jahren schon. Die Deponie liegt auf Territorium der Stadtgemeinde Brig, aber weder Lonza noch Sitten hatten es für nötig gehalten, die Briger Behörden zu informieren.

Lonza wiegelt ab: Kein Gift

Der Briger Gemeinderat war empört und setzte eine Krisensitzung an. Diese fand am 5. Mai 1980 im Stockalperschloss statt. Eine denkwürdige Sitzung. Das Protokoll zeigt: Sie hatte geradezu Modellcharakter für die Informationspolitik der kommenden Jahrzehnte. Die Lonza und das Amt für Umweltschutz gaben ihr Wissen immer nur scheibchenweise preis. Und meist erst auf öffentlichen Druck.

Jean-Pierre Julen, damals Chef des Amtes für Umweltschutz in Sitten, bestätigte: Die Deponie ist undicht. Er stellte es als eine riesige Überraschung dar: «Alle Experten waren überzeugt, die Deponie sei dicht.» Thaddeus Stachelski, Direktor der Lonza Visp, pflichtete Julen bei: «Selbst wir bei der Lonza sind total überrascht, niemand konnte sich vorstellen, dass die Deponie rinnt.» Gemeinderat Peter Bodenmann kritisierte heftig, dass die Gemeinde nicht rechtzeitig informiert wurde. Julen rechtfertigte sich: «Wir wollten, dass unsere Experten in Ruhe ihre Untersuchungen beenden konnten. Es war noch zu früh, die Gemeinde zu informieren.» Bodenmann wollte wissen, was genau die Experten untersuchten, und verlangte Einblick in ihre Untersuchungsberichte. Jean-Pierre Julen machte nur vage Andeutungen: «Unsere Experten vermuten, dass eventuell chemische Schadstoffe ins Grundwasser sickerten.» Mehr wollte er nicht verraten. Man müsse verhindern, die Bevölkerung unnötig zu beunruhigen, sagte er.

Dann schaltete sich Alfons Egger von der Lonza ein. Egger war langjähriger Vizedrektor und – bis zu seiner Pensionierung im Juni 1988 – auch Chef für Umweltschutz und Sicherheit. Egger nannte ein paar Zahlen und versicherte, die Lonza habe immer genau Buch geführt über die Abfälle, die auf der Deponie landeten. Er verstieg sich sogar zur Aussage, die Deponie stelle keine Gefahr dar. Egger wörtlich zu den Briger Stadträten: «Es handelt sich nicht um Gift, sondern um Produkte im Zersetzungsprozess; man kann nur von Verfaulen reden.»

Das war glatt gelogen. Egger kannte die Untersuchungsergebnisse. Und die waren alles andere als beruhigend. Im Gegenteil, sie dokumentierten eine gravierende Verschmutzung des Grundwassers.

Grundwasser massiv verschmutzt

Das Amt für Umweltschutz in Sitten hatte René Monod vom Hydrologischen Institut in Bulle mit einer Untersuchung beauftragt. Zuerst im Jahre 1972, dann erneut 1978. Der Auftrag: Monod sollte feststellen, welche Auswirkungen die Lonza-Deponie auf das Grundwasser in der Rhoneebene hat. Bereits 1972 stellte Monod geringfügige Verschmutzungen fest. Er fand leichte Konzentrationen von Chloriden, Spuren von Sulfaten, aber auch Ammonium, Nitrat, Nitrit usw.

Im Jahre 1978 wiederholte René Monod seine Untersuchung. Anfang Mai und Mitte November nahm er zwischen Visp und Gamsen diverse Grundwasserproben. Die Ergebnisse liessen keine Zweifel offen. Die Verschmutzung des Grundwassers hatte gewaltig zugenommen. René Monod in seinem Untersuchungsbericht: «Die erhobenen Daten (…) belegen eine schwerwiegende und massive Verschmutzung des Grundwassers in der Rottenebene.» Das Grundwasser war von einer Talseite zur anderen und mindestens bis 1,5 Kilometer unterhalb der Deponie verschmutzt. Monod empfahl weitere Studien. «Wenn keine Massnahmen ergriffen werden, ist zu befürchten, dass die Verschmutzung schlimmer wird und sich zudem weiter ausbreitet», so René Monod.

Ein Jahr später lieferte Monod einen weiteren Bericht. Auch die jüngsten Messergebnisse sprachen eine unmissverständliche Sprache. «Die Verschmutzung muss als sehr stark qualifiziert werden», schreibt Monod. Und: «Inzwischen hat sich die Verschmutzung bis unterhalb Lalden ausgedehnt; sie reicht über 2 Kilometer talabwärts.»

René Monod wies auch zweifelsfrei nach, woher die Verschmutzung stammte: aus der Lonza-Deponie.

Die Monod-Berichte blieben unter Verschluss. Selbst die Briger Gemeinderäte erhielten keinen Einblick. Überhaupt hatten sie grosse Mühe, sich ein Bild der Havarie-Deponie zu verschaffen. Und immer wieder gab es für sie Überraschungen. So stellte sich heraus: Die Lonza verfügte nicht einmal über eine gültige Baubewilligung. Dabei gab es die Deponie seit über 60 Jahren.

Deponie seit 1918 in Betrieb

Die ersten Projektpläne stammten aus dem Jahr 1917. Ein Jahr später wurde die Deponie in Betrieb genommen. Vorerst wurden fast ausschliesslich Kalkschlämme abgelagert. In den 1960er Jahren nahm die Lonza eine Benzinspaltanlage in Betrieb und stellte auf Petrochemie um. Mit einem Schlag änderte sich das Profil der Deponie, auf der jetzt zunehmend auch chemische Schadstoffe entsorgt wurden. Und die Deponie wuchs unaufhörlich, nahm schliesslich gigantische Ausmasse an. 1980 hatte sie sich auf rund 200’000 Quadratmeter ausgebreitet und wies ein Volumen von sage und schreibe 1,5 Mio. Kubikmeter auf, die Chemie- und Industrieabfälle türmten sich streckenweise 17 Meter hoch.

Für alle war klar, die Deponie musste saniert und die Verschmutzung des Grundwassers sofort gestoppt werden. Wegen ihrer gigantischen Grösse ein beinahe aussichtsloses Unterfangen. Die Projektierungsphase dauerte rund zehn Jahre.

Seit 1980 hatten Experten diverse Sanierungs-Methoden erarbeitet. 1988 entschied sich die Lonza schliesslich für ein hochkompliziertes, aufwendiges Verfahren, das den barbarischen Namen «Hydraulische Strategie» bekam. Hauptziel: Das verschmutzte Grundwasser der Deponie muss unter Kontrolle bleiben, damit es abgepumpt und entgiftet werden kann. Leichter gesagt als getan. Um das Schmutzwasser im Deponiebereich zu behalten, muss die Strömungsrichtung des Grundwassers geändert werden. Dazu werden, verteilt auf die ganze Deponie, rund ein Dutzend Brunnen und Pumpstationen installiert. Zuerst werden die Pumpen eingesetzt, um die Strömungsrichtung umzukehren und so zu verhindern, dass das schmutzige Grundwasser den Deponiebereich verlässt. Anschliessend wird mit einem weiteren Pump-Vorgang unter der Deponie das schmutzige Grundwasser eingesammelt. Dieses Schmutzwasser wird danach in der Fabrik Lonza und der Kläranlage Visp chemisch-biologisch behandelt, bevor es in die Rhone geleitet wird.

Die Sanierer sprachen auch von «Auswaschverfahren». Ihre Annahme: Durch sauberes Wasser, aber auch Regen- und Sickerwasser werde die Deponie im Verlaufe der Jahre langsam ausgewaschen. Mit anderen Worten, die Sanierer gingen davon aus, dass die Konzentrationen der Schadstoffe kontinuierlich abnehmen, bis sie schliesslich ganz verschwinden oder wenigstens umweltverträgliche Werte aufweisen werden.

Im Jahr 1988 gaben das Amt für Umweltschutz in Sitten und die Gemeinde Brig der Lonza grünes Licht für ihr Sanierungsprojekt.

Umweltverbände warnen

Einzig das Umweltsekretariat Oberwallis 1) hatte ernsthafte Bedenken. Es engagierte einen Gutachter. Die Wahl fiel auf den bekannten Zürcher Geologen und Sozialwissenschaftler Marcos Buser, einen erfahrenen Experten im Bereich Entsorgung chemotoxischer Sonderabfälle.

ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998.tif

Experte Buser erkannte gleich mehrere Schwachstellen des Sanierungsprojektes. Er kam zum Schluss: «Der Erfolg der anvisierten Sanierung ist ungewiss.» Trotz Sanierung bestehe die Möglichkeit, dass weiterhin Schadstoffe in den Rotten oder in das Grundwasser ausserhalb der Deponie entweichen, stellte Buser fest. Er erinnerte an den «ausgesprochen ungünstigen Standort der Deponie». Sie liegt nämlich in einem früheren Sumpf- und Schilfgebiet. Die Nase der Deponie schwimmt im Grundwasser. Die Schadstoffe stehen also direkt im Kontakt mit dem Grundwasser. Doch die tieferen Schichten des Grundwassers der Deponie werden von der Sanierung nicht erfasst. Nach Einschätzung des Experten Buser bestehe deshalb eine ständige Gefahr, dass aus den tieferen Schichten kontaminiertes Grundwasser ausströme.

Ein weiterer Schwachpunkt: «Umfang und Dauer sind nicht absehbar. Wie lange wird die Sanierung dauern: 10, 50 oder 100 Jahre?», fragte Experte Buser. Aber auf diese Frage gab es keine klare Antwort.

Lonza macht falsche Angaben

Was Experte Buser besonders störte: Die Lonza machte keine oder sogar unrichtige Angaben. Schon wieder. Buser: «Angaben über Abfallmengen sowie die Zusammensetzung sind spärlich. Ein Abfallinventar fehlt, ebenso Hinweise auf problematische Stoffgruppen (z.B. Aniline, Phenole).» Mit anderen Worten, die Lonza verschwieg – oder schlimmer noch – wusste nicht, was auf der Deponie lag.

1) Das Umweltsekretariat Oberwallis wurde von mehreren Umweltverbänden getragen, unter anderem von der Oberwalliser Gruppe für Umwelt und Verkehr (OGUV), Pro Natura und WWF.

*****************************************************************

  • 1. Teil: Der Fall Joël Rossier: Der Walliser Umwelt-Chef trat aus Protest zurück: Das Wallis sei nicht mehr in der Lage, das Umweltrecht korrekt anzuwenden.
  • Lesen Sie die Fortsetzung in den nächsten Tagen: «Der vertuschte Quecksilber-Skandal»

*****************************************************************

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Keine.

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

——————————————————————–

Grafikquelle         :

Oben          —       Visp seen from EXT 31161 from Brig to Burgdorf; in the foreground the Lonza premises.

———————————————-

Unten           —         ETH-BIB-Visp, Lonza AG-Inlandflüge-LBS MH03-0998

Abgelegt unter Europa, Positionen, Regierungs - Werte, Umwelt | Keine Kommentare »

Der Geist der Partisanen

Erstellt von DL-Redaktion am 29. November 2019

Die  Gründe für das Auseinanderfallen Jugoslawiens

File:Bundesarchiv Bild 101I-005-0032-11, Jugoslawien, Polizeieinsatz.jpg

Von Erich ­Rathfelder

Die wirklichen Gründe für das Auseinanderfallen Jugoslawiens sind vielfältig und komplex. Davon aber will Peter Handke nichts wissen.

er Kampf der jugoslawischen Partisanen gegen den Faschismus während des Zweiten Weltkriegs ist bis heute ein Leuchtturm in der Geschichte dieses Kontinents. Welcher Mut gehörte 1941 dazu, den bewaffneten Kampf gegen die deutschen und italienischen Besatzungsmächte und ihre Kollaborateure aufzunehmen! Hitler und Mussolini kontrollierten fast ganz Europa. Deutschland griff die Sowjetunion an. Ein kleiner Haufen von gerade einmal 20.000 kommunistischen Partisanen ohne nennenswerte Bewaffnung wagte ab dem 4. Juli 1941, sich dem zu widersetzen.

Sie kämpften nicht nur gegen die Wehrmacht, die SS und italienische Truppen, sondern auch gegen die Truppen des faschistischen und mörderischen Ustaschastaats in Kroatien, gegen das Nedić-Regime in Serbien und die nationalistischen serbischen Freischärler, die Tschetniks. Und sie gewannen. Nicht nur wegen der klugen militärischen Führung von Josip Broz, genannt Tito, der später Präsident werden und teils autoritär regieren sollte. Die Hauptwaffe der Partisanen war die Parole „Brüderlichkeit und Einheit“. Sie wandten sich gegen den Nationalismus und Faschismus aller Seiten. Aus allen Nationen Jugoslawiens strömten ihnen Kämpfer zu, vor allem, nachdem bekannt wurde, dass 1941 bis 1945 Zehntausende Juden und Roma in das berüchtigte Ustascha-Konzentrationslager Jasenovac gebracht worden waren – mehr als 80.000 Menschen wurden allein dort ermordet. In den Schlachten an der Neretva und in Sutjeska 1943 gelang es ihnen, sich aus der Umklammerung der weit überlegenen vereinigten Truppen aus Wehrmacht, Italienern, kroatischen Ustaschen und serbischen Tschetniks zu befreien. 1943 in Jajce, mitten im Krieg, erarbeiteten sie sogar eine Verfassung für Jugoslawien und auch für Bosnien und Herzegowina, in der die Gleichberechtigung aller Nationen und Bürger des Vielvölkerstaats versprochen wurde.

1945 wurde aus einem zerstörten Agrarstaat mit mehrheitlich Analphabeten binnen 20 Jahren ein moderner Industriestaat. Jugoslawien war unter Titos Führung ein Einparteienstaat, der sich jedoch im Lauf der Zeit liberalisierte. Mit der Arbeiterselbstverwaltung wurden Zeichen gegen den orthodoxen Kommunismus gesetzt. Bis Mitte der 1970er Jahre entstand ein Staat, in dem die Menschen ein Auskommen hatten, mit Schulen für alle, Universitäten, mit Renten und Krankenhäusern, mit dem damals besten Pass der Welt, die Jugoslawen konnten visafrei in den Westen und den Osten reisen. Die Schattenseiten waren Repressionen, derer sich Titos Regime bediente, so etwa im Konflikt mit der Studentenbewegung 1968, den Belgrader Liberalen und dem „Kroatischen Frühling“ 1971. In vielen Bereichen wurden „Brüderlichkeit und Einheit“ aber tatsächlich gelebt, vor allem in der multinationalen und multireligiösen Gesellschaft in Bosnien und Herzegowina.

Bijela, Montenegro - panoramio - ines lukic (8).jpg

Wenn der umstrittene Literaturnobelpreisträger Peter Handke von den Partisanen und diesem Jugoslawien fasziniert ist, dann steht er nicht allein. Die westliche Linke einschließlich der So­zial­demokraten schätzte Jugoslawien und Tito. Der Kampf gegen Faschismus und Nationalismus ist heute in ganz Europa wieder aktuell geworden. Auch in Ex-Jugoslawien selbst. Vor allem die serbischen Nationalisten – aber nicht nur sie – haben ab 1991 Jugoslawien zerstört. Umso unverständlicher ist es, dass sich Handke schon während des Krieges der 90er Jahre auf die Seite des serbischen Nationalismus stellte – und weiterhin stur daran festhält. Im Zeit-Interview in der vergangenen Woche wiederholte er nicht nur nationale Mythologien, sondern zudem die haltlose These, Jugoslawien sei durch die Anerkennung Kroatiens durch Deutschland zerstört worden. Dass Serbien Kroatien schon im Sommer 1991 angegriffen hatte, dass der Krieg also ein halbes Jahr vor der gemeinsamen Anerkennung durch die damaligen EG-Staaten begonnen hatte, ignoriert Handke. Wie auch die serbischen Verbrechen der ethnischen Säuberungen.

Quelle         :         TAZ          >>>>>           weiterlesen

—————————————————————–

Grafikquellen         :

Oben         —         Polizeieinsatz, Soldaten beim Durchsuchen einer Waldhütte

Date 1943

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 101I-005-0032-11 / CC-BY-SA 3.0

—————————–

Unten           —         Bijela, Montenegro  –  Erstellt: ‎7‎. ‎Juni‎ ‎2009

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung 3.0 nicht portiert“ lizenziert.
Namensnennung: ines lukic

Abgelegt unter Europa, Kriegspolitik, Mensch, Umwelt | Keine Kommentare »

Dorf Mühlrose geht unter

Erstellt von DL-Redaktion am 28. November 2019

Mühlrose soll der Braunkohle weichen

File:Wochožanska jama 2.jpg

Aus Mühlrose und Schleife Sabine Seifert

Mühlrose, ganz im Osten der Republik gelegen, soll weg, der Braunkohle wegen. Else und Günter Zech wollen nicht fort. Bei den Noacks war der Umzugs­wagen schon da. Wie sich eine Dorfgemeinschaft schon vor dem Verschwinden auflöst.

as Dorf hat eine Straße, die hinein- und wieder hinausführt: in die selbe Richtung, aus der man gekommen ist. Wer in die andere Richtung fährt, landet nach wenigen Metern im Tagebaugebiet Nochten, wo die Lausitz Energie Bergbau AG (LEAG) möglichst lange Braunkohle zu fördern hofft. Auch die 150 Millionen Tonnen, die unter Mühlrose liegen sollen, will sie noch erschließen. Es könnte das letzte Dorf der Lausitz sein, das den Kohlebaggern weichen muss.

Seit sechs Jahrzehnten knabbert die Kohle an Mühlrose. Das Dorf ist ein Sonderfall. Denn noch steht nicht fest, ob die Kohle überhaupt gebraucht wird und ob abgebaggert werden darf. Dennoch wurde im Frühjahr diesen Jahres ein Umsiedlungsvertrag für die Einwohner unterzeichnet. Ein Großteil möchte umsiedeln. Aber längst nicht alle. Die Dorfgemeinschaft ist gespalten, der Dorffrieden dahin. Die einen kämpfen für ihren Wegzug, die anderen für ihren Verbleib. Die einen sind lauter, die anderen hartnäckig. „Die Seele des Ortes geht verloren“, sagt die Pfarrerin.

200 Einwohner zählt Mühlrose heute, im ostsächsischen Landkreis Görlitz gelegen. Ein hübsches Dorf, umgebaute Drei- oder Viertseithöfe, die typisch sind für das einst sorbische Siedlungsgebiet. Landwirtschaft wird hier schon lange nicht mehr betrieben. „Wo ich geboren bin, das ist schon weggebaggert“, sagt Else Zech. Die 80-Jährige lebt heute nur ein paar Dorfstraßen weiter. Es ist das Elternhaus ihres Mannes Günter, in dem das Paar mit seinem erwachsenen Enkel unter einem Dach lebt.

Günter Zech, der am Silvestertag 81 Jahre alt werden wird, ist in diesem Haus geboren. Er hat ein gelbes X darauf angebracht, ein öffentliches Bekenntnis, dass seine Bewohner bleiben wollen, wie zu hören ist. Nur zwei Häuser im Ort zeigen dieses X, obwohl es acht Höfe sein sollen, die nicht umsiedeln wollen. Zech schätzt die Zahl der Bleibewilligen, der Verunsicherten und Zögernden auf insgesamt 20. „Die Leute sind verängstigt“, sagt er. „Viele trauen sich nicht, die Goschen aufzumachen.“ Im Fall einer späteren Enteignung könnten sie ja schlechter wegkommen. Davor hat er keine Angst – „die wollen doch was von mir“. Kaum einer im Dorf, der nicht jemanden in der Familie hat, der bei der LEAG arbeitet oder gearbeitet hat.

Günter Zech war nie im Tagebau, er fuhr Lastwagen, schon zu DDR-Zeiten. Else Zech hat als Verkäuferin gearbeitet. „Wir haben alles ertragen“, sagt sie. „Dreißig Jahre Kohledreck. Damals konnte man keine Wäsche aufhängen.“ Denn damals führte die Kohleverladebahn noch direkt am Dorf vorbei. Schmutz und Lärm stellen heute kein Problem mehr da, sagen die beiden. Günter und Else Zech, er in blauer Arbeitshose, sie im türkisfarbenen Haushaltskittel, haben im Vorraum des Hauses Platz genommen. Ein Wintergarten ohne Grün, hinter ihnen der orange Heizkessel, auf dem Tisch lehnt eine gerahmte Luftaufnahme von Mühlrose.

Er: „Niemand hat uns gefragt: Und wer will bleiben? Man hat uns mundtot gemacht.“ Sie: „Wir sind nicht einmal zum Reden gekommen.“ Er: „Ich habe nichts dagegen, wenn die, die wegziehen wollen, wegziehen. Dann kommt endlich wieder Ruhe ins Dorf. Aber warum soll man das hier aufgeben?“ Sie: „Wir waren nicht einmal im Urlaub, wir haben alles ins Haus gesteckt. Jetzt sind wir über 80 und haben nie die Welt gesehen.“

Es gibt Fotos vom Mühlroser Gasthof „Zur Erholung“, der nur noch zu besonderen Gelegenheiten öffnet. Der 28. März 2019 war so ein Tag, der Vorstandsvorsitzende der LEAG war da, die Bürgermeister von Trebendorf und Schleife kamen, sogar Sachsens Ministerpräsident Michael Kretschmer von der CDU. Der Umsiedlungsvertrag für Mühlrose wurde unterzeichnet, der Energiekonzern kommt für die Neuansiedlung der Haushalte im Nachbarort Schleife auf, wo am Ortsrand ein Areal für etwa 40 Grundstücke der Neu-Mühlroser erschlossen wird. Auch Einzelumsiedlungen oder ein Umzug in Mietwohnungen werden finanziert, ebenso wie die Umsetzung von Kriegerdenkmal, Glockenturm und Friedhof.

„Wer wohin kommt, das ist alles schon geregelt“, erklärt Enrico Kliemann. Der 44-Jährige ist kommissarischer Ortsvorsteher von Mühlrose, das seit 1999 zur Gemeinde Trebendorf gehört, und er ist Mitglied im Beirat für die Umsiedlung. Kliemann hat einen Raum im Vereinshaus aufgeschlossen, an den Wänden Skizzen von Neu-Mühlrose. Die Bestandsaufnahmen seien fast abgeschlossen. „Wie man’s hat, kriegt man’s wieder.“ Aus Alt wird Neu. Aus einem historischen Dorf eine Neubausiedlung auf dem flachen Acker.

Wie erklärt sich Kliemann, dass von ihm geschätzte 90 Prozent aus Mühlrose wegwollen, wo noch nichts endgültig klar ist? Jahrelang sei nichts investiert worden, sagt Kliemann, nicht bei der Stromversorgung, nicht beim Abwasser, und auch das Internet stagniert bei 2G. Manche Häuser im Dorf hätten Risse wegen der Grundwasserabsenkung durch den Tagebau. „Und selbst wenn das Sonderfeld nicht mehr genehmigt wird, ist Mühlrose von drei Seiten umschlossen.“

Unsicherheit und Verzögerung hätten vielen zugesetzt, da Mühlrose vor ein paar Jahren schon einmal umgesiedelt werden sollte. Damals kam der bereits ausgehandelte Vertrag nicht zustande, weil der schwedische Energiekonzern Vattenfall aus dem Energiegeschäft in der Lausitz ausstieg. Die Mühlroser hatten lange Zeit, sich an den Gedanken eines Umzugs zu gewöhnen. Und mancher mag auch geglaubt haben, dass er materiell etwas hinzugewinnt. Oder sich um Altlasten nicht mehr kümmern muss. „Neue Chancen“, formuliert Kliemann neutral, „die sich woanders auftun.“

Dataja:Mühlrose Tagebau Nochten Kraftwerk Boxberg 2008-05-11.jpg

Waldemar Locke ist der Mann, der am 28. März seine Unterschrift unter den Umsiedlungsvertrag gesetzt hat. Schweren Herzens, das ist selbst am Telefon noch zu hören. Ein Treffen klappt nicht, der Bürgermeister von Trebendorf und Mühlrose, 57 Jahre alt, CDU-Mitglied und seit zwei Jahren im Amt, ist unter der Woche berufstätig. Bei der LEAG. „Es handelt sich um einen rein privatrechtlichen Vertrag“, erklärt er. „Wer umsiedeln will, kann umsiedeln. Wer bleiben will, kann bleiben.“ Fünf Parteien sollen den Vertrag bisher unterschrieben haben. Was passiert mit deren Häusern? Die, so hatte es Kliemann erklärt, sollen bald abgerissen werden. Das Dorf würde also in sich zusammenfallen. Ein Tod auf Raten.

Der Bürgermeister hat Verständnis dafür, dass die Älteren im Dorf nicht entwurzelt werden wollen. „Günter Zech spricht für sich“, sagt er anerkennend, „nicht für das ganze Dorf. Ich akzeptiere nicht, wenn man sagt: Alle wollen umsiedeln. Jeder soll für sich sprechen.“ Locke sagt, seine Unterschrift unter den Vertrag habe er gesetzt, damit die Umzugswilligen „ihre Ruhe haben“.

Qielle        :         TAZ         >>>>>         weiterlesen

————————————————————————

Grafikquellen           :

Unten         —          Blick auf den Tagebau Nochten vom Aussichtsturm bei Weißwasser.

Author Julian Nyča      /       Source       :  Own work
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
No Facebook.svg This file has been released under a license which is incompatible with Facebook’s licensing terms. It is not permitted to upload this file to Facebook.

——————————–

Unten     —        Mühlrose in Sachsen: Blick vom Schutzdamm über einen ausgekohlten Bereich des Tagebaus Nochten zum Kraftwerk Boxberg mit dem Neubaublock R (links), dem Werk 4 (900 MW), dem Werk 3 in der Mitte (2×500 MW) und dem still gelegten alten Kraftwerksteilen (rechts).

žórło Swójske dźěło
awtor René Mettke
Tuta dataja je pod licencu Creative Commons Attribution 3.0 Unported licencowana

Abgelegt unter Regierung, Sachsen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Nach Jahr und Tag:

Erstellt von DL-Redaktion am 28. November 2019

’Die Gelbwesten’ und der kommende 5. 12. 2019

ManifGiletsJaunesVesoul 17nov2018 (cropped).jpg

Quelle        :         Scharf  —   Links

Von Dr. Nikolaus Götz

Es war im November 2018, dass urplötzlich ’Die Gelbwesten’ auf der politischen Bühne von Frankreich auftauchten und wie eine springflutähnliche Naturgewalt dieses Land in ihren Bann zogen. Die scheinbar aus dem Nichts kommende ’Bürgerwut’ gegen die als ungerecht empfundene Preisverteuerung des Mineralöls durch die französische Regierung unter Präsident Emmanuel Macron beschäftigte sofort die klassischen die Medien, und das Echo dieser neuen ’Französischen Revolution’, erst möglich durch das Kommunikationsmittel Internet, hallte in ganz Europa wider. Auch für Deutschland setzte eine direkte ’live’ Berichterstattung ein (siehe: scharf-links.de vom 19. 11. 2018). Die ’Revolte’ der dezentral auftretenden ’gilets jaunes’ gegen den ’Staat’ mit ihren im Verlauf eigentlich überwiegend friedlich geplanten Protesten wurde jedoch auf der Pariser ’Theaterbühne’ mit den brennenden ’Champs Elysées’ im Fernsehen fast als ’Sturm auf die Bastille’ präsentiert. Besonders die konservativen Manipulatoren vom ZDF lieferten dem deutschen Fernsehpublikum wieder ihr typisches Frankreichbild, wobei die wichtigste Frage der meisten Kommentatoren stets war: „Wie lange hält diese Bewegung ihren Protest durch?“ Spontan gab es Solidaritätsbekundungen für die ’Gilets’ auch aus Deutschland mit zahlreichen Kundgebungen in der selben gelben Autowarnweste, beispielsweise so in Berlin.

Jetzt aber, nach Jahr und Tag, sei deshalb ein kritischer Blick zurück gestattet, um der Frage nachzugehen, was diese französische Bürgerprotestbewegung gebracht hat, die nun ihren einjährigen Geburtstag feiert. Und prompt rufen die französischen Unzufriedenen, „diese Elenden“ des 21. Jahrhunderts (Vergleiche: Victor Hugo: Les Misérables) erneut für den kommenden 5. Dezember 2019 in ganz Frankreich zum Protest gegen die ungerechte Politik ihrer Regierung auf.

Zur ersten Forderung der ’Gelbwesten’ vom November 2018, nämlich einem sofortigen Preisstopp für Mineralölprodukte, kam, so sei im Rückblick erinnert, alsbald ein ganzer politischer Forderungskatalog hinzu (siehe: scharf-links.de vom 7. 12. 2018). Mit diesem Forderungskatalog sollte, jetzt schnell resümierend, generell die individuelle Kaufkraft aller Personen gestärkt, die Umwelt geschützt, die erlebte Polizeigewalt eingeschränkt, deren unrechtmäßigen Übergriffe bestraft und zudem ein direktes Bürgerbegehren eingeführt werden. Startschuss für diese Bürgerbewegung gab eine Petition von Priscillia Ludosky, die in den französischen ’Sozialen Netzen’ innerhalb von nur 12 Tagen 1 200 000 Unterschriften gesammelt hatte. Am 17. November 2018 protestierten sodann erstmalig runde 282 000 Franzosen in ganz Frankreich, womit diese Bürgerprotestbewegung die etablierte klassische Politikerkaste, und zwar alle politischen Partein, außen vor ließ. Auch deshalb sind ’Die Gelbwesten’ und ihr Protest eine Zäsur im politischen System von Frankreich.

Vornehmlich an einem zentral gelegenen Kreisverkehr der Hauptverkehrsachsen der Städte demonstrierten die Gelbwesten, um dort durch die so provozierten Verkehrstaus größtmögliche Medienattraktivität zu erzeugen. Diese Ziel wurde umgehend erreicht, zumal 84% aller Franzosen den politischen Forderungen der Gelbwesten zustimmten. Wendepunkt bei der Mobilisierung des ’Bürgerzornes’ waren jedoch die Großdemos von Paris, benannt als Akt 3 und Akt 4, bei denen es bedauerlicher Weise zu Gewalttätigkeit, mit Übergriffen und Geschäftsplünderungen kam, die den Gelbwesten angelastet wurden. Die mitfühlende ’Grande nation’ war sehr erschreckt besonders durch die „Entweihung“ des Pariser Triumpfbogens mit Sprüh-Graffiti. Die Konsequenz dieser Gewalteskalation durch die ’Casseurs’ (Schläger) wie die ’Agents provocateurs’ des Staates“ in den ’black blocs’ bei der übrigen, überwiegend friedlichen Gelbwesten war das sofortige Absinken der aktiven Teilnehmerzahl wie der gesamtfranzösischen Sympathiewerte auf im Dezember 2018 noch 47% und mit etwa 40 000 aktive Teilnehmer noch für Gesamtfrankreich. Auch jetzt, ein Jahr später, wurde die anfängliche Teilnehmerzahl nicht mehr erreicht und schrumpfte inzwischen auf runde 5000 zusammen, die ihre Protestfahne hochhalten.

Die französische Regierung unter Präsident Macron reagierte zunächst abwartend und zögerlich und dann ähnlich wie die „böse“ chinesischen Staatsmacht. Während die laufenden Proteste der Bürger in Hongkong den Deutschen als ’richtig’ verkauft werden, werden die Bürgerproteste der Franzosen eher als „unberechtigt“ präsentiert. Auch die französische Staatsgewalt unter Präsident Macron aktivierte den Repressionsapparat, natürlich in der üblichen Diktion der Herrschenden, „zum Schutz der Mehrzahl der friedlichen Bürger“. Zeitweise standen dabei den 125 000 Demonstranten 120 000 Polizisten gegenüber. “Gewalt“ ist stets negativ und entsprechend erschreckend sind die Zahlen der Toten (sic!), der Verletzten und der Bestrafungen von französischen Bürgern durch den ’richtenden’ Justizapparat, für sich das Gewaltmonopol beanspruchend. Auch aus Furcht vor Sanktionen sank die Unterstützerzahl bei den Protesten der ’gilets jaunes’ umgehend ab (siehe auch die Tabelle der Teilnehmer bei: www.WIKIPEDIA: Gelbwestenbewegung). Auf der Seite der Demonstranten gilt es heute, im November des Jahres 2019, 11 Tote zu beklagen (sic), darunter eine 63 Jahre alte Rentnerin. Weiter sind nach der offiziellen Statistik rund 2500 Verletzte zu nennen, wobei unter diesen 24 Personen das Augenlicht verloren und 5 Personen eine Hand. Aufgrund der Demonstrationen kam es zu 10 718 Verhaftungen und rund 2000 gerichtlichen Verurteilungen, wobei bei 40% der Abgeurteilten Gefängnisstrafen verhängt wurden (Siehe: www.cnews.france/france/). Ein anderes französisches Presseorgan spricht gar von 3000 Verhaftungen und 1/3 Gefängnisstrafen. (Siehe: www.bastamag.net/gilets-jaunes-champs-elysees-justice-repression-condamnations-violences -police-loi-anti-casseurs-prison) Der Blick auf eine Frankreichkarte mit dem Eintrag der Verurteilungen zeigt: ’Marianne’ hat echt stark die Masern, denn ihr Antlitz ist vollkommen übersät mit vielen eingetragenen knallroten Pusteln (Beleg: ebda.).

Doch auch bei den eingesetzten Kräften des Staates gab es Verletzte, wobei 1944 Polizisten oder Feuerwehrleute genannt werden. Die nachweisliche Eskalation von Gewalt, auch durch den eingesetzten Unterdrückungsapparat, wobei selbst der Einsatz von Militär diskutiert wurde, führte nicht nur zu einer Unzahl von Bürgerklagen gegen den Polizeiapparat, sondern auch zum Protest der französischen Künstlerelite gegen das vielfach unverhältnismäßige Vorgehen der Polizei (Siehe auch www. http://www.nousnesommespasdupes.fr/). Im Zentrum der Kritik an den Ordnungskräften des Staates durch die Gelbwesten stehen insbesondere die 13 905 LBD-Schüsse (Lanceur de balle de défence; LBD), die von Polizisten auf die Demonstranten abgefeuert wurden und die festgestellten, teilweise sehr schlimme Verletzungen verursachten.

GJ Paris (31102115797).jpg

Der durch die Blockaden und durch die Demonstrationen der Gelbwesten angerichtete wirtschaftliche Schaden für Frankreich addiert sich in Milliarden. So beispielsweise beziffert der französische Wirtschaftsminister Bruno Le Maire die Schadenssumme auf 4,5 Mrd. Euro oder 0,2% des Bruttoinlandproduktes (BIP). Ein Bericht für die ’Assemblée nationale’, das französische Parlament, schätzt, dass die Protestwelle der Gelbwesten die französische Nation im letzten Wirtschaftstrimester von 2018 immerhin 0,2 Wachstumspunkte gekostet hätte. Doch eine Analyse der französischen Wirtschaft aus Sicht von (deutschen) Wirtschaftsexperten bewertet, dass gerade die Plünderungen, Zerstörungen und der gezeigte Vandalismus durchaus positiv für das französische Wirtschaftssystem war! Die von den Versicherungsgesellschaften ausgeschütteten Entschädigungsmittel in Höhe von 217 Mill. Euro ebenso wie die erst durch die Krawalle durch die Regierung veranlassten Konjunkturhilfen in Form von Steuernachlässen und staatlichen Lohnzuschüssen an Geringverdiener von rund 10 Mrd. Euro haben nämlich durch „den erhöhten Binnenkonsum in Frankreich“ ein kleines Wirtschaftswunder bewirkt. Deutschland ist jetzt nicht mehr die „Wirtschaftslokomotive der EU“. Dies ist jetzt Frankreich! „Danke Gelbwesten!“, wünscht deshalb der ARD-Wirtschaftsexperte Notker Blechner mit seinen Kollegen von der Börse den demonstrierenden Franzosen und begründet so seinen Leitartikel: „Starke Konjunktur: Warum Frankreich Deutschland überholt hat.“ (Siehe: www.tagesschau.de/wirtschaft/boerse/frankreich-wirtschaft-103.html).

Und was hat der Protest der französischen Gelbwesten politisch bewirkt? Außenpolitisch sind es wieder die Franzosen, deren ewig streitenden Geist mit ihrer revolutionären Handlungskraft bewundernde Anerkennung widerfährt. Doch innenpolitisch wurden ’Die Gelbwesten’ im Protestjahr 2018 von dem jugendlich-dynamischen Ex-Banker und Staatspräsidenten Macron mit den ’Krümeln’ vom Tisch der Reichen wie Adligen abgespeist, so wie es das Französische Volk auch schon vor ihrer Revolution von 1789 erleiden musste. Immer noch ist das Renten- wie das Krankenversicherungsproblem ungelöst und die Unzufriedenheit wächst. Deshalb steht die ’Französische Nation’ jetzt erneut vor einem harten Sozialkonflikt (Siehe: www.france-info.com ) und auch die aktuelle Regierung Marcon weiß nicht, wie dieser angesetzte neue ’Tag der Revolution’ am 5. 12. 2019 enden wird.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————

Grafikquellen        :

Oben      —         Manifestation des Gilets Jaunes autour du rond-point de la Vaugine à Vesoul (Haute-Saône). La Nationale 19 est bloquée dans les deux sens.

———————————–

Unten       —          Les Champs-Élysées après la manif des Gilets Jaunes, le samedi 25 novembre 2018 entre 19 heures et 20 heures

Abgelegt unter Europa, Gewerkschaften, Schicksale, Sozialpolitik | Keine Kommentare »

Leichen im Keller

Erstellt von DL-Redaktion am 27. November 2019

(Teil 1): Der Fall Joël Rossier

File:Venzone Dom Friedhofskapelle Mumie 02.JPG

Quelle        :        INFOsperber CH. 

Von  Frank Garbely

Der Walliser Umwelt-Chef trat aus Protest zurück: Das Wallis sei nicht mehr in der Lage, das Umweltrecht korrekt anzuwenden.

Eigentlich war es ein überraschend optimistischer Brief, mit dem Joël Rossier (49) als Leiter der Dienststelle Umwelt des Kantons Wallis (DUW) am 17. Juni kündigte: «Es wird Zeit, dass ich mich wieder meiner ersten grossen Liebe, den Biowissenschaften, zuwende.» Man hätte vermuten können, da freue sich einer, weil er endlich seinen Traumjob gefunden hat.

Im August wollte Rossier seine ausstehenden Ferien einziehen und danach bis Ende Oktober nur noch 50 Prozent arbeiten. Am 1. August verabschiedete er sich, wie geplant, in die Ferien. Alles verlief in geordneten Bahnen, reine Routine, so wie es Beamte gerne mögen.

Doch nur einen Tag später, am 2. August, der grosse Knall: Rossier wurde freigestellt.

Vom Hof gejagt wie ein Hund

Rossier erhielt zehn Tage Zeit für eine Stellungnahme. Danach wurde die Freistellung definitiv. Damit war der Leiter der Dienststelle Umwelt ausgesperrt. Er hatte Büroverbot, musste seine Schlüssel abgeben; sein Badge wurde gelöscht und der Zugang zu Computer und Datenbanken gekappt.

Der rabiate Rauswurf liess nur einen Schluss zu: Rossier musste sich einen Riesenfehler, eine unverzeihliche Entgleisung geleistet haben.

Ein ehemaliger Staatsrat sagt: «Eine so radikale Massnahme wie gegen Rossier ergreift man höchstens, wenn ein Beamter einen grösseren Geldbetrag unterschlagen oder sich an einer Mitarbeiterin vergriffen hat».

Doch Dienstchef Rossier hatte weder die Staatskasse geplündert noch seine Sekretärin vergewaltigt, er hatte nicht einmal gegen die Hausordnung verstossen. Was war geschehen; warum wurde der Chefbeamte wie ein Hund vom Hof gejagt?

Am 3. Juli, nur wenige Tage nachdem der Staatsrat seinen Rücktritt angenommen hatte, alarmierte Rossier das Finanzinspektorat. «Der Chef der Dienststelle Umwelt ist nicht in der Lage, im Wallis das Umweltrecht korrekt anzuwenden; diese Erkenntnis ist der Grund meines Rücktrittes», schrieb Rossier. Immer wieder habe er die zuständigen Stellen im Departement auf die Schwierigkeiten mit Umweltdossiers aufmerksam gemacht: den Rechtsdienst, das Generalsekretariat und vor allem seinen Chef, den Departementsvorsteher Staatsrat Jacques Melly. Doch vergeblich, sowohl die mündlichen Berichte wie auch die schriftlichen Rapporte seien ohne Wirkung geblieben, kritisierte Rossier.

Im Schreiben an das Finanzinspektorat begründet Rossier seinen Rücktritt: «Der Chef der Dienststelle Umwelt ist nicht in der Lage, im Wallis das Umweltrecht korrekt anzuwenden; diese Erkenntnis ist der Grund meines Rücktrittes.» (Ausschnitt vergrössern)

Rossier verlangt Untersuchung

Das Finanzinspektorat ist nicht nur zuständig für die Finanzaufsicht; seiner Kontrolle unterliegen alle Departemente und Dienststellen. Kein Zufall, vielmehr ein völlig normaler Vorgang, dass sich Dienstchef Rossier an diese Aufsichts- und Kontrollbehörde wandte. Er verfolgte ein klares Ziel: Das Finanzinspektorat sollte eine Untersuchung einleiten und durchgreifen, damit das Umweltrecht auch im Wallis endlich korrekt durchgesetzt werde.

Rossier schickte dem Finanzinspektorat nicht weniger als 14 der unbeachteten Berichte. Total etwas mehr als 500 Seiten, die Infosperber vorliegen.

Im Begleitbrief, den Rossier zusammen mit 500 Seiten Dokumenten an das Finanzinspektorat schickte, listet er all die Berichte auf, die er seinem Vorgesetzten und diversen staatlichen Aufsichtsbehörden zugestellt hatte, auf die er aber nie eine Antwort erhalten hatte. (Ausschnitte vergrössert: hier und hier)

Joël Rossier wurde 2016 Leiter der Dienststelle Umwelt. Er war im besten Alter, 46, und wie geschaffen für diesen Job. Er hatte an der ETH Zürich Chemie studiert, sich danach auf Lebensmittelchemie und Umweltschutz spezialisiert. Und er hatte sogar Führungserfahrung, seit 2010 war er Stellvertreter des Kantonschemikers gewesen. Am 1. Dezember 2016 trat er die neue Stelle als DUW-Chef an. Nach nur knapp zweieinhalb Jahren warf er den Bettel hin.

Leichen im Keller

Bereits bei Amtsantritt machten ihn Mitarbeiter auf heikle unerledigte Dossiers aufmerksam. Schnell erkannte Rossier die Brisanz dieser unerledigten Fälle. Er informierte seinen Chef, Staatsrat Jacques Melly, und wies ihn auf die riskanten Leichen im Departements-Keller hin. «Peu à peu» geriet der neue DUW-Chef unter Druck. «Je mehr ich alte unerledigte Dossiers fand und diese meinen Vorgesetzten meldete, umso grösser wurde der Druck auf mich», schreibt Rossier in einem Bericht an das Finanzinspektorat.

Doch Rossier war jung, sportlich – er ist ein passionierter Bergsteiger und Kletterer – und voller Tatendrang. Er steckte den Druck weg und nahm die Herausforderung an, überzeugt, dass er sich schlussendlich durchsetzen werde. Er zählte auf seine Gipfelstürmerqualitäten. Doch im Departement Melly kam das gar nicht gut an. Joël Rossier stürzte ab. Aus eigenem Versagen? Oder war es Sabotage?

Es war Sabotage, sagt Rossier. Der Aktenberg, den er im Finanzinspektorat ablud, soll das beweisen.

«Der Druck auf mich nahm ständig zu. Ich war der ideale Sündenbock, der bei jedem Skandal den Kopf hinhalten sollte», schreibt Rossier. Staatsrat Jacques Melly lässt das nicht gelten: «Es wurde nie Druck gegen Herrn Rossier gemacht; er hat sich selbst unter Druck gesetzt.»

Krach mit dem Chef des Rechtsdienstes

Der wahre Grund für Rossiers Scheitern war aber nicht Staatsrat Melly, sondern die miserable Zusammenarbeit mit dem Rechtsdienst. «Schon als ich mein Amt als DUW-Chef antrat, haben sich meine Mitarbeiter über ihre Schwierigkeiten mit dem Rechtsdienst beklagt», schreibt Rossier. Die Dossiers blieben liegen, wochen-, monatelang. Zudem gab es unerledigte Dossiers von früher; Dossiers, die seit zwei, drei und sogar vier Jahren auf Bearbeitung warteten. Und mit Amtsantritt Rossiers wurde es nicht besser. Im Gegenteil. Jetzt verweigerte der Rechtsdienst beinahe systematisch juristische Beratung. Die forsche Gangart des ungeduldigen Gipfelstürmers Rossier stiess auf starken Widerstand. Fast machte es den Eindruck, als wollte der Rechtsdienst das ungezähmte Pferdchen Rossier zureiten und domestizieren.

Im Gegensatz zu anderen Departementen, wo jede Dienststelle über eigene Juristen und einen Rechtsdienst verfügt, wurde im Departement Melly der Rechtsdienst zentralisiert. Er gehört zur Dienststelle Verwaltungs- und Rechtsdienst. Und dort hat Adrian Zumstein das Sagen.

Nach einem Jahr Zoff mit Zumsteins Rechtsdienst hatte Rossier die Nase voll. Er verlangte eine Aussprache. Doch es kam zum Streit, dass die Fetzen flogen.

File:Messie Syndrom Arbeitszimmer 11.JPG

Es war am 22. Januar 2018, als sich Rossier und Zumstein zusammen mit ihren Mitarbeitern trafen, um ihre Differenzen zu bereinigen. Rossier ging die Sache frontal an. «Bei Routine-Dossiers klappt die Zusammenarbeit mit dem Rechtsdienst», sagte er, dann legte er den Finger auf die wunde Stelle, «bei komplexen Dossiers dagegen ist sie alles andere als optimal.» Ein Mitarbeiter des Rechtsdienstes gab enerviert zurück: «Es geht nicht an, dass die Dienststelle Rossier entscheidet, welches Dossier wir wann mit welcher Dringlichkeit zu behandeln haben.» So ging es lange hin und her. Schliesslich einigte man sich auf bessere Zusammenarbeit. Rossier wollte eben die Sitzung schliessen, da verlangte Adrian Zumstein das Wort. Er habe eine Beschwerde anzubringen, sagte er. Dann nahm er sich den jungen DUW-Chef Rossier zur Brust. Zumstein hatte eine endlose Klageliste vorbereitet. Für eine regelrechte Abrechnung.

Am Boden zerstört

Zumstein kanzelte Rossier ab wie einen ungezogenen Schuljungen, machte ihn so richtig zur Schnecke. Seit Rossiers Amtsantritt herrsche ein vergiftetes Arbeitsklima. Mitarbeiter im Rechtsdienst weigerten sich, für die Dienststelle Umwelt zu arbeiten, wegen Rossier. Rossier betreibe Mobbing. Rossier leiste sich sogar verbale Übergriffe … Ganze 45 Minuten lang prügelte Zumstein auf Rossier ein, liess keinen guten Faden an ihm.

Rossier wusste nicht, wie ihm geschah. «Ich war fassungslos, am Boden zerstört», schreibt er.

Nach ein paar Tagen, als er sich wieder gefasst hatte, forderte er Zumstein auf, die gegen ihn vorgebrachten Vorwürfe schriftlich zu bestätigen. Doch Zumstein weigerte sich. Niemand, der Zumstein kennt, wunderte das. Gegen Zumstein hatte Rossier nichts zu melden, die beiden boxen nicht in derselben Gewichtsklasse. Zumstein gilt als starke Persönlichkeit. Viele halten ihn sogar für die dominante Figur im Departement, selbst Staatsrat Melly tanze nach seiner Pfeife.

Staatsrat lässt kritische Dokumente vernichten

Aber Rossier liess nicht locker. Er verfasste ein Gedächtnisprotokoll der denkwürdigen Sitzung vom 22. Januar. Gleichzeitig dokumentierte er die miserable Zusammenarbeit mit dem Rechtsdienst. Die Unterlagen, die seine Aussagen belegten, füllten einen Bundesordner. Das Dossier übergab Rossier seinem Chef, Staatsrat Melly.

Die Antwort liess nicht lange auf sich warten. Rossier war sprachlos: «Am 6. Februar 2018 befahl mir Staatsrat Melly, den Bericht zu vernichten. Ich gehorchte.»

Staatsrat Melly bestätigt diese Aussage, stellt sie aber in ein völlig neues Licht. «Wir haben festgestellt, dass der Bericht von Rossier nicht den Tatsachen entspricht. In gegenseitigem Einvernehmen wurde beschlossen, den Rossier-Bericht nicht aufzubewahren.»

Von der Sitzung wurde kein Protokoll erstellt.

Für den zurechtgestutzten DUW-Chef begannen harte Zeiten. Etwas mehr als ein Jahr hielt er durch. Dann gab er auf. Bevor er seinen Rücktritt einreichte, erstellte er für das Finanzinspektorat umfangreiche Dossiers, um interne Untersuchungen gegen «Missstände im Departement Melly» anzustossen.

Politischer Sprengstoff

Diese Dossiers dokumentieren nicht nur den zum Teil hochnotpeinlichen Knatsch zwischen Rossier und Zumstein; da geht es nicht nur darum, wie Rossier und seine Dienststelle immer wieder an der Arbeit behindert wurden. Im Gegenteil – die Dossiers enthalten einigen Sprengstoff. Die Vorwürfe reichen von politischer Mauschelei bis zur Duldung systematischer Verletzung des Umweltrechts.

Zurzeit laufen gleich mehrere Abklärungen. Sowohl das Finanzinspektorat wie auch die Geschäftsprüfungskommission (GPK) haben eine Untersuchung angekündigt. Auch der Walliser «Datenschützer» Sébastien Fanti will sich vorrangig mit dem «Rossier-Dossier» befassen. Es trifft zwar zu: Rossiers Dossiers enthalten umfangreiche und erdrückende Beweise. Sie haben aus dem «Fall Rossier» längst einen «Fall Zumstein/Melly» gemacht. Trotzdem, für eine abschliessende Beurteilung wird man den Ausgang der laufenden Untersuchungen abwarten müssen.

*****************************************************************

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

——————————————————————–

Grafikqiellen     :

Oben           —         Mumie, ausgestellt im Keller der romanischen Friedhofskapelle St. Michele neben dem Dom Apostulus St. Andrea Venzone im Tagliamento-Tal in Friaul / Italien. In der in der ersten Hälfte des 12. Jhdt. erbauten Kapelle befinden sich mehrere Mumien, die nach dem Erdbeben von 1976 erhalten geblieben sind. Die Schädelknochen unter der eingetrockneten Haut sind gut erkennbar (Totenkopf). Das Bild zeigt Schulter und oberen Brustkorb.

Autore Joadl

Taken / scanned / uploaded by Joadl | Gallery | Gallery old If you use this photograph outside Wikimedia, I would highly appreciate if you let me know by email or on my talk page, as I’m curious where my work is used. Please choose a Free license to abide by. If you would like to use this image in a way which is incompatible with the given Free licenses (de: Freie Inhalte), please contact me.

Questo file è licenziato in base ai termini delle licenze Creative Commons Attribuzione-Condividi allo stesso modo 3.0 Unported, 2.5 Generico, 2.0 Generico e 1.0 Generico

——————————

Unten      —          Arbeitszimmer einer Messies

Author tabaluga

GNU General Public License

Abgelegt unter Europa, Kriegspolitik, Regierung, Schicksale | Keine Kommentare »

Bolivien: Die Bergbaunation

Erstellt von DL-Redaktion am 26. November 2019

Demokratie und Bodenschätze

20170812 Bolivia 1772 La Paz sRGB (37926540966).jpg

Quelle       :     untergrund-blättle CH.

Amelie Lanier

Wenn man die Geschichte Boliviens nach denjenigen Produkten einteilen wollte, die nach Eduardo Galeano „die Armut des Menschen als Ergebnis des Reichtums der Erde“ verursachen, so kann man dafür die Perioden des Silbers, des Zinns und die der Energieträger Erdöl und Erdgas ansetzen. In Zukunft vielleicht die des Lithiums. An diesen Bodenschätzen entlang entwickelte sich das heutige Bolivien.

Das Silber von Potosí bestimmte die spanische Kolonialzeit, und prägte das damalige Gebiet des heutigen Bolivien insofern, als sich die ganze Organisation der Gesellschaft unter den spanischen Behörden um das Funktionieren dieses Bergwerks und den Abtransport des dort gewonnenen Silbers drehte. Die Landwirtschaft, das Transportwesen und das gesamte gesellschaftliche Leben wurden dem untergeordnet. Die Eingeborenen des Hochlandes wurden versklavt und in den Minen vernutzt. Die spanischen Kolonialherren bedienten sich dafür einer Institution, die die Inkas eingeführt hatten, um in gemeinschaftlicher Arbeit Strassen und Kanäle zu bauen.

Als die einheimische Bevölkerung aufgrund der für sie viel zu schweren Arbeit gehörig dezimiert war, wurden sie durch schwarze Sklaven ergänzt, vor allem aus dem Gebiet der heutigen Guineas. Der „Reiche Hügel“ von Potosí befindet sich nämlich noch dazu auf einer Höhe von über 4000 Meter, wo der Sauerstoffmangel im Zusammenhang mit schwerer Arbeit sehr verkürzend auf das Leben der Arbeitenden wirkt.

Auch die Arbeit in der 1572 in Potosí gegründeten Münzprägeanstalt, die das ganze spanische Kolonialreich mit Silbermünzen versorgte, wurde von Sklaven geleistet. Nach dem Niedergang der Silberproduktion blieb die Münzprägeanstalt weiterhin einer der wichtigsten Wirtschaftsfaktoren des Kolonialreichs. Obwohl auch anderswo solche Häuser bestanden, war die Münze von Potosí mit Abstand die grösste, mit dem grössten Ausstoss an Münzen, weil sie eben an der Quelle stand. Sie war eine wichtige Beute der Unabhängigkeitskriege im 19. Jahrhundert, teilweise wurden die Prägestöcke abmontiert und woanders in Betrieb genommen.

Noch heute sagt man auf Spanisch, wenn man irgendwo eine wirkliche oder vermeintliche Goldgrube entdeckt zu haben scheint: „Es ist ein Potosí wert!“

Das Silber von Potosí war also nicht nur eine Ware wie andere Produkte des Kolonialreichs, wie Zuckerrohr oder Kakao, sondern eine der Grundlagen, mit der das Kolonialreich verwaltet und die Kolonialherrschaft finanziert wurde. Es trug dazu bei, dass Spanien bis zum Schluss den Silberstandard verwendete und der auf Gold beruhende Escudo eine untergeordnete Rolle gegenüber der Silbermünze Real spielte.

Die regionale und überregionale Bedeutung der Silberminen schlug sich jedenfalls nicht in irgendeiner Art von Wohlstand für die Eingeborenen – und der schwarzen, hmmm, Zwangseingeführten – nieder, und darin gleicht die Silber-Periode den nachfolgenden Perioden.

Die Epoche des Zinns, die MNR und die „Revolution“ von 1952

Das Silber verlor im Laufe des 19. Jahrhunderts aus verschiedenen Gründen an Bedeutung und ausserdem waren auch im „Reichen Hügel“ langsam einmal die Vorkommen erschöpft.

Aber das Zinn löste als Geissel der Vielen und Reichtum der Wenigen das Silber gegen Ende des 19. Jahrhunderts ab. Auch heute noch ist Bolivien der 5-tgrösste Zinnproduzent der Welt.

Dazu trug auch der von Bolivien 1884 verlorene Pazifik- oder Salpeterkrieg bei, der Bolivien nicht nur seinen Teil am Salpetergeschäft kostete, sondern auch seinen Zugang zum Meer und damit den Abtransport seiner Bergbauprodukte erschwerte und verteuerte.

Die Bedeutung des Zinns für verschiedene Legierungen in der Industrie und im Maschinenbau war im Laufe des 19. Jahrhunderts gestiegen. Vor allem der Vormarsch der Konservendose erhöhte den Bedarf nach Zinn. Heute ist es zusätzlich für die Glasherstellung unverzichtbar.

So gelang es einem findigen bolivianischen Unternehmer, über Zinnfunde und den Ausbau des Zinnbergbaus zu einem der grössten Zinnhersteller der Welt zu werden. Er erhielt auch Rückendeckung der bolivianischen Eliten, weil es ihm gelang, das chilenische Kapital aus dem bolivianischen Bergbau zu verdrängen.

Patiño war also sozusagen der erste „Nationalisierer“ des Bergbaus. Die Regierung von Paz Estenssoro und die von ihm gegründeten MNR – Revolutionäre Nationalbewegung – verstaatlichte dann 1952 nicht nur die Patiño-Zinnminen, sondern die ganzen damaligen Bergbaubetriebe Boliviens.

Comcipo-Protesta en LaPaz.jpg

Sie kann als ein direkter Vorläufer der MAS von Evo Morales betrachtet werden: Es war eine Regierung und Partei, die die Bodenschätze des Landes verstaatlichen wollte, mit der Absicht, einmal auch diejenigen am stofflichen Reichtum des Landes zu beteiligen, die ihn aus dem Inneren der Erde herausgeholt hatten. Diese Verstaatlichung und die damit einhergehende Absicht der Umverteilung war das, was sie als „Revolution“ bezeichneten.

Damit machten sich die Verstaatlicher nicht nur Freunde im In- und Ausland.

Das eigentliche Problem der MNR-Regierung war aber, dass die Bergleute Boliviens sich von dieser Verstaatlichung eine Verbesserung ihrer Lage erwarteten, die mit den Anforderungen des Weltmarktes in Widerspruch stand. Die bolivianische Regierung wollte durch den Export der verschiedenen Metalle (ausser Zinn und Silber auch noch Wolfram, Zink, Kupfer usw.) Devisen auf dem Weltmarkt erlösen, um damit verschiedene gute Taten, aber auch Investitionen in den Bergbau zu finanzieren.

Um an diese Devisen kommen zu können, hätten die Bergleute genauso weiter schuften müssen wie bisher, zu Hungerlöhnen und unter gesundheitsschädlichen Bedingungen. Letztere knüpften aber an die Verstaatlichung die Forderung, dass es ihnen jetzt besser gehen sollte, und so führte diese zu einer Serie von Streiks, dem Rückgang der Produktion und einer daraus folgenden Ebbe in der Staatskasse, was dann schliesslich der Grund für den Militärputsch von 1964 war. Der Gewaltapparat selber stiess nämlich an die Grenzen seiner Finanzierung.

Dieser Zyklus holt früher oder später alle ein, die die nationalen Reichtümer in Staatshand zentralisieren, auf dem Weltmarkt verscherbeln, und die Gewinne dann mit der Giesskanne über die Bevölkerung ausschütten wollen. Die Sache geht spätestens dann schief, wenn die Weltmarktpreise für diese national hergestellten Produkte fallen, und sich die Rechnung Einnahmen => Staatsnotwendigkeiten + Investitionen + Versorgungsleistungen nicht mehr ausgeht.

Statt Staat privat!

Auf den Sturz der Regierung von Paz Estenssoro folgten Militärregierungen, oftmals sehr kurzlebig, und Zivilregierungen, während sich das Missverhältnis von Einnahmen und Ausgaben weiterhin reproduzierte. Solange, bis mit Hilfe von IWF und Weltbank die Reprivatisierung als Allheilmittel entdeckt wurde.

Um die Sache ganz gut zu machen, wurde zusätzlich zu auch noch das Wasser als Ressource entdeckt, mit der sich gut Geld machen liesse – zum Wohle der Allgemeinheit, selbstverständlich.

(Das Inka-Reich entstand und hielt sich deshalb, weil es die Kriege auf dem Andenhochland um das Wasser beendete und eine zentrale und effiziente Verwaltung des Wassers schuf. Dergleichen ist in Bolivien bis heute nicht gelungen.)

Das bescherte Bolivien im Jahr 2000 ff. den Wasserkrieg, wo die Bevölkerung von Cochabamba die Rücknahme der Wasserprivatisierung und des Wassergesetzes erzwang. Damals schloss sich Evo Morales als Vertreter der Coca-Bauern diesen Forderungen an – mehr oder weniger: Wasser für alle, Coca für alle – und begann seine politische Karriere.

Die Energieträger

Genauso wie mit den Bergbauprodukten ist in Bolivien das Interesse, die Energieträger aus Kohlenwasserstoffen – die seit Anfang des 20. Jahrhunderts in Bolivien untersucht und abgebaut worden waren – zu verstaatlichen, nicht neu. Bereits in den 30-er Jahren ging das ein Präsident an, ganz ohne soziales Engagement, sondern einfach, um diesen strategischen Rohstoff im Sinne von Militär und Staatskasse durch staatlich kontrollierte einheimische Firmen zu fördern. Damals wurde die US-Firma Standard Oil hinauskomplimentiert.

Damals bereits stellte sich aber heraus, dass ohne ausländisches Kapital weder die nötigen Prospektierungen noch die Förderung, noch die Raffinierung angegangen werden konnten. Dazu kam der erbärmliche Zustand aller Transportverbindungen. Eine aus den USA während des II. Weltkriegs zwecks Kooperation nach Bolivien geschickte Expertendelegation empfahl unter anderem, vielleicht einmal die wichtigsten Strassen zu asphaltieren.

Choqueyapu 022.jpg

Und so ging die gleiche Angelegenheit wieder los: Ohne ausländisches Kapital gibt es keinen Zugriff auf die nationalen Reichtümer. Ist es einmal da, hat investiert und sich breit gemacht, so will es eben auch möglichst viel Gewinn einstreifen und ihn nicht am Ende mit gierigen bolivianischen Steuerbehörden teilen.

Nach der Verstaatlichung und der Gründung der staatlichen Ölfirma YPFB dümpelte sie eine Zeitlang vor sich hin, bis sie die Regierung Paz Estenssoro als Finanzierungsquelle für die inzwischen verstaatlichte (sonstige) Bergbauindustrie entdeckte. Der Verkauf von Schürfrechten für Öl sollte das Geld in die Staatskasse bringen, das dort für die Entwicklung des Zinn-, Silber- und Sonstwas-Bergbaus nötig war. Und so wurden Konzessionen für 40 Jahre vergeben, bis in die 90-er Jahre also.

Die Ölfirma, die sich an die Bohrarbeit machte, entdeckte Erdgas – für das sie gar keine Konzession hatte, weil daran gar nicht gedacht worden war. Die US-Firma Gulf Oil Company bot an, der bolivianischen Industrie Erdgas kostenlos zu liefern, wenn sie nur mit dem Rest machen könne, was sie wolle.

Man muss hier erwähnen, dass sich der Gasmarkt in den späten 50-er Jahren erst entwickelte. Bisher hatte man das überschüssige Gas meistens abgefackelt. Sowohl bezüglich der Verwendungsmöglichkeiten als auch des Transportes und der Förderkosten war alles neu, was der Ölfirma sehr freie Hand bei der Festsetzung der Preise liess.

Als die bolivianische Regierung 1969 die Verträge mit der Gulf Oil Company kündigte, mit Berufung auf neue Bedingungen, und die Energieträger wieder verstaatlichte, verhängten die USA ein Embargo über bolivianisches Erdöl und seine Derivate. (Kennen wir das nicht von irgendwo?)

Nach dem Putsch von Hugo Banzer 1971 wurden die Karten wieder neu aufgemischt. Die staatliche bolivianische Firma YPFB blieb bestehen, aber als eine Art leere Hülse, die Betrieb und Prospektion an Vertragspartner verpachtete. Dem legte die zivile Regierung Paz Zamora 1990 noch ein Schäuferl dazu, indem sie Gewinn-Garantien gab, um Investoren in diesen Sektor anzuziehen.

Dann wurden noch Joint Ventures genehmigt, und so um das Millenium herum war auf einer viel höheren Stufenleiter die gleiche Situation da wie früher einmal beim Bergbau: Es war klar, dass Bolivien grosse Reserven an Öl und Gas hatte, sie wurden auf dem Weltmarkt auch nachgefragt, aber private ausländische (USA & Argentinien) Firmen hatten die Hand drauf und die Gewinne flossen grösstenteils in ihre Taschen.

Neue Steuern sowie Gerüchte über geplante Exporte von Öl und Gas ins Ausland waren schliesslich der Grund, warum der Volkszorn sich in Aufständen entlud. Nachdem der damalige Präsident Schiessbefehl gegeben hatte, mit dem Ergebnis von 70 Todesopfern, war er genötigt, ins Ausland zu fliehen. Dort sitzt er bis heute.

Sein Nachfolger setzte zur Beruhigung der Gemüter ein Referendum über die Verstaatlichung der Energieträger an, das mit grosser Mehrheit für dieselbige stimmte. Als das Parlament versuchte, diese zu verwässern, musste wieder einmal gewählt werden, und so erstarkte auch die Partei von Evo Morales (MAS), mit dem Versprechen der Verstaatlichung der Energieträger, die mit Mehrheit im bolivianischen als Gesetz beschlossen wurde. Damals wurde auch festgelegt, dass zwischen Abgaben und Steuern 50% der Wertschöpfung in die Staatskasse fliessen müssen.

Die Verstaatlichung geschah übrigens durch Aktienkäufe, nicht durch Enteignung, da es dafür gar keine gesetzlichen Grundlagen in Bolivien gibt. Sie liessen sich im Parlament nicht durchsetzen. Mit den Einnahmen aus den Energieträgern wurde tatsächlich in Bolivien einiges in Bildung, Gesundheit und Infrastruktur investiert. Die Giesskanne funktionierte. Das gestehen der bolivianischen Regierung auch ihre Gegner zu.

Das Problem liegt auf der anderen Seite, bei den Einkünften.

Es wurden nicht alle Öl- und Gasfelder verstaatlicht, da der Staat gar nicht das nötige Kapital hätte, um sie alle zu erschliessen und zu betreiben. Ähnliches gilt für die Raffinerien. Die Verträge wurden neu verhandelt, und eben um die staatliche Entnahme für soziale Zwecke nicht zu gefährden, wurde kein Prozentsatz für Investitionen hineingeschrieben. Das heisst, weder die privaten noch sie staatlichen Firmen investierten viel, und die Produktion und vor allem die Raffinerieleistung ging zurück. Das wiederum heisst, dass Bolivien teilweise Treibstoff zu Weltmarktpreisen importieren muss – während es seine Rohprodukte aus Mangel an Transportmöglichkeiten (Pipelines, Flüssiggas-Terminals, Hafenanlagen) unter dem Weltmarktpreis verkaufen muss.

2005 standen Öl- und Gaspreise ungefähr so hoch wie heute, nach einigen Höhenflügen und Einbrüchen. Dennoch hat sich aus den oben genannten Gründen die Ratio zwischen Einnahmen und Ausgaben für Energieträger seither verschlechtert.

Der Agrarsektor und Evo Morales

Der Agrarsektor stand in Bolivien aufgrund der Wichtigkeit der Bergbauprodukte immer im Hintergrund. Der Hunger und die Unterernährung gehören zur Folklore Boliviens. Auf dem für intensive Produktion ungeeigneten Hochland quälen sich die Eingeborenen mit Trockenheit und Kälte herum, in den Niederungen haben sich teilweise Grossgrundbesitzer breit gemacht. Bolivien verfügt aber wie viele andere Länder Lateinamerikas auch über Dschungel: Unbebaute Flächen, wo vielleicht noch irgendwelche traditionell lebenden Eingeborenen hausen, und deren Besitzverhältnisse nicht ganz geklärt sind. Und diese Gebiete bieten sich an, wenn andere Einkommensquellen versagen, so auch heute.

Morales und seine Familie zogen als Kolonisten in den Dschungel und machten dort Flächen urbar, weil sie auf dem Hochland aufgrund von Missernten und Frost nicht mehr überleben konnten Und sie widmeten sich – neben anderen Pflanzen – dem Anbau von Coca.

Die Cocapflanze ist ein traditionelles Grundnahrungsmittel des Andenhochlandes, wo vieles an Nährstoffen und Vitaminen drin ist, das sich die armen Leute, also die Mehrheit der Bevölkerung der Anden, auf andere Weise gar nicht besorgen könnten. Ausserdem hilft es, die grosse Höhe zu ertragen und dennoch schwer arbeiten zu können. Ohne das Coca hätte die Silberproduktion von Potosí gar nicht funktionieren können. Schon die spanischen Kolonialbehörden sorgten deshalb dafür, dass es die Arbeiter der Bergwerke in ausreichender Menge erhielten. Es stellte sie aufgrund der beruhigenden und gleichzeitig anregenden Wirkung nämlich auch ruhig. Erst recht wurden sie von moderneren Bergbaufirmen dazu angehalten, ordentlich Coca zu konsumieren, um sich für die Anforderungen des Kapitals fit zu halten.

Ausserdem hielt es die Ureinwohner seit jeher bei ihren Festen bei Stimmung, im Zusammenhang mit Tanz und Gesang, so wie bei uns der Alkohol.

Das Mitte des 19. Jahrhunderts erstmals erzeugte Derivat Kokain wurde als Anästhetikum und Droge für psychische Erkrankungen eingesetzt, und wird in der Medizin teilweise heute noch verwendet, während sein Konsum und Besitz in den meisten Ländern der Welt heute strafbar ist.

Die bolivianischen Bauern, die das Coca anbauten, gerieten dadurch in den 80-er Jahren zwischen 2 Feuer. Einerseits war das Zeug für die Bolivianer bitter notwendig, andererseits fragten es die kolumbianischen Drogenbarone als Rohstoff für Kokain nach – dual use, ideal für den Produzenten – und drittens versuchte die exterritorial agierende US-Drogenbehörde DEA, den Anbau zu verhindern und die Pflanzungen zu zerstören.

In diesem Hin und Her wuchs Evo Morales in Verteidigung der angestammten Traditionen der bolivianischen Bevölkerung zu einer kämpferischen Autorität heran und griff nach den Sternen des höchsten Amtes im Staat.

Er machte sich also erstens durch die als Aktienkauf betriebene Rückholung der Bodenschätze in bolivianischen Staatsbesitz bei den USA unbeliebt. (Es waren vor allem US-Unternehmen, deren Beteiligung hier reduziert wurde.) Zweitens durch Festhalten daran, dass die Bolivianer zu entscheiden hätten, was in Bolivien angebaut wird.

Der „Regionalismo“ und die Provinz Santa Cruz

Die Stadt, die irreführenderweise „Santa Cruz im Gebirge“ heisst – sie liegt in der Ebene – war lange eine Art vergessene Ecke Boliviens, ohne Bodenschätze und Bergwerke, und wegen der fehlenden Strassen auch ohne Handelsverbindungen. Die Strasse des Silbers führte über das heutige Argentinien, rund um Santa Cruz war nichts ausser Urwald und Sümpfen. Die paar Grundherren und sonstigen Notabeln des Ortes versauerten hinter den 7 Bergen und konnten nicht einmal ihre landwirtschaftlichen Produkte in die in der näheren Umgebung ohnehin recht bescheidenen Metropolen transportieren, um irgendwelche kleineren Luxusgüter für sich einzukaufen. Auch ihr Lobbyismus für eine Eisenbahnlinie verhallte in Sucre und La Paz lange ungehört, weil einfach kein Geld dafür da war und auch kein ausländisches Kapital in diese Gegend investieren wollte.

Das änderte sich, als um die Wende zum 20. Jahrhundert in der Provinz Öl entdeckt wurde. Auf einmal kamen Fremde hierher, Kapital, bald eine Strasse, schliesslich gab es sogar einen Krieg wegen der Transportwege nach Süden, und Santa Cruz stieg zur wohlhabendsten Stadt Boliviens auf. Es stellte schliesslich auch einen Präsidenten, den Diktator Hugo Banzer, der ein weiteres dazu beitrug, Santa Cruz Privilegien aller Art zuzuschanzen.

Hier in Santa Cruz machte sich Morales unbeliebt, weil mit seinem Amtsantritt das Gerangel losging, wem eigentlich die Einnahmen aus den so umstrittenen Energieträgern zustanden? Den regionalen Institutionen oder dem zentralen Budget? Das Ganze wurde von den international gut vernetzten Lokalpolitikern von Santa Cruz und deren medialen Sprachrohren mit schönen Titeln über „rückschrittliche“, Koka kauende Indianer, die nicht wirtschaften können, und „fortschrittliche“, mit dem Finanzkapital der Welt verschwägerte und moderne Glaspaläste errichtende lokale Unternehmer ausgetragen. Und ebenso mit Zentralismus gegen Föderalismus, „Selbstbestimmung“, usw.

Hier, in dieser Gegend hat Morales besonders wenig Freunde unter den Besitzenden, aber viele unter den Blossfüssigen – die wiederum von der Mittelklasse aufwärts nicht wohlgelitten sind, und die viele Santacruzeños gerne von dort vertreiben möchten.

Das Militär

war zwar lange unterversorgt und entsprechend schwach, aber spielt in Bolivien eine doppelt wichtige Rolle. Natürlich muss es die Einheit nach innen wahren und hin und wieder aufständische Bergarbeiter, Bauern oder Bewohner von El Alto, der Zwillingsstadt von La Paz, niederhalten, notfalls auch mit scharfer Munition und mit Toten.

Aber Bolivien hat seit seiner Unabhängigkeit mehrere Kriege geführt und sie allesamt verloren. Das Territorium dieses Staates ist deshalb geschrumpft, es verlor den Zugang zum Meer, die Salpetervorkommen und den Hafen von Antofagasta im Pazifikkrieg, in anderen Kriegen Teile Amazoniens und des Chaco. Jeder Nachbarstaat hat sich ein Stück von Bolivien genommen. Die nationale Schmach sitzt bei den Bolivianern tief und das Militär wird deswegen doch auf eine widersprüchliche Art akzeptiert und verehrt, als Bollwerk gegen äussere Feinde und letzten Garant für die nationale Selbstbehauptung.

Das war auch der Grund, warum die kämpferischen Gewerkschaften die Militärdiktaturen eine Zeitlang geduldet haben.

Die Demokratie, die Verfassung und der Putsch

Als Evo Morales seine erste Wahl gewann, ging er in den Präsidentenpalast und schaute sein zukünftiges Büro an. Er fand, dass das Büro daneben vom CIA benutzt wurde. Seine Vorgänger, sicher jedenfalls „Goni“, fragten bei jeder Entscheidung nach, ob das den USA ohnehin recht wäre. Morales forderte die US-Botschaft auf, das Büro zu räumen – was auch geschah. Er machte sich auch hiermit unbeliebt.

Er war 14 Jahre an der Macht, aber vorher schon sehr präsent in der bolivianischen Politik, spätestens seit dem Wasserkrieg. Er sah sich als eine Art Landesvater, ohne den gar nichts geht. Deswegen sah er in der Amtszeitbeschränkung einen Verstoss gegen seine ureigensten Rechte als Führer. Und er setzte diese Amtszeitbeschränkung ausser Kraft, indem er erst ein Referendum ansetzte, in dem sein Anliegen mit knapper Mehrheit, aber doch zurückgewiesen wurde. Dann liess er sich vom Obersten Gerichtshof bestätigen, dass damit gegen sein Menschenrecht auf praktisch unbeschränktes Regieren verstossen würde. Und ging mit Schwung daran, sich wiederwählen zu lassen.

Er hat da etwas über die Demokratie nicht ganz verstanden, oder sie zumindest zu eigenwillig interpretiert. Die Demokratie samt ihrem Procedere besteht nämlich nicht nur darin, dass sich die Regierenden wählen und dadurch in ihrer Machtausübung bestätigen lassen müssen.

File:La Paz, Teleferico- Linea Amarilla.JPG

Es geht auch darum, dass die Kontinuität der Macht über den Wechsel der sie ausübenden Figuren bewerkstelligt wird. Damit ist klar, dass die abstrakten Prinzipien von Freiheit und Gleichheit – Freiheit des Eigentums und Gleichheit vor dem Gesetz, also Unterordnung unter das Gewaltmonopol – unabhängig von den jeweiligen Vollstreckern dieser Prinzipien gelten sollen. Deshalb gibt es in allen demokratischen Verfassungen diese Beschränkung, meistens auf zwei Amtsperioden, die z.B. in den USA nach dem Ableben von FD Roosevelt eingeführt wurde, damit so etwas wie seine 4-malige Wiederwahl nicht mehr vorkommt.

Eine ständige und womöglich erbliche Herrschaftsausübung, wie sie Monarchen oder Diktatoren treiben, verbieten die Grossmächte, die allen Staaten Demokratie vorschreiben wollen, und sind entsprechend sauer, wenn sich andere Staaten darüber hinwegsetzen. In Bolivien wird so etwas nicht geduldet.

Nach einigen Fehlschlägen in Sachen Regime Change wurde jetzt sehr vorsichtig vorgegangen. Auf das Referendum, den Gerichtsbeschluss und die Ankündigung der Wiederwahl folgten keine Donnerwetter aus Washington, Brüssel und ähnlichen Metropolen der Meinungsbildung. Es wurden keine Medienkampagnen gegen den „Diktator“ angezettelt. Sein Wahlkampf wurde beinahe wohlwollend kommentiert. Aber irgendwer sorgte dafür, dass alle wichtigen Institutionen wussten, was sie zu tun hatten. Dass nämlich Militär, Polizei, Gewerkschaftsführung, Santa Cruz-Politiker usw. an einem Strang ziehen, Kasperln mit Bibeln in der Hand auftauchen; dass plötzlich als Bauern verkleidete Oppositionelle oder „einfache Leute aus dem Volk“ vor laufenden Kameras Wahllokale stürmen usw. – das weist schon auf eine sehr weit gediehene Koordination hin, ebenso wie der Umstand, dass es Morales fast nicht gelang, das Land zu verlassen.

Evo Morales konnte sich deswegen so lange halten, weil er viele Gegensätze im Land ein Stück weit schlichten konnte und das Vertrauen der Volksmassen hatte. Es wird nicht möglich sein, ihn durch eine ähnlich integrative Figur zu ersetzen.

Che Guevara suchte sich deshalb Bolivien aus, weil er meinte, das Land sei zentral gelegen und vereinige alle Widersprüche Lateinamerikas in sich. Wenn es gelingt, dieses Land zu kippen, so seine Ansicht, dann würde der Rest der Nachbarstaaten folgen. In einer sehr abstrakten Weise haben die Drahtzieher des Sturzes von Morales vielleicht ähnliche Pläne, um in Sachen Hinterhof voranzukommen.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————

Grafikquellen       :

Unten       —        Looking down on La Paz from just below the canyon rim where El Alto is located. The large green field is Simón Bolívar Stadium (Estadio Libertador Simón Bolívar) which is most often used for soccer matches being the home field for Club Bolívar. Here the yellow line of cable car system Mi Teleférico connects the lower valley of La Paz with the city El Alto. Photo taken 2017. La Paz (elev.3,240m/11,942ft) was founded in the Andes by the Spaniards in 1548 in a canyon created by the Choqueyapu River. The administrative capital of Bolivia shifted to La Paz in 1898 while Sucre remained the constitutional and judiciary capital. On the western rim of the canyon on the Altiplano (High Plain) is the satellite city of El Alto (The Heights; elev. 4,150m/13,615ft) where there is flat land for the airport. The area was uninhabited until 1903 when the railroad reached the canyon rim and railway workers settled there to staff the railyards and depots. The district was politically separated from La Paz in 1985 and then formally incorporated as a city in 1987. Today El Alto is the second-largest city in Bolivia (after Santa Cruz) and the highest major metropolis in the world. The population is mostly indigenous, primarily Aymara. On Google Earth: canyon-rim viewpoint 16°31’3.04″S, 68° 8’59.57″W

——————————

2.) von Oben        —     Protesters from the Potosí Civic Committee blockade central streets in La Paz, Bolivia, as part of a 2015 mobilization.

————————————-

3.) von Oben         —        Río Choqueyapu before Ruta 3 at km 22, facing south

——————————————-

Unten        —       La Paz, Teleférico, gelbe Linie

Author Grullab

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

Abgelegt unter Amerika, Feuilleton, Regierung, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Die Artenvielfalt stirbt

Erstellt von DL-Redaktion am 26. November 2019

Die Artenvielfalt stirbt – und wir schauen zu

2014 Borneo Luyten-De-Hauwere-Bornean orangutan-06.jpg

von Tanja Busse

Wir befinden uns mitten im sechsten großen Artensterben der Erdgeschichte.[1] Das erste liegt etwa 500 Mio. Jahre zurück: Damals brachen so viele Vulkane aus, dass sich die Zusammensetzung der Meere und der Atmosphäre stark veränderte und in der Folge viele Arten ausstarben. Vor 443 Mio. Jahren driftete dann der Urkontinent Gondwana nach Süden und die Erde kühlte sich ab. Dabei starben vermutlich mehr als 85 Prozent aller Meeresbewohner. Als größtes Massenaussterben aller Zeiten aber gilt der Übergang vom Erdaltertum zum Erdmittelalter etwa zweihundert Mio. Jahre später, bei dem nach gigantischen Vulkanausbrüchen in Sibirien beinahe alles Leben weltweit vernichtet wurde. Das große Sterben zog sich damals mindestens über Tausende von Jahren hin. Erdgeschichtlich gesehen war das ein recht schnelles Aussterben in kurzer Zeit, aber im Vergleich zu dem, was heute passiert, war es slow motion.

Bis vor etwa 200 Jahren wussten die Naturforscher nicht einmal, dass Arten aussterben können. Sie konnten es sich nicht vorstellen, weil es die Idee des Aussterbens einfach nicht gab. In der Zeit vor Darwin hatte jedes Lebewesen seinen Platz in einer immerwährenden göttlichen Ordnung – obwohl damals längst Knochen von ausgestorbenen Tieren entdeckt worden waren. Erst der Naturforscher Georges Cuvier hatte – bei der Betrachtung des Backenzahns eines Mastodons – einen Aha-Moment, der ihn zu der Erkenntnis brachte, dass es früher Tierarten gegeben haben musste, die es jetzt offenbar nicht mehr gab. Dass diese Arten also ausgestorben sein mussten. Er entdeckte, dass das Leben selbst eine Geschichte hat.[2] Das war ein Gedanke, der bis dahin undenkbar gewesen war. Was wir uns heute wiederum kaum mehr vorstellen können, weil es für uns so offensichtlich ist. Keiner, der im Berliner Naturkundemuseum unter dem riesigen Brachiosaurierskelett entlangspaziert ist, könnte noch bezweifeln, dass Arten aussterben können. Doch früher war das eine disruptive Information, und viele Wissenschaftler verweigerten sich dem neuen Paradigma. Vielleicht werden sich die Menschen in 200 Jahren nicht vorstellen können, dass wir Menschen des frühen 21. Jahrhundert so blind vor der globalen Bedrohung standen wie einst Cuviers Zeitgenossen vor den Mammutknochen?

Heute wissen wir, dass das Aussterben von Arten etwas völlig Normales ist, Evolution eben. Die Wissenschaftler bezeichnen das gewöhnliche Entstehen und Vergehen von Arten in Zeiten ohne kosmische oder geologische Katastrophen als Hintergrundrate. Bei Säugetieren nimmt man an, dass etwa zwei von zehntausend Arten pro Jahrhundert aussterben.

Der mexikanische Biologe Gerardo Ceballos und seine Kollegen haben diese Rate mit den in den letzten Jahrhunderten ausgestorben Säugetierarten verglichen (ohne die vielen gefährdeten und vom Aussterben bedrohten mitzurechnen) und sie sind zu dem beunruhigenden Schluss gekommen, dass die aktuelle Aussterberate bis zu hundert Mal höher als die Hintergrundrate liegt. Andere Forscher gehen vom Tausendfachen aus. In Zukunft könnte die Aussterberate sogar zehntausend Mal so hoch sein.[3] Doch selbst Ceballos vorsichtige Schätzungen lassen nur einen Schluss zu: nämlich, dass wir uns tatsächlich mitten im sechsten Massenaussterben der Erdgeschichte befinden.[4]

Die Menschheit hat versagt

Das ist eine ungeheure Erkenntnis, die jahrelang ungeheuer gelassen aufgenommen wurde. Außer ein paar Wissenschaftlern und Naturschützern hat diese Tatsache die Medien und die Menschen viel zu lange kaum interessiert. Erst als der Weltbiodiversitätsrat IPBES im Mai 2019 die ungeheure Zahl von einer Million bedrohter Arten verkündete, machte das Massensterben Schlagzeilen auf den Titelseiten.

So weit der Blick reicht: Bild Mitte – Palmölplantagen.

Dabei schreien die Forscher ihre Erkenntnisse schon sehr lang sehr laut in die Welt hinaus. 1992 veröffentlichte der Physik-Nobelpreisträger Henry Kendall eine Warnung an die Menschheit, der sich 1700 Wissenschaftler, darunter viele Nobelpreisträger anschlossen: Die Menschheit befinde sich auf Kollisionskurs mit der Natur. Von den vielen Zerstörungen natürlicher Ressourcen sei der irreversible Verlust der Arten besonders ernst zu nehmen, schrieben Kendall und seine Kollegen vor einem Vierteljahrhundert. Kendall war Mitbegründer der Union of Concerned Scientists, der Vereinigung besorgter Wissenschaftler, die sich nicht damit begnügen, Entscheidungsträgern Forschungsergebnisse auf den Tisch zu legen. Sie fordern vielmehr science-based action, also politisches Handeln, das aus der Arbeit der Wissenschaftler die richtigen Schlüsse zieht – zur Rettung der Menschheit. Kendall ist 1999 gestorben, er hat nicht erleben müssen, dass die US-Amerikaner 2016 einen Präsidenten gewählt haben, der alle wissenschaftliche Evidenz ignoriert und selbst ausgedachte „alternative Fakten“ an ihre Stelle setzt. 2017 wiederholten Kendalls Nachfolger seine Warnung, und dieses Mal unterschrieben mehr als 15 000 Wissenschaftler aus der ganzen Welt. In „Warning to humanity, a second notice“bringen sie die Entwicklung seit 1992 auf den Punkt: Mit Ausnahme des Lochs in der Ozonschicht ist kein Problem gelöst worden, im Gegenteil. „Humanity has failed“, schreibt das Autorenteam um den Ökologen William J. Ripple. Die Menschheit hat versagt. Sie hat nicht genug unternommen, um den möglicherweise katastrophalen Klimawandel zu bremsen. Und darüber hinaus hat sie ein Massenaussterben entfesselt – das sechste in 540 Mrd. Jahren – das bis zum Ende dieses Jahrhunderts viele der gegenwärtigen Lebensformen auslöschen könnte.[5]

Fatale Apokalypseblindheit

Der Philosoph Günther Anders, der Ex-Mann von Hannah Arendt, hat über die Haltung vieler Menschen in den Jahren nach dem Zweiten Weltkrieg gegenüber der atomaren Bedrohung geschrieben und sie als Apokalypseblindheit bezeichnet. Mit der Erfindung von Atombomben hat sich die Menschheit als Ganze in die Lage gebracht, sich mit ihren eigenen Waffen selbst auslöschen zu können. Und die ganze Welt, wie wir sie kennen, gleich mit. Eine entsetzliche Erkenntnis, offenbar zu entsetzlich, um sich damit auseinanderzusetzen. Was bliebe übrig, wenn die Bombe eingesetzt würde? „Ein Trümmerfeld, unter dem alles, was Geschichte einmal gewesen, begraben läge. Und wenn der Mensch doch überlebte, dann nicht als geschichtliches Wesen, sondern als ein erbärmlicher Überrest: als verseuchte Natur in verseuchter Natur.“ So habe Albert Einstein die Lage beurteilt, schreibt Günther Anders und er ergänzt: „Und wir lesen es in den Zeitungen. Und wie reagieren wir darauf? Eben so, wie wir auf Zeitungsnachrichten reagieren: gar nicht.“[6]

Warum aber ist das so, warum wiederholt sich die Blindheit gegenüber den nuklearen Gefahren heute gegenüber dem Artensterben? Günther Anders glaubte, dass die Gefahr zu groß sei für unser Vorstellungsvermögen. Dass wir unseren eigenen Produkten und deren Folgen phantasie- und gefühlsmäßig nicht gewachsen seien. Anfang der fünfziger Jahre hat der Philosoph das geschrieben. Ein Vierteljahrhundert später, 1979, ergänzte Anders: „Die drei Hauptthesen: dass wir der Perfektion unserer Produkte nicht gewachsen sind; dass wir mehr herstellen als vorstellen und verantworten können: und dass wir glauben, das, was wir können, auch zu dürfen, nein: zu sollen, nein: zu müssen – diese drei Grundthesen sind angesichts der im letzten Vierteljahrhundert offenbar gewordenen Umweltgefahren leider aktueller und brisanter als damals.“[7]

Die chillige Ruhe, mit der wir bis vor Kurzem die länger werdenden Roten Listen ignoriert haben, gibt Günther Anders ein Vierteljahrhundert nach seinem Tod noch einmal Recht. Die Gelbbauchunke verschwindet? Der Feldhamster? Der Schierlingswasserfenchel? Schade, aber auch nicht sooo schlimm, also für uns nicht, wir Menschen sterben ja nicht aus, wir werden ja immer mehr und es geht uns immer besser. Diese Alltagserfahrung hat uns lange Zeit apokalypseblind gemacht. Dass das stille Verschwinden der possierlichen kleinen Tierchen um uns herum Teil eines globalen Massenaussterbens sein könnte, das auch das Leben der Menschen bedrohen wird, haben wir lange Zeit einfach nicht verstanden. Das übersteigt, hätte Günther Anders gesagt, unser Vorstellungsvermögen, dazu waren wir zu apokalypseblind, nein: dazu wurden wir zu lange apokalypseblind gemacht.

Es verschwinden nicht nur die Bienen

Doch immerhin, das ändert sich, seit die Krefelder Studie über das große Insektensterben ein weltweites Medienecho ausgelöst hat.[8] Die Krefelder Entomologen haben einen Nerv getroffen. Sie haben uns aus einem Schlaf gerissen und aufgeweckt.

So standen im Februar 2019 Millionen Bayern bei Regen und Kälte vor den Rathäusern Schlange, um für das Volksbegehren Artenvielfalt zu unterzeichnen. Und die Warnung des Weltbiodiversitätsrates, des IPBES – eine Million Arten vom Aussterben bedroht! – hat es in die Nachrichten und auf die Titelseiten der großen Zeitungen gebracht. Dass gehandelt werden muss, steht jetzt im Raum. Immerhin. Doch gleichzeitig ist die Diskussion auf merkwürdige Weise auf Insekten und vor allem auf Bienen beschränkt geblieben. Dieser enge Fokus könnte zu falschen Entwarnungen verleiten, fürchtet der Entomologe Udo Heimbach, weil wir über die Gefährdung vieler anderer Arten so viel weniger wissen.

Seit 2017 wird sehr viel über Blühstreifen als Beitrag zum Insektenschutz geredet, als könnte man mit einer schmalen bunten Blumenzierde um Äcker und Betonwüsten unsere lebensvernichtende Landnutzung umkehren. Ökologen wie Thomas Fartmann halten nicht viel von solchen Blühstreifen, vor allem nicht im konventionellen Ackerbau, weil sie die verbliebenen Insekten an die Ränder von Feldern mit gefährlicher Ackerchemie locken: Ökologische Falle nennt man das.

Viele Landwirte haben solche Streifen angelegt, weil sie beunruhigt waren über die Funde der Entomologen und selbst etwas gegen das Verschwinden der Insekten tun wollen. Die Kritik der Ökologen hat sie deshalb getroffen. Denn natürlich sind blühende Ackerränder besser als gar keine Ränder. Und die Blühstreifen haben noch einen großen Wert, den Ökologen vielleicht nicht erkennen: In der landwirtschaftlichen Ausbildung spielt Biodiversität so gut wie keine Rolle. Für die viele Landwirte sind die Blüten am Ackerrand ein erster Schritt zu Naturschutz auf den eigenen Flächen. So kann man die einjährigen Blühstreifen entlang der Agrar- oder Betonwüsten als Versuch interpretieren, das business as usual weiterzuführen wie bisher, nur eben mit kleinen Korrekturen, etwas verziert sozusagen, als Zeichen für die trügerische Hoffnung, dass ein paar Sommerblüten am Feldrand reichen werden, um die Insekten in ihrer ganzen Vielfalt wieder aufzupäppeln. Aber man kann sie auch als Zeichen deuten, dass viele Landwirte bereit sind für eine andere, vielfältigere Landwirtschaft. Blühstreifen sind nicht genug, aber sie sind die Symbole eines Aufbruchs auf dem Land.

Biodiversität ist eine Überlebensfrage für die Menschheit

Quelle          :      Blätter           >>>>>            weiterlesen

—————————————————————-

Grafikquellen      :

Oben             —       Bornean Orangutan (Pongo_pygmaeus)

—————————–

2.)       von Oben       —      Zerstörung des Regenwaldes

—————————————

Unten         —         Protest gegen Neonicotinoide auf der Demonstration Wir haben es satt! 2013.

Abgelegt unter International, Mensch, Regierung, Umwelt | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 26. November 2019

Von Kreuzberg über Mölln zur Nordsee

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ebru Taşdemir

Wenn ich mal rauskomme aus meinem Kreuzberger Dorf und unterwegs bin in Deutschland, denke ich oft den Satz „Ach nee, sieh an, auch das ist Deutschland“. Vor allem geschieht das, wenn ich in Gegenden bin, wo ich a) ziemlich voreingenommen hinfahre (Sachsen, Brandenburg, you name it) und überrascht bin, doch wenigstens eine coole oder zumindest freundliche Person dort zu treffen, oder b) wenn ich in Gegenden fahre, die in solch einem krassen Gegensatz zu dem stehen, was ich aus meinem Berliner Alltag kenne.

In der vergangenen Woche war ich zum ersten Mal an der Nordsee. Auf einer der größten Nordseeinseln, auf Norderney, um genau zu sein – rein beruflich. Gibt Schlimmeres, würden die Norddeutschen einen Arbeitstermin auf Norderney kommentieren, während man sich bei uns in Berlin schon mega rufend und jubelnd in die nächste Düne werfen würde. Nicht wundern also, in dieser Woche gibt es fast nur Nachrichten von der Insel.

An meinem Anreisetag bekomme ich noch über Twitter mit, dass Idil Baydar die Möllner Rede im Exil doch in Frankfurt gehalten hat, trotz konkreter Morddrohungen. Das Stresspotenzial, dass im Vorfeld durch solch eine Morddrohung aufgebaut wurde, hat die Kabarettistin durch eine enorme Entschlossenheit, diese Rede zu halten, abgebaut. Die Möllner Rede im Exil wird seit dem rechtsradikalen Brandanschlag in Mölln 1992 von Freunden und der Familie Arslan organisiert. Ayşe, Yeliz und Großmutter Bahide Arslan starben in den Flammen, viele der Familienmitglieder überlebten schwer verletzt, so wie Ibrahim Arslan. Anlässlich des Gedenkens erinnerte die Stadt Mölln jedes Jahr an den Mord, doch ab Jahr vier nach Mölln fand man es besser, nicht mehr die Familie entscheiden zu lassen, wer diese Rede hält. Die Möllner Rede wird seitdem im Exil gehalten, in diesem Jahr eben in Frankfurt, Idil Baydar sollte sie halten. Das die Comedienne Baydar schon mehrere Morddrohungen in diesem Jahr erhalten hat, macht diese Rede umso aktueller. Nun wurde sie also unter Polizeischutz gehalten. Seltsamerweise war das 1. Frankfurter Polizeirevier damit beauftragt, wie die Kollegin Ayesha Khan in der taz vom 18. 11. berichtete. Aus diesem Revier wurden die rassistischen Drohfaxe an die NSU-Opfer-Anwältin Seda Başay-Yıldız verschickt. Auch das ist Deutschland. Während ich also am Montag noch nachlese, wie die Veranstaltung war, trinken Rentnerpärchen gemütlich ihren Kaffee.

Berliner Möwenclan ?

Ich komme ja auch von einer Insel. Berlin vor dem Mauerfall. Es ist natürlich kein Vergleich zu dem Inselstatus von Norderney. Berlin verband ich mit dem Inselvolk der Linken, Arbeiter*innen und Aussteiger, Wohlstand trug man nicht auf die Berliner Straßen. Anders dagegen auf der Nordseeinsel: gediegene Boutiquen, wenige, silbern glänzende Mülleimer, aus denen nichts quillt, nirgends ein Döner und sogar die Fast-Food-Läden sind eher Bistros mit Sektchen oder Schnäppsken zum Schnitzelbrötchen.

Quelle          :          TAZ            >>>>>           weiterlesen

—————————————————————–

Grafikquellen       :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Berlin, Feuilleton, Mensch, Umwelt | Keine Kommentare »

Vom Aufstand im Libanon

Erstellt von DL-Redaktion am 25. November 2019

Aufstand gegen den Status quo

Beirutcity.jpg

Von  von Jakob Farah

Der Libanon erlebt die größten Proteste in seiner Geschichte. Die Menschen demonstrieren gegen eine korrupte politische Elite und das konfessionelle Proporzsystem. Mit dem Rücktritt der Regierung haben sie ihr erstes Ziel erreicht. Das bedeutet aber keineswegs, dass das Establishment aufgeben wird.

Am 20. Oktober, einem Sonntagnachmittag, gleicht das Zentrum von Beirut einer riesigen Partymeile: Zehntausende Menschen haben sich auf dem Märtyrerplatz vor der Mohammed-al-Amin-Moschee sowie vor dem „Grand Serail“, dem Regierungssitz, versammelt. Aus Lautsprecherwagen dröhnt Musik, die Leute tanzen, singen, schwenken die libanesische Fahne und skandieren Slogans gegen die Regierung und diverse Politiker. Abends gibt es sogar eine Lasershow; in riesigen Lettern flackert das Wort „Revolution“ auf einer Hausfassade am Rand des Platzes.

Viele Beobachter bezeichnen die Proteste als die größten in der Geschichte des Landes. An diesem Sonntag soll knapp ein Drittel der libanesischen Bevölkerung auf der Straße sein, landesweit 1,7 Millionen Menschen. Die Leute fordern den Rücktritt der Regierung, ein Ende der Herrschaft der korrupten Eliten. Und immer wieder ist der Schlachtruf des Arabischen Frühlings von 2011 zu hören: „Das Volk will den Sturz des Regimes!“

Nur einige Tage zuvor brannten im Zentrum Autoreifen, an zwei Abenden in Folge setzte die Polizei Tränengas und Wasserwerfer gegen die Demons­tran­ten ein, Dutzende wurden verhaftet. Mittlerweile gleicht die Stimmung auf dem Märtyrerplatz aber eher einem großen Volksfest: Es werden Fahnen verkauft, Eis und Maiskolben am Stiel. Für 3000 Lira (knapp 2 Euro) kann man Wasserpfeifen mieten, die in langen Reihen auf den Gehwegen stehen.

Ansonsten steht das Land still: Banken, Schulen, Ämter, alles ist geschlossen. Dutzende Straßensperren im ganzen Libanon haben den Verkehr lahmgelegt. Auf der Küstenautobahn Richtung Norden, wo sich normalerweise kilometerweit die Autos stauen, herrscht gähnende Leere.

Hariris Rücktritt ist nur ein Etappensieg

„Libnan jintafad“ – „der Libanon erhebt sich“ –, heißt der beliebteste Hashtag. Dabei haben viele Libanesen ihre eigene „Intifada“ selbst am wenigsten erwartet. Es ist ein Moment, den viele staunend, teils ungläubig und vor allem euphorisch erleben. „Das ist das eigentliche Ende des Bürgerkriegs“, twittert einer, dazu einen Grabstein mit der Aufschrift „1975–2019“.

„Heute ist es ganz egal, wo einer herkommt“, sagt Ayman El Sayed. „Egal ob Schiit, Sunnit, Katholik, Orthodoxer oder Druse – alle hier haben das gleiche Ziel. Und alle werden dir das Gleiche sagen: Sie haben die Schnauze voll von diesem System.“

Zusammen mit anderen jungen Leuten hat der 31-Jährige aus der Hafenmetropole Saida (Sidon) ein kleines Zeltlager mitten auf dem Märtyrer-Platz errichtet. Man sitzt zusammen im Schatten einer großen Plastikplane zwischen den Zelten, tauscht die neuesten Nachrichten aus, das ein oder andere Bier wird geöffnet. „Bis vor ein paar Tagen kannten wir uns gar nicht“, erzählt Ayman. „Aber jetzt werden wir zusammen hierbleiben, bis die Regierung abgetreten ist.“

Gut eine Woche später, am 29. Oktober, geht Aymans Wunsch in Erfüllung: Um 4 Uhr nachmittags tritt Premierminister Saad Hariri vor die Fernsehkameras und verkündet den Rücktritt seines Kabinetts. Für die Demonstranten ist es allerdings nur ein Etappensieg. Denn vielen von ihnen geht es um weit mehr: „Wir wollen einen neuen Libanon aufbauen“, hatte Ayman gesagt, „ohne die verdammte ‚ta’ifiye‘.“

Das Wort lässt sich am besten mit dem englischen „sectarianism“ übersetzen. Und tatsächlich zeichneten sich die jüngsten Proteste vor allem dadurch aus, dass sich die Demonstranten, egal ob in Beirut, im sunnitischen Tripoli oder im schiitischen Tyros, demonstrativ gegen den im Libanon allgegenwärtigen Sektarismus stellen. Viele, vor allem jüngere Libanesen, sehen im konfessionellen Proporzsystem, das auch in der Verfassung des Landes festgeschrieben ist, mittlerweile ein künstlich geschaffenes Herrschaftsinstrument der korrupten Politikerkaste.

2019 Lebanese protests beirut 10 Noveber 2019 21.jpg

Zwar gab es in den vergangenen Jahren immer wieder Proteste, die sich auch gegen das konfessionelle System richteten – etwa die „You stink“-Proteste während der Müllkrise 20151 –, aber die waren vor allem von der Beiruter Mittelschicht getragen. Im Gegensatz dazu haben sich die aktuellen Proteste über das ganze Land und über alle Klassengrenzen hinweg ausgebreitet.

Selbst in den Hochburgen der beiden schiitischen Parteien, der Amal-Bewegung und der Hisbollah, wurde demonstriert, etwa in den Städten Nabatieh und Tyros im Süden des Landes. Und zwar nicht nur gegen den sunnitischen Premier Saad Hariri, sondern auch gegen die eigene Führung. So machte ein Slogan gegen den Amal-Chef Nabih Berri, Multimillionär und seit 1992 amtierender Parlamentspräsident, die Runde, den öffentlich auszusprechen in diesen Städten bis vor kurzem noch undenkbar gewesen wäre: „Nabih Berri, Dieb!“

Quelle       :         Le Monde diplomatique           >>>>>           weiterlesen

——————————————————————–

Grafikquellen             :

Oben      —        Vista de la ciudad de Beirut, Líbano.

Abgelegt unter Arbeitspolitik, Asien, Mensch, Regierung | Keine Kommentare »

Der Tod von Venedig

Erstellt von DL-Redaktion am 24. November 2019

 Tourismus bis zum Kollaps

File:Navire de croisière dans le canal de la Giudecca (Venise) (6156556391).jpg

Von Susanna Böhme-Kuby

„Wer aber vom Kapitalismus nicht reden will, der sollte auch vom Tourismus schweigen”, so könnte man den bekannten Ausspruch Max Horkheimers abwandeln. Denn seit seinem Beginn vor etwa 150 Jahren hat sich der moderne Tourismus weltweit zu einer hochprofitablen Industrie entwickelt, die große Mengen von Menschen und Kapital bewegt. Reisten 1959 noch 25 Millionen Menschen durch die Welt, so ist ihre Zahl inzwischen auf jährlich 1,4 Milliarden angeschwollen, und für das Jahr 2030 werden sogar ganze 2 Milliarden prognostiziert. Die Tourismusindustrie boomt also – doch mit ihrem Wachstum steigen zugleich auch ihre desaströsen ökologischen und sozialen Folgen.

Besonders schmerzlich zu spüren sind sie in Italien und im (Noch-)UNESCO-Weltkulturerbe Venedig. Die reiche Region Venetien ist die meistbesuchte Italiens: Jährlich zieht es viele Millionen Touristen in die nordöstliche Region, die mit fast 70 Mio. Übernachtungen ein Zehntel des dortigen Bruttosozialprodukts produzieren – davon fast 12 Mio. Übernachtungen in der Gemeinde Venedig. Tendenz: steigend. Erklärtes Ziel des Regionalpräsidenten Luca Zaia von der rechtsradikalen Lega ist denn auch die Ausdehnung der Branche von Venedig auf die gesamte Region. Schließlich zeigt ein internationaler Vergleich, dass Italien insgesamt gesehen in seinen Aufnahmekapazitäten noch entwicklungsfähig ist, da es weniger Touristen pro Einwohner aufnimmt als andere Länder. Das wollen investitionsstarke Regionen wie Venetien ausnutzen. Um noch mehr Besucher anzulocken, setzt Zaia dabei insbesondere auf den sogenannten Erlebnistourismus, also auf „emotionale” Angebote und „Events”, die „einzigartige Erfahrungen” anpreisen und sich schon anderswo zunehmender Beliebtheit erfreuen. Moderne Kreuzfahrer mögen eben nach wie vor den Blick auf Venedigs Dogenpalast vom Oberdeck genießen können, ganz gleich, ob sie damit die Stadt überfordern und das Ökosystem der Lagune zerstören.

Inzwischen subsumiert Zaia das ganze vielgestaltige Venetien unter den Werbeslogan: „The Land of Venice”. Mit dem unmissverständlichen Motto: „Buy Venice” eröffnete er 2017 denn auch eine Tourismusmesse im venezianischen Mestre. Investoren aus 47 „Buyer“-Nationen beteiligten sich am Ausverkauf der Stadt und der Region, erstmalig dabei auch China und Indien. Die so dringenden politischen Antworten auf die sozialen und ökologischen Probleme der Bevölkerung rücken damit in weite Ferne. Seit 1945 sind mit dem Auszug von über 100 000 Einwohnern aus der Inselstadt aufs Festland auch deren Lebensgrundlagen, differenzierte und kreative Arbeitsplätze, Wohnraum und die entsprechenden Infrastrukturen verschwunden. Heute leben im Zentrum weniger als 53 000 Menschen, dazu weitere 30 000 auf den Laguneninseln, dagegen 180 000 Menschen auf dem Festland.

Die lange Tradition des privatwirtschaftlichen Chaos

Um die Entwicklung dahin zu verstehen, lohnt ein kurzer Blick auf die kapitalistische Geschichte des Belpaese. Denn der Ausverkauf Venedigs steht in einer langen privatwirtschaftlichen Tradition der fortdauernden Dominanz von Renten und Renditen über tatsächlich erwirtschaftete Profite in der Industrie. Von der Staatsgründung (1861/1866) bis zur Weltwirtschaftskrise von 1929 dominierte ein stark lokal orientiertes und konzentriertes Familienkapital die nationale Entwicklung. Es war dann erst ausgerechnet das Mussolini-Regime, das sich in den 1930er Jahren an einem nachhaltigen öffentlichen Investitionsprogramm à la Keynes versuchte. Doch spätestens beim Wiederaufbau nach 1945 überwog wieder das privatwirtschaftliche Chaos.

Strukturmaßnahmen wie öffentlicher Wohnungsbau blieben verschwindend klein, trotz starken Bevölkerungsdrucks auf die Städte in den industriellen Zentren seit den 1950er Jahren – vor allem im Norden, aber auch im Süden, wie in Neapel, wo Bodenspekulation vorherrschte. Die durch Arbeitslosigkeit und die Migration in den Norden Europas ausgelöste Landflucht ließ ganze Dörfer nicht nur in Süditalien verfallen. In der Toskana und in Umbrien beispielsweise wurden viele verlassene Bauerngehöfte ab den 1960er Jahren als Ferienobjekte ausgebaut, meist von Ausländern.

Erst Ende der 1960er Jahre begannen lokale Verwaltungen Bebauungspläne zu erstellen, konnten damit aber landesweit nur noch wenig Raubbau verhindern. Die regionalen Unterschiede waren und bleiben dabei groß: Man blicke nur in die fast unberührt anmutende Landschaft um Volterra und durchfahre dann die amorphen Ränder der meisten Städte oder die immens verbaute Ebene um den Vesuv zwischen Neapel und Sorrent.

Hintergrund ist, dass Gewinne und Renditen damals im Immobiliensektor leichter und schneller realisierbar waren als anderswo, was langfristig zu einer Überkapazität an vorhandenem Wohnraum führte. Italiens Familien investierten schon von jeher wenn möglich in die eigene „casa” – ein Haus oder eine Eigentumswohnung in der Stadt. Der wachsende italienische Mittelstand kaufte dann seit den 1960/1970er Jahren auch Zweitwohnungen in den vielen Feriengebieten. Diese stehen heute, aufgrund der langanhaltenden Krise und trotz Preisverfalls, zunehmend zum Verkauf.

Die in den 1980er Jahren schleichend einsetzende Deindustrialisierung, die im letzten Jahrzehnt ihren bisherigen Höhepunkt fand und etwa 25 Prozent des einstigen Industriepotentials kostete, hat in den betroffenen Städten zu großen sozialen Verwerfungen geführt. So öffneten sich Räume für eine schier unbegrenzte „Touristifizierung“, gewissermaßen als Ersatzindustrie. Insbesondere die berühmten Kunstmetropolen Mittel- und Norditaliens, aber verstärkt auch südliche Städte wie Neapel und Palermo ziehen seitdem viel internationales Immobilienkapital an und werden von immer größeren Touristenmassen durchstreift. Mit dem Siegeszug des schrankenlosen Neoliberalismus und seiner fatalen Fortschrittsideologie unter dem ersten sozialistischen Regierungschef eines nationalen Mitte-links-Bündnisses, Bettino Craxi, kam es seit den 1980er Jahren zu massiven Deregulierungen in der Wirtschaft. Liberalisierung und Privatisierung setzten sich gerade in Venedig rasch durch, wo der Druck seitens des Kapitals besonders stark war. Das EXPO 2000-Projekt in der Lagune konnte zwar damals auch durch den Widerstand der Venezianer noch verhindert werden. Doch der Immobilienmarkt blieb weiter dem freien Spiel der Kräfte überlassen. Der Exodus aus der Insel-Stadt aufs Festland verstärkte sich und inzwischen hat auch Airbnb den Mietwohnungsmarkt erobert, so dass es heute mehr Wohnraum für Touristen und Bewohner auf Zeit gibt als für Einheimische. Das geht zu Lasten des städtischen Lebens, das immer mehr zur Hintergrundkulisse degradiert wird, und zu Lasten der Umwelt, die den Overtourism nicht mehr abfedern kann.[1]

Ein ökologisches Desaster

Acqua alta del 15 novembre 2019.jpg

Insbesondere die Touristenfracht der inzwischen über 600 Kreuzfahrtschiffe, die jährlich die kleine Lagunenstadt ansteuern, birgt eine enorme ökologische Gefahr. Im vergangenen Jahr schifften sie mehr als 1,5 Millionen Menschen in die Stadt. An einem einzigen Sommerwochenende durchqueren 10 bis 16 schwimmende Hochhäuser den Giudecca-Kanal und entlassen bis zu 50 000 Urlauber in die historischen Gassen. Weniger augenfällig als die Menschenmassen, aber noch viel gravierender, ist die starke Luftverschmutzung durch die schwimmenden Hotelburgen: Ein Schiff stößt Abgase von 15 000 Autos aus, allerdings aus noch viel schädlicherem, schweröllastigem Treibstoff.[2] Darüber hinaus schädigen die Kreuzfahrtschiffe nachhaltig das Fundament der Lagune, denn ihre mächtigen Antriebe verstärken die Erosion und spülen die Sedimente fort. Sie zerstören also das gesamte Ökosystem der Lagune, die entscheidende Lebensbedingung Venedigs. Doch dass die Stadt ohne die Lagune nicht sein kann, verdrängen die Entscheidungsträger schon seit einem Jahrhundert weitgehend. Dabei bildet diese Tatsache die Grundlage der berühmten Legge speciale von 1973, ein Gesetz, das nach der großen Flut von 1966 den Auftrag formulierte, die Lagune nicht nur zu erhalten, sondern wiederherzustellen – und das zumindest de jure noch in Kraft ist. Dass auch nach jahrelanger Debatte die „Grandi Navi” nach wie vor schamlos das Becken vor San Marco durchqueren – ungeachtet sogar jüngster Unfälle – zeigt, wie mächtig die Oligopole der Kreuzfahrtlinien sind. Sie haben sich längst in Venedigs Hafen eingekauft und dominieren die Aktiengesellschaft Venezia Terminal Passeggeri. Die Megaschiffe wollen in Venedig anlegen – koste es, was es wolle. Seit die Havarie der „Costa Concordia“ 2012 strengere Auflagen nach sich zog, wurden in Venedig diverse Alternativprojekte für das Anlegen der Schiffe entwickelt, darunter zwei Offshore-Varianten vor Chioggia und Cavallino. Sie alle lösen jedoch das Problem der Lagunenbelastung nicht im Geringsten. Geht es nach der Stadtverwaltung, sollen die Schiffe lediglich aus der Skyline der Stadtmitte verschwinden, aber weiter quer durch die Lagune von Malamocco zu den Handelshäfen nach Marghera und Fusina fahren dürfen. Das wurde von der Weltpresse erleichtert aufgenommen, jedoch in Unkenntnis der Lokalität und der Tatsache, dass dafür alte Kanäle der Lagune, wie der berüchtigte Canale dei Petroli, noch tiefer und breiter ausgebaggert und sogar massiv befestigt werden müssten. Mit dem Umweltschutz der Lagune wäre das aber absolut unvereinbar und würde obendrein mit den – ihrerseits ökologisch hochproblematischen – Hochwassersperranlagen (MoSE) kollidieren. Nicht auszumalen wären außerdem die Schäden einer möglichen Kollision mit den großen Öltankern. Aber eine Umleitung der Megaschiffe ins nicht weit entfernte Triest, wo es bereits Aufnahmekapazitäten gäbe, wird offiziell nicht einmal angedacht.

Quelle      :          Blätter         >>>>>            weiterlesen

——————————————————————-

Grafikquellen        :

Oben       —          Plusieurs navires de croisière et paquebots empruntent chaque jour le canal de la Giudecca (Photo Annie Dalbéra)

Author dalbera from Paris, France

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on by the administrator or reviewer File Upload Bot (Magnus Manske), who confirmed that it was available on Flickr under the stated license on that date.

—————————-

Unten      —          Acqua alta del 15 novembre 2019

Abgelegt unter Europa, Flucht und Zuwanderung, Innere Sicherheit, Umwelt | Keine Kommentare »

Stadtgespräch von Malta

Erstellt von DL-Redaktion am 21. November 2019

Eine prominente Festnahme

Von Christian Jalob

Mord an Journalistin. Auf Malta wird im Fall Caruana Galizia ein Geschäftsmann verhaftet. Das heizt Spekulationen an, dass die Politik in den Mord verstrickt ist.

Viel Zeit ließen sich die Ermittler nicht: Am Dienstag verkündete Maltas Ministerpräsident Joseph Muscat, dass er einen von Interpol verhafteten Mittelsmann im Mordfall Daphne Caruana Galizia begnadigen wolle. Wie maltesische Medien berichten, handelt es sich um einen Taxifahrer, der wegen Geldwäschegeschäfte verhaftet worden war. Um sich freizukaufen, hatte der Mann offenbar angekündigt, den Namen des Auftraggebers des Mordes an Galizia zu nennen.

Am frühen Mittwochmorgen verhaftete die Polizei den maltesischen Geschäftsmann Yorgen Fenech, als dieser versuchte, den Hafen von Valletta mit seiner Jacht zu verlassen. Sein Name war offenbar von dem Tippgeber genannt worden. In Malta wird spekuliert, dass Muscats Äußerungen vom Dienstag ihn aufgeschreckt hatten.

Galizia war die mit Abstand bekannteste Investigativjournalistin Maltas. Am 16. Oktober 2017 war sie durch eine Autobombe in der Nähe ihres Hauses auf der Insel getötet worden. Bis heute ist nicht geklärt, wer dafür verantwortlich ist.

Das EU-Parlament hat die Schaffung eines Daphne-Caruana-Galizia-Preises für investigative Journalisten gefordert, das deutsche Reporter-Forum ein „Galizia-Stipendium“ ausgelobt. Sie selbst bekam posthum sage und schreibe 30 internationale Auszeichnungen. 45 Journalisten aus 15 Ländern haben ihre Recherchen im „Daphne-Project“ weitergeführt.

Nicht das einzige Opfer

Die traurige Wahrheit ist, dass Galizia nur eine von vielen JournalistInnen ist, die getötet wurden. 36 waren es nach Zählung von Reporter ohne Grenzen bislang in diesem Jahr, 80 im vergangenen. Kaum einer hierzulande ist annähernd so bekannt wie Galizia. Auch nicht die seither in Europa ermordeten JournalistInnen Ján Kuciak aus der Slowakei oder Wiktorija Marinowa aus Bulgarien.

Il-Belt. Monument tal-Assedju l-Kbir u Caruana Galizia 1.jpg

Was Galizia posthum solche Strahlkraft verleiht und sie so berühmt gemacht hat, ist nicht nur ihr – beeindruckendes – journalistisches Lebenswerk. Es ist der Umstand, dass bis heute der Verdacht im Raum steht, sie habe nicht nur in kriminellen Milieus recherchiert und sei deshalb von Gangstern getötet worden.

Galizia wirkte vor ihrem Tod an der Aufdeckung von Skandalen mit, an denen das direkte Umfeld von Maltas Ministerpräsident Joseph Muscat beteiligt war. In vier Korruptionsverfahren wurde daraufhin gegen Michelle Muscat, die Frau des Premierministers, dessen Kabinettschef Keith Schembri und den Tourismusminister Konrad Mizzi ermittelt.

Quelle         :            TAZ          >>>>>         weiterlesen

Vorhergehende Berichte :

18. 10. 2017   —     Mord an einer Mutigen

28. 10. 2017    —    Schmiergeld, Öl + Semtex

—————————————————————-

Grafikquellen         :

Oben      —         Daphne Caruana Galizia,  https://twitter.com/RED92cadadiamas

——————————

Unten      —       La Valletta.

Abgelegt unter Europa, Kriminelles, Medien, Schicksale | Keine Kommentare »

Dürre in Südafrika

Erstellt von DL-Redaktion am 20. November 2019

Das einsame Nashorn

Fil:Waterberg Nashorn3.jpg

Ein Schlagloch von Illja Trojanow

Eine Reise durch Südafrika ist Anschauungsunterricht in Sachen Klimakatastrophe. Der Regen bleibt aus, Farmer gehen pleite, Hotels schließen.

Dolly ist blind und gefräßig. Nicht ungewöhnlich für ein Breitmaulnashorn. Dolly teilt sich ein Wasserloch mit einigen Wasserböcken, Gnus und zwei Giraffen. Dolly muss täglich gefüttert werden, mit einem Ballen Luzerne. Ansonsten würde sie verhungern. Denn es wächst schon seit Jahren kein Gras mehr in der trockenen Karoo in Südafrika, seit sieben Jahren hat es nicht mehr richtig geregnet. Dolly frisst etwa 100 Euro im Monat weg. Die Eigentümer der Farm Bultfontein leisten sich mit letzten Kräften die Gesellschaft dieses Nashorns, als sei es ein Totem der Zuversicht. Solange es vor der eigenen Veranda mampft, gibt es noch Hoffnung.

Aber es wird zunehmend schwieriger, weil gemäß kapitalistischer Logik die Preise für Luzerne in die Höhe geschossen sind. Also haben sich die Farmer mit anderen zusammengetan, um Futter mit einem Lastwagen aus entfernten Gebieten her­anzuschaffen, wo die Preise niedriger sind. Die Hausherrin Carin muss in einem nahe gelegenen Städtchen als Lehrerin arbeiten, ihr Mann auf dem Bau.

Ansonsten würden sie nicht über die Runden kommen. Einige Nachbarn mussten schon ihre Farmen aufgeben und in die Städte ziehen. Das Überleben unter dem Diktat der Trockenheit ist ökonomisch schwierig, wenn die Fütterung der Schafe mehr kostet, als diese auf dem Markt einbringen. Öffentliche Unterstützung bleibt aus.

Wer dieser Tage durch Südafrika reist, erhält Anschauungsunterricht in Sachen Klimakatas­trophe. Nicht nur in der Karoo bleibt der Regen aus. Auch in der Provinz Northern Cape, wo sogar die Kakteen teilweise verdorrt sind. Die Namaqua-Wüste, berühmt für ihre Blumenpracht im September, ist inzwischen eine sandfeste Wüste und die Blumen, dieses Symbol des widerspenstigen Lebens in mageren Zeiten, sind zwar auch dieses Jahr erblüht, aber nur kurz und vereinzelt, um schnell wieder zu verschwinden – wie ein flüchtiger Traum.

Endgültigkeit der Ereignisse wird evident

In dem kleinen Binnenstaat Lesotho warten die Menschen seit drei Jahren auf Regen. Brandnarben ziehen sich über die spektakulären Hänge. „Der Berg stand in Flammen“, erzählt ein Einheimischer, „so was hatten wir noch nie erlebt.“ Ein mächtiger Bergfluss, der einst Felsen verschoben hat, als seien es Kieselsteine, ist nur noch ein Rinnsal, in Jauchen waschen die Dorfbewohner ihre Kleidung, neben ihnen die durstigen Nutztiere. Die luxuriöse Maliba Lodge, die über ein eigenes Bohrloch verfügt, teilt das hochgepumpte Grundwasser mit den nahe gelegenen Gemeinden, aber wenn es nicht bald regnet, so der Manager, werde man die Türen des Hotels schließen müssen.

In den schön eingerichteten Hütten steht noch jeweils eine Badewanne, die allerdings alles andere als einladend wirkt. Im Gegenteil: Die Vorstellung, angesichts der Trockenheit, die der Gast jenseits des Fensters zu Gesicht bekommt, Wasser zu verschwenden, erscheint hochgradig pervers. So dürften es wohl die meisten Gäste empfinden. Im globalen Zusammenhang füllen wir Wohlhabendere jedoch weiterhin bedenkenlos unsere Badewannen mit dem flüssigen Stoff, der mit Privilegien verbunden ist.

Zwei Folgen von ökologischen Desastern werden angesichts solcher Zustände schmerzhaft evident: die Endgültigkeit der Ereignisse und die autoritären Notwendigkeiten. Wenn das Wasser ausgeht, gibt es keine Lösungen mehr, keine Reaktionsmöglichkeiten, keine raffinierten technologischen Adaptionen. Die Optionen sind buchstäblich zerronnen. Es gibt nur Flucht oder Tod. Beides ist nur schwer rückgängig zu machen.

Quelle         :       TAZ         >>>>>          weiterlesen

——————————————————————

Grafikquellen     :

Oben      —         Laufendes Breitmaulnashorn in Namibia

Opphavsperson Ikiwaner
Tillatelse
(Gjenbruk av denne filen)
GNU Free Documentation License v1.2 only

————————

Unten        —            Pustynia Namib

Abgelegt unter Afrika, Positionen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Völkerrecht, USA, Israel

Erstellt von DL-Redaktion am 20. November 2019

Die USA entscheiden selber, was im Völkerrecht gilt

Efrat winter.jpg

Quelle         :        INFOsperber CH.

Von Andreas Zumach

Die US-Regierung biegt das Völkerrecht zurecht wie es ihr passt – und verletzt es gleich mehrfach. Proteste halten sich in Grenzen.

Die US-Regierung hat beschlossen, die israelischen Siedlungen in den besetzten palästinensischen Gebieten ab sofort nicht mehr als Verletzung des Völkerrechts zu betrachten. Der Bau von israelischen Siedlungen im Westjordanland sei aus Sicht der USA «nicht per se unvereinbar mit internationalem Recht» erklärte Aussenminister Mike Pompeo am Montag. Mit dieser Entscheidung verstösst die Trump-Administration mit Blick auf den israelisch-palästinensischen Konflikt bereits zum wiederholten Mal gegen das Völkerrecht.

UNO hat illegale Besatzung bereits mehrmals verurteilt

Im Nahostkrieg vom Juni 1976 hatten die israelischen Streitkräfte das Westjordanland, den Gaza-Streifen und Ost-Jerusalem sowie die syrischen Golanhöhen und die ägyptische Sinai-Halbinsel besetzt. Inzwischen existieren im Westjordanland über 200 völkerrechtswidrige Siedlungen mit mehr als 600’000 illegalen jüdischen Siedlern.

Diese 1967 erfolgte Besatzung verurteilte der UNO-Sicherheitsrat mit seiner Resolution 242 im Konsens mit 15:0 Stimmen als «Verstoss gegen internationales Recht» und forderte die israelische Regierung zum vollständigen und bedingungslosen Rückzug aus den besetzten Gebieten auf. Nach dem Yom-Kippur-Krieg vom Oktober 1973 wiederholte der Sicherheitsrat mit seiner Resolution 338 die Feststellung der Völkerrechtswidrigkeit der Besatzung sowie die Rückzugsforderung an die israelische Regierung. Die beiden Resolutionen 242 und 338 sind weiterhin ohne Einschränkung gültiges Völkerrecht, und sie wurden vom Sicherheitsrat in den letzten fünf Jahrzehnten in weiteren Resolutionen viele Male bekräftigt.

In mehreren Resolutionen hat der UNO-Sicherheitsrat zudem ausdrücklich festgestellt, dass die Besiedlung von völkerrechtswidrig besetzten Gebieten ebenfalls gegen internationales Recht verstösst und Israel aufgefordert, die völkerrechtswidrige Besiedlung zu unterlassen. Zuletzt geschah dies in der Resolution 2234 vom 23. Dezember 2016, in der der Sicherheitsrat

  1. «bekräftigt, dass die Errichtung von Siedlungen in dem seit 1967 besetzten palästinensischen Gebiet, einschliesslich Ost-Jerusalems, durch Israel keine rechtliche Gültigkeit besitzt und einen flagranten Verstoss gegen das Völkerrecht und ein ernstes Hindernis für die Herbeiführung der Zwei-Staaten-Lösung und eines gerechten, dauerhaften und umfassenden Friedens darstellt;»
  2. «abermals verlangt, dass Israel alle Siedlungstätigkeiten in dem besetzten palästinensischen Gebiet, einschliesslich Ost-Jerusalems, sofort vollständig einstellt und alle seine diesbezüglichen rechtlichen Verpflichtungen uneingeschränkt achtet.»

Die Siedlungen seien «ein grosses Hindernis für Frieden», stellte der Sicherheitsrat fest. Die Resolution 2234 wurde mit 14-Ja-Stimmen verabschiedet; die bis Ende Dezember 2016 noch von der Obama-Administration regierten USA enthielten sich der Stimme.

USA verstossen systematisch gegen Völkerrecht

Doch die Trump-Administration verstösst seit ihrem Amtsantritt im Januar 2017 systematisch gegen immer mehr völkerrechtliche Bestimmungen, die für den Konflikt Israel-Palästina relevant sind. Zunächst verlegte sie die US-Botschaft von Tel Aviv nach Jerusalem und anerkannte damit ausdrücklich den Anspruch der israelischen Regierung auf Jerusalem als alleinige Hauptstadt Israels. Damit verstiessen die USA gegen die UNO-Teilungsresolution, mit der die Generalversammlung am 30. November 1947 die Bildung zweier Staaten auf dem damals von Grossbritannien als «Mandatsgebiet Palästina» verwalteten Territorium zwischen dem Mittelmeer und dem Jordanfluss beschlossen hatte.

Die Teilungsresolution legt ausdrücklich fest, dass der Status Jerusalems zunächst offen bleibt und die künftige Rolle und Funktion der Stadt (sei es als gemeinsame oder getrennte Hauptstadt eines oder beider Staaten oder als internationale Stadt mit den Hauptstädten in Tel Aviv und Ramallah) erst in Verhandlungen zwischen beiden Seiten entschieden werden soll.

In einem weiteren völkerrechtswidrigen Schritt anerkannte die Trump-Administration im Frühjahr dieses Jahres die Entscheidung der Regierung von Benjamin Netanjahu, die völkerrechtswidrig besetzten syrischen Golanhöhen zum dauerhaften Teil des israelischen Staatsgebietes zu erklären.

Neue Sprachregelung verschleiert völkerrechtswidrige Besatzung

Und schliesslich tilgte das von Mike Pompeo geführte State Department in Washington die Bezeichnung «Occupied Palestinian Territories (OPT)», die seit 1967 in allen US-Regierungsdokumenten, bei der UNO und auch überall sonst in der weltweiten Diplomatie sowie in Entscheidungen internationaler Gerichte für die von Israel besetzten Gebiete verwendet wird, aus allen offiziellen Dokumenten und dem Sprachgebrauch der US-Regierung und ersetzte sie durch den Begriff «disputed territories» (umstrittene Gebiete).

Die Tendenz, die harte Realität der völkerrechtswidrigen Besatzung durch diese neue Sprachregelung zu verschleiern und zu verharmlosen, ist seit geraumer Zeit auch in anderen westlichen Hauptstädten zu beobachten. Erst letzte Woche bezeichnete der Antisemitismus-Beauftragte der deutschen Bundesregierung, Felix Klein, ein direkt dem Büro von Kanzlerin Angela Merkel unterstellter hoher Beamter, die von Israel besetzten Gebiete als «umstrittene Gebiete».

Klein tat dies in seiner Kritik am Urteil des Europäischen Gerichtshofes in Luxembourg. Dieser hat kürzlich entschieden, dass Produkte aus den besetzten Gebieten, die Israel unter Verstoss gegen das seit 1996 bestehende Handelspräferenzabkommen mit der EU und mit der falschen Herkunftsbezeichnung «aus Israel» in EU-Länder (und auch in die Schweiz) exportiert, mit ihrer korrekten Herkunft («aus dem Westjordanland») deklariert werden müssen. Klein behauptete, die Entscheidung des Europäischen Gerichtshofes setze «doppelte Standards» für Israel, weil es keine entsprechenden Bestimmungen «für andere umstrittene Gebiete» wie die ukrainische Krim oder das von Marokko verwaltete Territorium von Westsahara gebe.

Chaschmona’im

Entsprechend äusserte sich auch der Generalsekretär der regierenden Christdemokraten, Paul Ziemiak. Bereits im Sommer 2017 verbot der Direktor der Katholischen Akademie in Berlin eine bereits vertraglich vereinbarte sowie in Plakaten und Flugblättern angekündigte Veranstaltung zum 50. Jahrestag der Besetzung palästinensischer Gebiete durch Israel im Juni 1967 mit der Begründung, «der Begriff Besatzung gehört nicht zu unserer Sprache».

In der Schweiz missachtet unter anderem die Webseite «Audiatur» ständig das Völkerrecht, in dem sie ebenfalls den Begriff «umstrittene Gebiete» verwendet und den Begriff «Besatzung» stets in Anführungszeichen setzt. In einer Kritik an dem Urteil des Europäischen Gerichtshofes wird schlicht unterschlagen, dass mit der UNO-Teilungsresolution von 1967 nicht nur die Schaffung eines Staates Israel beschlossen wurde, sondern ebenfalls die Schaffung eines Staates für die Palästinenser.

Die jüngste völkerrechtswidrige Entscheidung der Trump-Administration lässt weitere erwarten. Sollte Israel die Ankündigung von (noch)-Ministerpräsident Netanjahu zur Annexion von zumindest Teilen des Westjordanlandes wahrmachen, dürfte sie dafür ebenfalls die Unterstützung der Trump-Administration erhalten.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Keine.

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

————————————————————————-

Grafikquellen        :

Oben      —          The town of Efrat in winter

  • CC BY-SA 3.0Hinweise zur Weiternutzung
  • File:Efrat winter.jpg
  • Erstellt: ‎7‎. ‎Februar‎ ‎2008

 

————————————–

Unten          —      Chaschmona’im

Abgelegt unter International, Kriegspolitik, Mensch, Regierung | Keine Kommentare »

Vom Antifaschismus

Erstellt von DL-Redaktion am 20. November 2019

Das Märchen vom linken Mob

File:Bundesarchiv Bild 183-1984-0909-406, Berlin, OdF-Kundgebung.jpg

Eine Kolumne von

Was ist gemeint, wenn von „Angriffen von links oder von rechts“ die Rede ist? Oft ist das, was als „linke Hetze“ gilt, bloß ein Benennen der Zustände. Zu denen zählen Morddrohungen gegen AktivistInnen.

Die Leute sagen, ein Gespenst gehe um in Europa, das Gespenst des linken Mobs. Allein, dieser vermeintliche linke Mob scheint hauptsächlich in den Köpfen derer zu existieren, die Antifaschismus für „genauso schlimm“ wie Faschismus halten. Während JournalistInnen, KünstlerInnen, AktivistInnen, WissenschaftlerInnen und Privatpersonen heute einer Vielzahl Angriffen von Rechten und Rechtsextremen ausgesetzt sind, gibt es immer noch und immer wieder Leute, die davon reden, dass Gewalt von Linken oder Linksextremen im Moment das eigentliche Problem sei. Obwohl sie wissen könnten, dass Gewalttaten von links deutlich zurückgegangen sind.

Deutsche lieben Traditionen, aber manchmal wissen sie gar nicht, in welch althergebrachter Tradition sie stehen. Die Verharmlosung rechter Gewalt bei gleichzeitiger Behauptung angeblich mindestens genauso brutaler linker Gewalt ist so eine Tradition in Deutschland. (Sie ist nicht nur deutsch, natürlich; VertreterInnen der sogenannten Hufeisen-Theorie, nach der Rechts- und Linksextreme gleichermaßen bedrohlich für Demokratien sind, findet man überall.)

Die Philosophin und Autorin Dania Alasti schreibt in ihrem Buch „Frauen der Novemberrevolution“ darüber, wie „viele Krawalle, Demonstrationen und Streiks von 1915 bis 1918 maßgeblich von Frauen getragen“ wurden und wie viele der damals protestierenden Frauen heute vergessen sind. Interessant für die Frage nach linker und rechter Gewalt ist ihre Beobachtung der juristischen Verfolgung politischer Gewalt, zu der sie eine Untersuchung von 1922 zitiert:

„In seiner ausführlichen Recherchearbeit ‚Vier Jahre politischer Mord‘ fasste der Mathematiker Emil Gumbel 1922 alle bekannt gewordenen Fälle politischen Mordes (…) von linken und von rechten Gruppierungen zusammen und verglich die Strafverfolgung und Aufarbeitung. Der Vergleich war erschreckend. Die bayerischen Räterepublikaner*innen wurden insgesamt zu 616 Jahren Einsperrung verurteilt, während die Kapp-Putschisten für insgesamt fünf Jahre eingesperrt wurden. Seine Arbeit kann als akribische Ideologiekritik verstanden werden. Er stellte ausführlich dar, wie ausschreitend Gewalttaten von rechten Verbänden waren und wie wenig sie strafverfolgt wurden, während es sehr viel weniger Gewalttaten seitens der linken Räte oder Aufständischen gab, die aber sehr stark strafverfolgt wurden. Gleichzeitig (…) war das öffentliche Bewusstsein verkehrt. Gewalt von linker Seite wurde direkt verurteilt, während Gewalt von rechter Seite mit ausweichenden Sätzen begegnet wurde, wie: ‚Wir mißbilligen politischen Mord von jeder Seite.'“

Diese Art der Verschiebung von Diskursen, weg von rechter Gewalt, sehen wir auch heute. Menschen, die etwa in sozialen Netzwerken darauf hinweisen, von welchen rechten Journalisten oder anonymen Accounts sie belästigt oder bedroht werden, wird vorgeworfen, sie würden nun ihrerseits gegen diese Leute „hetzen“, den „linken Mob anstacheln“, Leute ihren Followern „zum Fraß vorwerfen“ – obwohl sie einfach nur TäterInnen benennen oder Angriffe sichtbar machen. Im Großen und Ganzen heißt das: Wehr dich nicht und halt dein Maul, wenn Nazis dich angreifen, sonst bist du genauso schlimm wie sie. Oder, wie FDP-Politiker Sebastian Czaja es mal formulierte: „Antifaschisten sind auch Faschisten“. Täter-Opfer-Umkehr wie aus dem Lehrbuch.

File:Wien-Innere Stadt - Demonstration gegen die Kriminalisierung von Antifaschismus - V.jpg

Dabei ist das, was für „linke Hetze“ gehalten wird, oft einfach ein Benennen der Zustände. Wenn man Leute, die Rechte oder Rechtsextreme verteidigen – ob aus Unwissenheit oder tatsächlicher politischer Motivation – darauf hinweist, was sie da tun, dann hört man sehr schnell Verteidigungen wie: „Hören Sie auf gegen mich zu hetzen!“ oder „Sie diskreditieren mich öffentlich!“ Es sind oft Leute, die keine Ahnung davon haben (oder haben wollen), was etwa JournalistInnen oder AktivistInnen, die über Rechtsextreme berichten, erleben, und was tatsächliche Hetze ist: Gewaltandrohungen, Morddrohungen, Veröffentlichung von Privatadressen oder anderen privaten Informationen, sogenannte Feindeslisten und Aufrufe, die Person zum Schweigen zu bringen.

Quelle         :          Spiegel-online               >>>>>            weiterlesen

—————————————————————–

Grafikquellen         :

Oben        —             Berlin, OdF-Demonstration Info non-talk.svg

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-1984-0909-406 / Karl-Heinz Schindler / CC-BY-SA 3.0

—————————————-

Unten             —            Die Demonstration gegen die Kriminalisierung von Antifaschismus am 26. Juli 2014 war eine Solidaritätsdemo mit Josef S., der ohne Beweise, lediglich aufgrund der Aussage eines zivilen Polizisten wegen Landfriedensbruchs in Rädelsführerschaft, versuchter schwerer Körperverletzung und schwerer Sachbeschädigung zu zwölf Monaten Haft – davon acht bedingt – verurteilt wurde.

Author Haeferl
file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter International, Kriminelles, Mensch, P. DIE LINKE | Keine Kommentare »

Francos Tote ohne Ruhe

Erstellt von DL-Redaktion am 19. November 2019

 Die Toten Francos geben keine Ruhe

von Pauline Perrenot und Vladimir Slonska-Malvaud

Die historische Aufarbeitung ist mit der Umbettung Francos noch lange nicht zu Ende.

Der Bus überwindet die letzten Kurven und erreicht den riesigen Vorplatz im ­Valle des los Caídos („Tal der Gefallenen“) im Nordosten von Madrid. Schon von der Straße aus ist das 150 Meter hohe Kreuz, das auf dem Berg die Gedenkstätte überragt, weithin zu sehen. In der riesigen Basilika, die zwischen den Kiefern und Zistrosen der Sierra de Guadarrama errichtet wurde, ruhten bis vor Kurzem die sterblichen Überreste Francisco Francos (1892–1975) in einer 300 Meter in den Berg hineingetriebenen Krypta.

Der Diktator selbst hatte sein Mausoleum als Symbol der „Versöhnung“ der verfeindeten Lager im Spanischen Bürgerkrieg entworfen. In den 1940er und 1950er Jahren mussten tausende republikanische Gefangene dieses Mahnmal ihrer Demütigung in den Fels schlagen. Hier wird täglich eine katholische Messe gelesen, die Anhänger des alten Regimes paradieren mit faschistischem Gruß, und Busse bringen jedes Jahr hunderttausende Touristen her. Keine Tafel erläutert die Geschichte oder die gigantomanische faschistische Symbolik des Mahnmals.

Für viele Spanier ist das Tal der Gefallenen ein Ort der Verhöhnung der Opfer der Diktatur. Am 24. September 2019 gab der oberste Gerichtshof grünes Licht für den im Juni 2018 beschlossenen Plan der sozialistischen Regierung unter Pedro Sánchez, die Gebeine des Caudillos in die Fami­lien­grabstelle beim Königspalast El Pardo am Rande von Madrid umzubetten. Trotz des Widerstands, der von der Volkspartei (Partido Popular, PP), der katholischen Kirche und rechtsextremen Organisationen angeführt wurde, und trotz wiederholter Einsprüche der Familie Franco gelang es der So­zia­lis­ti­schen Arbeiterpartei (PSOE) nach monatelangem Hin und Her, die Überführung der Gebeine des Generals am 24. Oktober – also noch vor den Parlamentswahlen am 10. November – durchzusetzen.

Die Gedenkstätte im Tal der Gefallenen ist jedoch nur die Spitze des Eisbergs franquistischer Nostalgie. Während die Überreste der geschätzten 100 000 bis 115 000 Opfer der Diktatur und des Spanischen Bürgerkriegs (1936–1939) in teilweise unbekannten Massengräbern liegen, wird der Generalissimus an seinem Todestag, dem 20. November, stets gefeiert – übrigens auch bei manchen Demonstrationen gegen die Unabhängigkeit Kataloniens.

Das toxische Schweigen der Transición

Mit dem Einzug der rechtsextremen Partei Vox ins andalusische Regionalparlament im Dezember 2018 und ins spanische Abgeordnetenhaus, die Cortes, im April 2019 wurde der schwelende Konflikt um den Umgang mit der Vergangenheit neu angefacht. Der stellvertretende Vox-Fraktionsvorsitzende im andalusischen Parlament, Rodrigo Alonso Fernández, erklärte, Spanien behandle das eine Lager schlechter als das andere: „Die Besiegten werden als Märtyrer dargestellt und die Sieger verteufelt.“

Diesen Standpunkt teilt natürlich auch die Francisco-Franco-Stiftung (FFF), die ein Jahr nach dem Tod des Diktators gegründet wurde, um „das Vermächtnis, das Denken und die Erinnerung an Francisco Franco und den Staat, der von 1936 bis 1977 die Geschicke Spaniens lenkte, zu verbreiten und zu fördern“. So erklärt es uns der Stiftungsvorsitzende Juan Chicharro Ortega, den wir in den Räumen der Stiftung in Madrid treffen.

Es handelt sich um eine Art Museum des Franco-Regimes mit Büsten, riesigen Porträts und Fahnen mit dem franquistischen Adler. Ortega, Generalmajor der Marineinfanterie a. D., ehemaliger Adjutant von König Juan Carlos und (wie auch Franco selbst) Angehöriger der französischen Ehrenlegion, berichtet uns von den Ungerechtigkeiten, die sein politisches Umfeld derzeit zu erleiden habe: „Spanien ist das einzige Land, das den Kommunismus mit Waffengewalt besiegt hat. Das haben sie uns nie verziehen oder vergessen. Die Arbeit der überwiegenden Mehrheit der Geschichtsvereine beruht auf Lügen, der seit Lenins Zeiten wichtigsten Waffe des Marxismus.“

Für die extreme Rechte gab es den Putsch der Offiziere gegen die demokratisch gewählte Regierung der Zweiten Spanischen Republik 1936 gar nicht – und auch keinen Unterschied zwischen dem schlecht organisierten, manchmal auch mörderischen Widerstand der Anhänger der Republik und der organisierten, systematischen und massiven Repression des darauffolgenden Franco-Regimes.

Dieses Wiedererstarken der franquistischen Reaktion ist keine neuartige Erscheinung. „In Spanien wurde das Vergessen auf allen politischen Ebenen institutionalisiert“, sagt Bonifacio Sánchez, Sprecher des „Vereins für die Rückgewinnung des historischen Gedächtnisses“ (Asociación para la Recuperación de la Memoria Histórica, ARMH). Es geht dabei vor allem um die sogenannte transición, den Übergang zur Demokratie, der nach dem Tod Francos im November 1975 begann und im Oktober 1982 in einen überwältigenden Sieg der unter Franco verbotenen Sozialisten mündete.1

Mit Unterstützung der Kommunistischen Partei Spaniens (PCE) organisierten der rechte und der linke Block den bruchlosen Übergang. Dafür mussten die Erinnerungen an die Republik, die durch den Militärputsch vom 17. Juli 1936 zerstört worden war, den darauffolgenden Krieg und vierzig Jahre Diktatur in der Versenkung verschwinden. Der kommunistische Abgeordnete Marcelino Camacho hatte selbst über zehn Jahre im Gefängnis gesessen und erklärte sich dennoch einverstanden mit der Verpflichtung, Stillschweigen über die alten Wunden zu bewahren. Am 15. Oktober 1977 stimmte er für ein entsprechendes Amnestiegesetz. Bei eine Rede vor dem Parlament bezeichnete er es als „Meisterstück einer Politik der nationalen Versöhnung“ und erklärte, seine Seite habe „die Toten und den Groll begraben“.2

Die Sozialisten von der PSOE, die Organisatoren derTransición, scheuten keine Mühe, um eine möglichst konfliktfreie Versöhnung zu inszenieren. So widmeten sie 1985 das Denkmal am Madrider Bahnhof Atocha für die erschossenen Widerstandskämpfer gegen die napoleonische Besetzung vom 3. Mai 1808 in ein Denkmal für alle „für Spanien Gefallenen“ um. Vor der Parade der Streitkräfte umarmten sich zwei Veteranen, ein Falangist und ein Republikaner. 20 Jahre später, am 12. Oktober 2004, nahm der sozialistische Regierungschef José Zapatero eine Parade zum Nationalfeiertag ab, an der sowohl ein Republikaner teilnahm, der im Zweiten Weltkrieg aufseiten der Franzosen gekämpft hatte, als auch ein Ehemaliger der Blauen Division – einer Truppe spanischer Freiwilliger, die auf Francos Geheiß an der Seite der deutschen Wehrmacht für die Ostfront eingezogen wurden.

„Dank dieses Systems hat der Franquismus im kollektiven Unbewussten überleben können“, sagt der Journalist Juan Miguel Baquero. Die fehlende Erinnerung an die (Zweite) Republik ermögliche die neuerliche Leugnung der Geschichte – ein Phänomen, das Baquero als „desmemoria“ (auf Deutsch etwa: Ent-Erinnerung, verfälschte Erinnerung) bezeichnet. Deshalb ist die Arbeit der Geschichtsvereine so wichtig, die seit neunzehn Jahren Massengräber exhumieren und versuchen, die sterblichen Überreste zu identifizieren.3

Von den 2400 vom Justizministerium verzeichneten Gräbern wurden bis 2018 erst 740 geöffnet. „In Sevilla erklärten die Rechten noch in den 2000er Jahren, die Republikaner hätten ebenso viele Menschen getötet wie die Faschisten“, berichtet Cecilio Gordillo, Mitglied der „Gruppe zur Wiedererlangung der Erinnerung an die Sozialgeschichte Andalusiens“, die zur anarchistischen Gewerkschaft CGT gehört. „Die Exhumierungen dienen nicht nur dazu, den Familien ihre Toten wiederzugeben. Es geht auch darum, zu wissen, wie viele überhaupt dort liegen.“

Diese Forderungen wurden am 29. Juni 2018 im Rahmen eines Änderungsvorschlags für das Gesetz über das historische Gedenken (Ley de Memoria Histórica) von 2007 von dem Abgeordneten Alberto Garzón der Vereinigten Linken, einer Koalition unter Federführung der Kommunistischen Partei, im Parlament vorgetragen.

Dass diese Initiative überhaupt zustande gekommen ist, hat mit dem Wandel der politischen Landschaft in Spanien zu tun: Die Wirtschaftskrise von 2008 und die Lawine der Korruptionsskandale innerhalb der PP4 – in etwas geringerem Maße auch in der PSOE – haben das seit der Transición bestehende Zweiparteiensystem erschüttert. Die 2014 gegründete linke Partei Podemos schloss sich mit ihrer parlamentarischen Fraktion Unidos Podemos dem Vorschlag der Vereinigten Linken an.

Ohne die kontinuierliche Arbeit der Geschichtsvereine wäre dieser Umschwung nicht möglich gewesen. Als ihr Gründungsdatum wird oft das Jahr 2000 genannt, weil damals anlässlich der Öffnung des Massengrabs von Pria­ranza del Bierzo (Provinz León) der Verein ARMH gegründet wurde, doch zahlreiche andere Gruppen führen den Kampf um das Gedenken bereits seit vielen Jahren. „Die Erinnerung war immer da, es gab kein Vergessen“, erklärt Ricard Vin­yes, Historiker an der Universität Barcelona und Autor zahlreicher Bücher über die Franco-Zeit. Als Beispiel nennt er den „Katalanischen Verein der ehemaligen politischen Gefangenen des Franquismus“ (Acepf), der 1976 legalisiert wurde. Er entstand aus den Solidaritätskomitees von Ex-Gefangenen für die Inhaftierten des Franco-Regimes. „Ähnliche Vereine wurden von Leuten gegründet, die im Bürgerkrieg, im Zweiten Weltkrieg und während der Diktatur im Widerstand gewesen waren“, erzählt der Acepf-Vorsitzende Carles Vallejo. „Die republikanischen Piloten und Polizisten, all diese Leute kämpften für ihre Recht. Heute gibt es diese Organisationen nicht mehr.“

Die Struktur der Vereine, die sich vor allem um die Exhumierungen kümmerten, veränderte sich durch einen Generationenwechsel. „Es war sehr aufwühlend, als die Kinder und Enkel ihre Eltern und Großeltern nach ihren Geschichten zu fragen begannen“, erzählt Vallejo. „Die bestialische Repression hatte Angst und Schrecken verbreitet, Schweigen war eine Frage des Überlebens, und das wurde auf die nächste Generation übertragen.“ Mit der Öffnung der Massengräber bekamen die Vereine immer mehr Zulauf, da es so viele Familien gab, die Verschwundene zu beklagen hatten.

File:Bundesarchiv Bild 183-L15327, Spanien, Heinrich Himmler bei Franco.jpg

Unter dem Druck dieser Bewegung verabschiedete die PSOE 2007 das erste landesweite Gesetz zum historischen Gedenken. Es schrieb vor, die Massengräber zu lokalisieren und zu untersuchen, den Zugang zu den Archiven zu öffnen und franquistische Symbole aus dem öffentlichen Raum zu entfernen. Die Vereine kritisierten, dass das Gesetz die politisch motivierten Urteile und Strafen unter Franco lediglich für „ungesetzmäßig“ erklärte, ohne sie zu revidieren. Später wurden unter der Regierung von Mariano Rajoy (PP) sämtliche Gelder für die Erinnerungsarbeit gestrichen.

Im Jahr 2008 hatte der Richter Baltasar Garzón begonnen, in Fällen von gewaltsamem Verschwinden zu ermitteln. Diese Verfahren scheiterten. Daraufhin reichten zwei Nachkommen von Opfern der Franco-Diktatur 2010 in Argentinien Klage ein. Eine argentinische Richterin erklärte sich für zuständig, im Namen des Universalitätsprinzips zu ermitteln. Doch Spanien gab ihren Ersuchen, die Verdächtigen zu verhören, niemals statt, obwohl interna­tio­na­le Haftbefehle gegen sie erlassen worden waren.

Der „Querella Argentina“ (argentinische Streitsache) haben sich inzwischen fast 9000 Kläger angeschlossen.5 Zu ihnen zählt auch José María Galante vom Verein La Comuna; er war Mitglied der Revolutionären Kommunistischen Liga Spaniens und wurde als Student wegen gewerkschaftlicher Aktivitäten verhaftet: „Ich wurde dreimal verurteilt und gefoltert, ich habe fünf Jahre meines Lebens im Gefängnis verbracht, und keiner der Verantwortlichen wurde jemals vor Gericht gestellt“, berichtet er.

Quelle          :          Le Monde diplomatique           >>>>>        weiterlesen

——————————————————————

Grafikquellen         :

Oben            —         Valle de los Caídos (Valley of the Fallen), viewed from the esplanade.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-L15327 / CC-BY-SA 3.0

 

Abgelegt unter Europa, Kriegspolitik, Positionen, Schicksale | Keine Kommentare »

Die autoritäre Welle stoppen

Erstellt von DL-Redaktion am 17. November 2019

Ein Plädoyer für politische Geistesgegenwart

WirSindAachenElisengartenVorRechterDemo s8202.jpg

Von Claus Leggwies

Um die Demokratie steht es so schlecht wie ums Weltklima. Man muss die Opposition gegen Antidemokraten scharf markieren – und als Ultima Ratio Widerstand leisten.

ürzlich, während einer gut besuchten Konferenz des Online-Magazins Eurozine in der Heinrich-Böll-Stiftung, machte sich Resignation breit, als die Resultate von ’89 begutachtet wurden: Repression im Osten, wo völkisch-autoritäre Nationalisten die Revolution gekapert haben, Depression im Westen, wo man dem Verfall der Demokratie ziemlich hilflos zuschaut.

Am Abend aber sollte ein anderer Ton angeschlagen werden, nach dem Motto: Vergesst für einen Moment 1989, wer leistet heute Widerstand? Dóra Papp, Kampagnenleiterin der ungarischen Bürgerplattform „aHang“ (Die Stimme), berichtete, wie es in Budapest gelungen ist, einen nicht zu Orbáns Machtclique gehörigen Oberbürgermeister ins Amt zu bringen: Opposition durch Allianzbildung. Radu Vancu, Dichter-Professor aus Sibiu, erzählte, wie die von ihm mitbegründete Bewegung „Va vedem“ (Wir sehen euch) durch beharrlichen, am Ende schweigenden Protest das hyperkorrupte Regime in Rumänien ins Wanken brachte: Protest der Ehrlichen. Helena Marschall, als 17-jährige Schülerin Organisatorin von Fridays for Future aus Frankfurt, legte dar, wie bunt der große Streik am 29. November ablaufen könnte: Widerstand durch zivilen Ungehorsam.

Drei Positionen, die Hoffnung machen, weil sich junge Leute der autoritären Welle entgegenstellen. Sie haben mächtige Gegner: eine verzagte Groko in Berlin und den penetranten Leugner im Weißen Haus; von der Korruption ermüdete Gesellschaften, deren Eliten nicht einfach abdanken werden; Potentaten wie Orbán, die immer wieder Mehrheiten erobern, indem sie gegen Brüssel, Juden, „Gender-Faschisten“ und „Klima-Kommunisten“ hetzen. In Budapest und Bukarest geht es um elementare Bürgerfreiheiten, doch ökologische Forderungen, denen Fridays for Future und Extinction Rebellion eine neue Dringlichkeit verliehen haben, stehen ebenso auf den Transparenten. Demokratie und Klimaschutz gehören zusammen.

Von Santiago über Beirut bis Hongkong regt sich gerade ein gewaltiger Zorn, der leicht zu kapern ist, wenn sich auch Rechtsradikale gelbe Westen überstreifen oder Schwarzvermummte friedliche Klimamärsche aufmischen. Was also ist legitimer Widerstand? „Protest ist, wenn ich sage, das und das passt mir nicht. Widerstand ist, wenn ich dafür sorge, dass das, was mir nicht passt, nicht länger geschieht. Protest ist, wenn ich sage, ich mache nicht mehr mit. Widerstand ist, wenn ich dafür sorge, dass alle andern auch nicht mehr mitmachen.“ Die Definition hatte Ulrike Meinhof im Frühjahr 1968 von einem Black Panther übernommen und für sich den irren Schluss gezogen, in den bewaffneten Untergrund zu gehen. Heute entwickeln eher rechte Identitäre ein hohles Widerstandspathos gegen den angeblich von der Regierung Merkel angezettelten „Großen Bevölkerungsaustausch“, und diese Paranoia agieren Rechtsterroristen in Mordaktionen gegen Juden, Muslime, Flüchtlinge und Politiker aus.

In seinem Geburtsort Hermaringen wurde jetzt endlich eine Gedenktafel für den Hitler-Attentäter Georg Elser enthüllt. Bundespräsident Steinmeier sieht das Recht auf Widerstand nicht zuletzt dank dieser einzelnen Tat eines einfachen Mannes in Artikel 20, Absatz 4 des Grundgesetzes eingeschrieben: „Gegen jeden, der es unternimmt, [die demokratische] Ordnung zu beseitigen, haben alle Deutschen das Recht zum Widerstand, wenn andere Abhilfe nicht möglich ist.“

Kundgebung Mehmet Turgut.jpg

Konkret heißt das doch: Würde die völkisch-autoritäre Usurpation auch in Deutschland stattfinden, kann dieser Absatz kein toter Buchstabe bleiben. Diverse Protagonisten zivilen Ungehorsams haben einen ganzen Katalog möglicher Maßnahmen ausgebreitet, der 1989 ff. in den Farben- und Majdan-Revolutionen im östlichen Europa zur Anwendung kam und herangezogen werden kann, wenn sich in Sachen Klima- und Artenschutz weiter so wenig tut.

Widerstand ist eine ultima ratio, wenn Oppositionelle als „Feinde des Volkes“ (Donald Trump) denunziert werden, faire Wahlen nicht mehr stattfinden, Presse- und Versammlungsfreiheit eingeschränkt wird und die Gewaltenteilung außer Kraft gesetzt ist. Das ist in Russland und der Türkei schon der Fall, in Ungarn und Polen weit gediehen und in den USA auf schlechtem Wege. An diesen Fällen erweisen sich die Schwierigkeiten, amtierenden Autokraten eine in Wahlen erfolgreiche Alternative entgegenzustellen. Linke und Liberale gehen unterschiedliche Wege und finden keine allseits akzeptablen Gegenkandidat*innen.

Quelle       :          TAZ         >>>>>         weiterlesen

———————————————————————

Grafikquellen         :

Oben       —            Wir sind Aachen-Protestplakat am Morgen vor einer angekündigten rechtsextremen Demonstration[1] in Aachen. Blick vom Elisengarten Richtung Nordost auf Aachener Dom und Geldbrunnen

  • CC BY-SA 3.0 deview terms
  • File:WirSindAachenElisengartenVorRechterDemo s8202.jpg

 

—————————

Unten          —         Kundgebung in Rostock vor der Bürgerschaftssitzung über den Entscheid zur Errichtung einer Gedenkstätte.

Abgelegt unter Friedenspolitik, Innere Sicherheit, Mensch, Opposition | Keine Kommentare »

Der Begriff der Herrschaft

Erstellt von DL-Redaktion am 17. November 2019

Ohne Herrschaft ginge vieles nicht
und das wäre gut so!

File:Moscow City - 2009-08.jpg

Quelle          :          untergrund-blättle  CH.

Von  Jörg Bergstedt Gruppe Gegenbilder

Grundanforderungen emanzipatorischer Politik.  Der folgende Text ist der Versuch, den Begriff der Herrschaft zu fassen und einen Rahmen zu stecken für die Debatte um herrschaftsfreie Gesellschaft. Zudem soll er die Rahmenbedingungen und Strategien emanzipatorischer Politik ausleuchten und ansatzweise abstecken.

Der Text steht neben anderen, die das Phänomen „Herrschaft“ zu beschreiben versucht haben – unterscheidet sich aber vor allem dadurch, dass er sehr stark auf eine Praxis gesellschaftlicher Veränderung und gesellschaftlichen Handelns ausgerichtet ist.

Eine bessere Welt – das reicht

Eine Gesellschaft „Freier Menschen in Freien Vereinbarungen“ ist eine konkrete Utopie, deren genaue Form nicht abgeschätzt werden kann. Zu gross ist der Unterschied zu den herrschaftsförmigen Gesellschaften der Gegenwart und Vergangenheit – und damit zu schwierig die Vorhersagbarkeit des individuellen und sozialen Verhaltens von Menschen ohne Zwangsverhältnisse. Anzunehmen ist, ist nach einem Prozess des Abbau bekannter Herrschaftsverhältnisse noch weitere zum Vorschein kommen – die Emanzipation, d.h. die Loslösung und Überwindung von Zwängen, von Herrschaft und Beherrschung aller Art, wird ein langer, wahrscheinlich immerwährender Prozess.

Der Entwurf einer einheitlichen Utopie als zukünftiger Gesellschaftsform im herrschaftsförmigen Hier und Jetzt würde eine Vorgabe sein, die eher eine Beschränkung als einer Befreiung gleich käme. Daher sind Zukunftsentwürfe nur Möglichkeiten, jedoch ihre Beschreibung wichtig, da sie beschreiben – wenn auch aus der aktuellen Perspektive -, dass schon jetzt herrschaftsärmere Entwicklungen denkbar und erstrebenswert sind.

Eine abschliessende Diskussion über die Details, über Machbarkeit und notwendige Vereinbarungen in der Zukunft wird angesichts des durch Herrschaftsverhältnisse beschränkten Horizontes, der eigenen Zurichtung auf herrschaftsförmige Wahrnehmung von Menschen und Gesellschaft sowie der nicht vorhandenen Erfahrungen kaum zu führen sein. Viele Möglichkeiten werden aus der heutigen Sicht gar nicht vorstellbar sein, so dass eine Festlegung einer Selbstbeschränkung gleich käme.

Zudem muss noch ein weiteres Hindernis in der Diskussion ausgeräumt werden. Eine Analyse von Herrschaft und der Entwurf von Ideen und Konzepten einer herrschaftsfreien Gesellschaft muss nicht zu einer perfekten Welt führen.Es reicht, gegenüber dem heutigen Zustand erstens eine spürbare Abnahme von gewaltförmigen Beziehungen zwischen Menschen zu erlangen und zweitens die Situation so zu gestalten, dass ein immerwährender Prozess möglich ist. Das würde reichen, um die Entwürfe als erstrebenswert zu empfinden und dafür einzutreten.

Worum geht es?

Die Fragestellung nach einer herrschaftsfreien Gesellschaft ist also nicht die nach dessen exakter Form. „Wie sieht eine utopische Gesellschaft aus?“ ist zwar eine interessante Frage und bietet viel Raum für anregende Diskussionen. Wichtiger aber ist die nach den Verhältnissen, unter denen sich Gesellschaft entwickelt: Was stärkt heute und in herrschaftsförmigen Gesellschaften die Konkurrenz und untergräbt Kooperation?

Was fördert gewaltförmiges Verhalten und Herrschaft zwischen Menschen? Umgekehrt, d.h. positiv formuliert für die gewollte Utopie, lautet die Frage: Welche Rahmenbedingungen fördern kooperatives und behindern konkurrierendes Verhalten? Unter welchen Bedingungen gehen Menschen gleichberechtigt miteinander um, entwickeln ihre eigenen Potentiale, aber organisieren die eigene Selbstentfaltung so, dass sich die anderen Menschen auch selbst entfalten können?

Der Mensch ist ein Wolf – wir brauchen den Staat?

Bei der Beantwortung solcher Fragen kommen viele Menschen zu der Auffassung, dass nur eine starke Moral den Menschen bändigen kann. Der Egoismus des Menschen stehe der Neigung zur Kooperation gegenüber – als Gegenmittel werden der Staat als aufklärerisch-kontrollierender Überbau, eine Religion oder der Appell an die Selbstzügelung genannt.

Doch hinter diesen Auffassungen verbergen sich zwei entscheidende Irrtümer: • Alle Versuche, statt dem vom Egoismus angetriebenen Menschen ein soziales und am Interesse anderer Wesen zu schaffen, sind Formen der Fremdbestimmung – selbst wenn appellativ an das Gute im Innern angeknüpft werden sollte. Denn schlechtes Gewissen ist Fremdbestimmung, es orientiert sich an Erwartungshaltungen anderer, an Angst und normativen Setzungen. Gesetze, Moral, Esoterik und Religion sind ohnehin Wertesysteme, die von aussen kommen und den Menschen steuern.

• Den Egoismus überwinden zu wollen, bedeutet den Verzicht auf den impulsivsten, energiegeladensten Antrieb des Menschen. Der Versuch wird meistens scheitern, weil der Egoismus zu stark ist. Wo er gebrochen wird, bleibt oft ein kraftloses, persönlichkeitsschwaches Wesen zurück.

Der Egoismus als Triebfeder

Tatsächlich wäre wichtig, genau das stark zu machen und kooperativ zu nutzen, was den Menschen im Kern antreibt: Sein Egoismus, der Wille nach einem besseren Leben, das Bedürfnis nach Sicherheit bzw. Geborgenheit, Lust und Befriedigung, Selbstentfaltung und Innovation – alles also Ziele, die vom Egoismus gespeist werden. Die gesellschaftlichen Rahmenbedingungen müssen so sein, dass diese Motivation die freie Kooperation fördert.

Wenn es besser für ein gutes Leben usw., kooperativ zu handeln, dann wird das auch eher geschehen. Gesucht sind also Rahmenbedingungen, unter denen der Antrieb zu einem besseren Leben, der Egoismus der Menschen, weitestmöglich das kooperative Verhalten fördert und konkurrierende Beziehungen verdrängt. Mit dieser Sichtweise erledigt sich auch die Frage nach dem Menschenbild.

Was ist der Mensch? Ist er gut oder schlecht, wenn er von Zwängen befreit ist? Mit der Idee der „Freien Menschen in Freien Vereinbarungen“ werden nicht die Menschen beschrieben, sondern die Rahmenbedingungen.

Es geht um die Frage, welche Rahmenbedingungen maximal kooperatives Verhalten fördern und welche eher konkurrierendes, Dominanz ausübendes Verhalten hervorbringen. Für dieses Ziel ist unerheblich, wie der Mensch an sich ist.

So oder so ist das Ziel, kooperatives gegenüber konkurrierendem Verhalten attraktiv zu machen. Das Ergebnis wird der Prozess zu immer mehr kooperativ-gleichberechtigten Beziehungen zwischen Menschen und der Abbau von Konkurrenz und gewaltförmigen Verhältnissen sein – von welchem Menschenbild und welcher Anfangssituation auch immer ausgegangen wird.

Die erhoffte Verbesserung, das mehr an Kooperation und das weniger an Konkurrenz ist die ausreichende Motivation zum Handeln.

Was fördert Konkurrenz?

Konkurrenz und Kooperation sind keine neuen Formen menschlichen Miteinanders. Sie finden im Hier und Jetzt bereits statt. Sichtbar ist auch heute bereits, was Konkurrenz fördert und was Kooperation fördert. Das kann erste Anhaltspunkt geben, welche Rahmenbedingungen eine herrschaftsfreie Gesellschaft fördern – und welche sie verhindern.

Das gibt nicht nur Grundlagen für die utopischen Entwürfe, sondern auch Ansatzpunkte für Veränderungen im Alltag und in der politischen Praxis. Zudem bietet sie einen grundlegenden Massstab zur Beurteilung politischer Forderungen und konkreter Projekte.

Daher sollen im folgenden die bereits heute spürbaren Aspekte aufgezählt werden.

• Jede Form institutioneller Herrschaft fördert Konkurrenz, weil in der Position des/r Herrschenden die Ausübung von Konkurrenz einfacher möglich ist. Zudem lassen sich die Folgen besser abschätzen. Wer also z.B. ein Interesse an einem Stück Land, einem Produkt, einem Rohstoff u.ä. hat, kann leichter konkurrierend agieren (statt sich mit anderen Menschen gleichberechtigt zu einigen), wenn eine durchsetzungsstarke Herrschaftsstruktur das konkurrierende, d.h. andere ungefragt benachteiligende Verhalten absichert.

Entweder die Person oder Gruppe ist selbst in einer herrschenden Position oder kann per behördlichem Verfahren einen Rechtsanspruch absichern (Kauf, Genehmigung …) und somit gegen KonkurrentInnen mit den Apparaten der Herrschaft drohen. In allen diesen Fällen ist konkurrierendes Verhalten einfach möglich, zudem können Folgen wie Proteste durch die Repressionsorgane der benutzten Herrschaftsstruktur zurückgewiesen oder per Einschüchterung vorab verhindert werden.

• Marktförmige Herrschaftsverhältnisse wie materielle Abhängigkeiten fördern ebenfalls die Konkurrenz. Wer keine Chance hat, sich selbst ausserhalb der herrschaftsförmigen Beziehung (z.B. zum Arbeitgeber, LandbesitzerIn u.ä.) zu organisieren, ist auf die Kooperation angewiesen – kann also nicht ohne erhebliche Gefahren aus ihr aussteigen. Das sichert wiederum die Person, die über den bevorzugten Zugang zu Ressourcen verfügt, ab. Sie kann sich meist beliebig konkurrierend verhalten, weil sie in der überlegenen Position ist.

• Unterschiedliche Handlungsmöglichkeiten fördern Konkurrenz. Wer über mehr Zeit, Wissen, Kraft, Geld, andere Ressourcen, Beziehungen usw. verfügt, kann im Kontakt mit anderen Menschen dieses unter Bedingungen stellen und somit oftmals die Regeln diktieren, unter denen dieses „Mehr“ zur Verfügung gestellt werden kann. Der „Tauschwert“ der Person und seines Besitzes sind grösser.

• Fremdbestimmte sowie nicht oder nur schwer trennbare Beziehungen zwischen Menschen brechen Selbstbestimmung und schaffen Zwang statt freier Kooperation, z.B. Kleinfamilien, Zwangsverwandtschaft, Ehe, aber auch ArbeitnehmerInnenschaft, Schulklassen usw.

• Herrschaft verringert Kommunikation, weil diese unnötig wird. Handlungen, die durch Herrschaft abgesichert sind, bedürfen weder der Zustimmung noch überhaupt der Kommunikation mit betroffenen oder aus anderen Gründen interessierten Menschen. Die Folgen eines durch Herrschaft abgestützten Verhaltens können ohne Absprache bzw. Zustimmung der Betroffenen auf andere Menschen abgewälzt werden. Auf diesem Prinzip basiert im Kern die Zerstörung der Umwelt, denn diese bedeutet auch immer eine Zerstörung oder Einschränkung der natürlichen Lebensgrundlagen und der Qualität des Lebensumfeldes von Menschen.

Alle Herrschaftsformen wirken konkurrenzsteigernd und antiemanzipatorisch, aber sie unterscheiden sich dadurch, dass einige auf sozialisierten, aber willensmässig veränderbaren Haltungen beruhen, andere wie Staat und Marktzwang eine über das individuelle hinausgehende Systemhaftigkeit haben, u.a. die Selbstverwertung des Wertes oder der Hang von Herrschaft zur eigenen Ausdehnung zwecks Selbstabsicherung.

Was fördert Kooperation?

Kooperation hat überall dort eine bessere Chance, wo solche oder vergleichbare Bedingungen fehlen. Kooperation und Konkurrenz bilden dabei eine Spanne – mit den beiden (utopischen) Polen der totalen Fremdbestimmung und der freien Gesellschaft. Je nach Bedingungen können sich individuelle und gesellschaftliche Verhältnisse dem einen oder anderen Pol annähern.

Das Bild der Spanne zwischen Kooperation und Konkurrenz ist beliebig oft wiederholbar – in den Beziehungen des Alltag, in der materiellen Reproduktion (Arbeit, Haushalt, Konsum), in politischen oder anderen Gruppen, in Projekten oder im gesellschaftlichen Umfeld (informelle Kontakte, gesellschaftliche Arbeitsteilung, Verwaltungen, Staat). Jegliches Herrschaftsverhältnis stärkt Konkurrenz.

Verschärfung von Herrschaftsverhältnissen, Ausbau von Herrschaftsstrukturen, neue Erwartungshaltungen usw. verändert die Situation immer stärker zum konkurrierenden Pol, während der Abbau von all diesem die Kooperation stärkt. Wo Herrschaft in all seinen Facetten fehlt, existiert nur noch die Gesellschaft der „Freien Menschen in Freien Vereinbarungen“.

Antrieb dafür ist der Egoismus als Drang zum besseren Leben. Innerhalb von Herrschaft ist ein besseres Leben meist über Konkurrenz organisierbar. Was ich habe, hat jemand anders nicht – egal ob das Eis, der Arbeitsplatz, die/der PartnerIn oder ein Buch. Die Verrechtlichung mit den dahinterstehenden Herrschaftsstrukturen schafft diese Situation. In einer herrschafts- und (damit einhergehend) verwertungsfreien Gesellschaft sieht das anders aus.

Weiterhin bleibt der Egoismus, der Wille zum besseren Leben der Hauptantrieb des Menschen. Nun ist aber alles, weil ein Mensch für sich verbessert, auch eine Chance für alle anderen.

Sie können das Neugeschaffene auch nutzen oder zumindest reproduzieren. Was die/der Einzelne schafft, ist selbst dann ein Vorteil für alle, wenn er/sie es zunächst nur für sich gemacht hat. Und weil das so ist, ist auch die Chance am grössten, die freie Entfaltung aller anderen zu wollen – denn deren Ideen und Produktivität, deren Musik, Kunst oder was auch immer kann mir ebenfalls zum besseren Leben dienen, denn es ist nicht mehr exklusiv.

Beispiele für Rahmenbedingungen, unter denen Egoismus und Kooperation zusammenfallen:

• Wenn alles Wissen frei wäre von Eigentumsrecht in Form von Patenten, Lizenzen, Copyright usw., würde alles, was einmal erfunden oder erdacht ist, sofort allen helfen. Neue Techniken wären theoretisch überall nachbaubar und sogar weiterentwickelbar – so profitiert auch die Person oder Gruppe, die den ersten Schritt gemacht hat, von der Kooperation, weil andere dann ihr Werk verbessern. Und da Technik dem besseren Leben und nicht mehr dem Profit dienen, ist die Chance am grössten, dass sich alle freuen, wenn andere die eigene Idee übernehmen und weiterentwickeln. Auf der Spanne von Konkurrenz und Kooperation ist das komplett freie Wissen ein starker Antrieb Richtung Kooperation.

• Wenn Land und Boden nicht mehr Einzelnen gehören würde, sondern die jeweils in einer Gegend Wohnenden gleichberechtigt darüber entscheiden, würden die Bedürfnisse und Träume der Menschen in den Vordergrund treten. Profitinteressen wären nicht mehr durchsetzungsfähig.

• Wenn Produkte frei wären, müsste nicht mehr jede Person Waren oder Geld (als Gegenwert von Ware) horten, sondern das eigene Leben wäre am besten und auch am sichersten, wenn es einen gemeinsamen Reichtum gäbe, auf den jedeR Einzelne zurückgreifen könnte. Wenn mehr als genug zu essen da ist, ist auch für jeden Menschen genug da, da es keine erzwungene Aufteilung gäbe. Wo dagegen Eigentumsrechte mit Herrschaftsausübung zwischen den Menschen stehen, müssten alle für sich horten und für sich Sicherheit schaffen. Das würde Konkurrenz bedeuten und die Wahrscheinlichkeit steigern, dass tatsächlich einige zu wenig haben würden.

• Offensichtlich ist, dass gesellschaftlicher Reichtum schneller zu erreichen und grösser ist als individueller Reichtum. Wenn alles allen gehört, haben auch alle alles. Unter den Verhältnissen von Privatbesitz muss jede Person selbst alles beschaffen – Essen, Bohrmaschinen (auch wenn nur einmal im Jahr benutzt), Zweitwagen, Abflussreinigungsdraht, Laptop, Eismaschine, Entsafter, Deutsch-Spanisch-Lexikon usw. – und zudem Zeit investieren in die Sicherung des individuellen Reichtums. Sofort könnte schon heute überall ein deutlich grösserer Reichtum entstehen, wenn nur wenige Menschen jeweils als soziale Basisgruppe ihren materiellen Besitz teilen – umfassend ausgestattete Computer- und Werkräume, Küchen und Bibliotheken wären die sofortige Folge.

• Die Effizienz der eigenen Tätigkeit würde steigen, weil Kontroll- und Überwachungstätigkeiten wegfallen würden.

Diese Vorschläge können schon heute verwirklicht werden. Projekte und Forderungen dieser Art wären erste Schritte zu einer herrschaftsfreien Utopie. Diese würde dann die Chancen der Freien Kooperation noch weit deutlicher ausbauen – und damit die Tendenz des Verhaltens von Menschen auf dem Strang von Konkurrenz bis zu Kooperation sehr stark zu letzterer verschieben.

Was ist Herrschaft?

Herrschaft zu beschreiben, ist nicht einfach. Sie ist ein Verhältnis zwischen Menschen, das durch unterschiedliche Möglichkeiten des Handelns gekennzeichnet ist, die gegeneinander gerichtet werden können.

Herrschaft umfasst dabei Mittel der direkten Beherrschung (Gewalt, Entzug der Lebensmöglichkeiten, Freiheitsentzug), der Beeinflussung (gerichtete Kommunikation über Bildung, Medien, Öffentlichkeitsarbeit usw.), institutionalisierte, d.h. dauerhaft, einseitig nicht oder nur schwer aufhebbar unterschiedliche Handlungsmöglichkeiten (Reichtum, Zugang zu Wissen und Ressourcen, körperliche Leistungsfähigkeit usw.) und Selbstbestimmung brechenden Rollenzuweisungen (direkte Anweisung, gesellschaftliche Kategorien und erziehende Zurichtung auf Rollen in Gesellschaft, Arbeitswelt, Familie usw. – oft an Geschlecht, Herkunft, Alter oder Ausbildung orientiert).

File:Frankfurt-Skyline.jpg

Auch die Möglichkeit zur Androhung solcher Mittel oder Fremdbestimmung ist bereits ein Herrschaftsverhältnis. Solche gewaltförmigen oder -bedrohten Beziehungen können zwischen Menschen oder Institutionen und Menschen bestehen und gegeneinander gerichtet werden.

Es gibt verschiedene Definitionen, die versuchen, das komplexe Phänomen Herrschaft zu fassen. Dabei teilen sie die Herrschaft nach ihren Wirkungsprinzipien, nach Herrschenden oder Beherrschten ein. All diese Einteilungen dienen allein dem Versuch, Herrschaft begrifflich zu fassen und damit durchschaubar zu machen.

In der Realität ist die Unterscheidung in verschiedene Herrschaftslogiken nicht vollständig möglich.

Herrschaft wirkt komplex, die verschiedenen Wirkungsformen überlagern und verstärken sich ständig. Es gibt weder eine einfache Einzelform von Herrschaftsausübung noch eine einfache Strategie gegen eine solche, separierbare Herrschaftsform. Auch die im Folgenden entworfene Beschreibung von Herrschaft dient vor allem der besseren Klärung, sie ist nicht tatsächlich so teilbar.

Herrschaft als Institution: Oben und Unten ganz fühlbar

Die bekannteste Form der Herrschaft ist die der direkten Beherrschung. Gewaltanwendung ist die auffälligste von ihnen. Herrschaft per direkter Gewaltanwendung zielt auf momentane oder absolute Unterwerfung der Person(en), gegen die Gewalt angewendet wird.

Beispiele sind Kinder, die von ihren Eltern geschlagen werden, jede andere Form der körperlichen Gewalt zum Zweck der Beherrschung in menschlichen Beziehungen, die zwangsweise Verhaftung durch Polizei oder der erzwungene Aufenthalt in Gefängnis, Psychiatrie u.ä. über Gewalt gegen Menschen bestimmter Hautfarbe, Geschlechter oder sozialem Status bis hin zum Krieg.

Die Androhung der Anwendung von Gewalt wirkt ähnlich der tatsächlichen Anwendung, sie kann daher gleichgesetzt werden. Das gilt auch für das als Drohung wirkende Potential der Gewaltanwendung, selbst wenn keine Drohung ausgesprochen wird.

Die unterschiedlichen Möglichkeiten direkter Gewaltanwendung schaffen schon dann eine Dominanz, wenn eine Anwendung von Gewalt im Bereich des Möglichen und Vorstellbaren liegt. Diese Form ist zwischen Menschen verschiedenen Geschlechts, Nationalität, Alters, Bildungsgrades usw. sowie zwischen Institutionen und von ihnen abhängigen Menschen häufiger als die tatsächliche Anwendung oder Androhung von Gewalt. Sie ist in der Regel nicht nötig, ein Herrschaftsverhältnis entsteht dennoch. Geschieht sie gelegentlich doch, erhöht sie zugleich auch die Glaubwürdigkeit der latenten Drohung.

Zur direkten Herrschaft gehört neben der Androhung von Gewalt in Beziehungen zwischen Personen oder Personengruppen auch die Herrschaft der Institutionen, also der Polizei, Justiz, der Ämter (Ausländeramt, Finanzamt, Baubehörde usw.), Schulen und Hochschulen, des Militärs (zur Zeit noch vor allem gegenüber Menschen und Institutionen im Ausland) usw. Sie verfügen über das Recht, Denken und Handeln von Menschen zu beeinflussen und diese Beeinflussung auch mit der Androhung von Gewalt durchzusetzen.

Diese Form direkter Gewaltanwendung bzw. ihrer Androhung ist zwar nach wie vor stark verbreitet, aber wird in modernen Herrschaftssysteme Stück für Stück durch die Mittel der manipulativen Beeinflussung sowie die Schaffung von Verhältnissen ersetzt, deren Zwang nicht auf direkter Gewalt besteht.

Zumindest ist das das Ziel moderner Herrschaftssysteme, da direkte Gewaltanwendung die dahinterstehenden Herrschaftsformen offensichtlicher werden lässt als Formen der Verhaltenssteuerung ohne direkte Gewaltwendung. In den modernen „Demokratien“ dehnen sich daher die weniger offensichtlichen Herrschaftsformen immer mehr aus, die in den folgenden Punkten beschrieben werden.

Marktförmige Zwänge, Kapitalverteilung und ökonomische Abhängigkeit

Der Mensch braucht Reproduktion und er will Genuss – materielle wie immaterielle. Er kann diese autark (für sich), in kleinen autarken bis umfassend selbstorganisiert-kooperativen Gruppen erreichen (Subsistenz) oder über den Markt. Marktwirtschaft ist eine Verregelung der Befriedigung von Bedürfnissen. Sie schreibt die Formen vor, wie Mensch an Waren und Dienstleistungen kommt – und wie er an den Gegenwert kommt, um wiederum Waren und Dienstleistungen zu erhalten (Geld oder andere Tauschwerte).

Dabei kann der Markt anonym sein, d.h. ProduzentInnen von Waren und KonsumentInnen kennen und begegnen sich nicht, oder direkt, z.B. beim direkten Tausch. In beiden Fällen ist aber das Prinzip von Wert, Wertung und Verwertung voll entwickelt.

Es schafft die Zwänge. Der Markt selbst ist damit eine Herrschaftsform, ein Regelwerk.

Dieses Regelwerk bestimmt Unterschiede zwischen den Menschen. Es gilt die totale Konkurrenz, d.h. im Markt ist es immer so, dass der Vorteil des einen der Nachteil des anderen (meist eines Dritten, nicht der direkt Handelnden) ist. Das ist oft sehr brutal, weil es Menschen in materielle Not und Abhängigkeit treibt. Die aktuelle Politik des Neoliberalismus hat zudem totalitären Charakter, weil es die Regeln des Marktes in jeder Region der Welt und auf jede Lebenssituation ausdehnen will. Die Verbindung mit den direkten Herrschaftsformen ist eng: Ohne direkte Herrschaftsformen gäbe es keinen Markt.

Die Verwertung basiert auf Eigentumsrecht und den Zwang zur Verwertung im sogenannten „freien Markt“. Hinter diesem Zwang stehen direkte Herrschaftsverhältnisse.

Daher gibt es Zweifel, ob die marktförmige Herrschaft, die Kapitalverhältnisse und der Verwertungszwang überhaupt als besondere Herrschaftslogik abgetrennt werden können. Dieser Zweifel ist berechtigt – kein Markt ohne Staat (oder eine ähnlich wirkende Herrschaftsform).

Daher sind auch alle politischen Strategien, den Markt über eine Stärkung des Staates (Reregulierung, Steuern, Gesetze usw.) einzuschränken, schon vom Ansatz hier falsch. Dennoch scheint berechtigt, diese Herrschaftsform von der personalen zu unterscheiden.

Sie funktionieren zwar auf der Basis und mit ständiger Androhung personaler Herrschaftsverhältnisse, wirken aber auch dort fort, wo diese nicht selbst sichtbar werden. Der Markt ist ein Regelwerk, dass aufgrund allgemeiner Akzeptanz sehr reibungslos funktioniert – trotz seiner offensichtlichen Brutalität für die VerliererInnen sowie den Zwang zur fremdbestimmten Ausbeutung von Denk- und Arbeitskraft fast aller Menschen.

Die dauernde Zuschreibung von Werten für alle materiellen Dinge (Stoffe, Produkte, immer mehr auch des Menschen, seiner Organe, Arbeits- und Zeugungsfähigkeit, Gene usw.) und allen Wissens zum Zweck der Verwertung, also des Kaufs und Verkaufs, der Mehrwertabschöpfung, des Tauschs oder der Kapitalakkumulation kommt einer kontinuierlichen, sich selbst reproduzierenden Verwertungs“maschine“ gleich.

Machbarkeitsorientierung statt Verwirklichung von Hoffnungen

Eng zusammen mit allen anderen Herrschaftsformen und durchaus auch als Ausdrucksform der anderen zu begreifen ist der Aspekt, dass Menschen nicht das tun, wonach sie sich sehnen und was sie wollen, sondern nach dem, was unter den gegebenen Umständen als machbar erscheint und wozu der Mut reicht. Die Alltagsgestaltung der meisten Menschen ist eine Aneinanderreihung von Handlungen, die mit ihren eigenen Vorstellungen, wie sich ihr Leben entwickeln soll, wenig zu tun hat.

Entscheidender Richtungsgeber ist vielmehr die Gesamtheit der äusseren Einflüsse – von Verboten und Drohungen über wirtschaftliche (Schein-)Machbarkeit bis zu Ängsten vor sozialer Isolation, Risiken, Unsicherheiten usw.

Praktisch unterbleiben meist schon die Versuche, eigene Sehnsüchte oder Utopien, oft aber auch nur ganz kleine Veränderungen umzusetzen, dass heisst ein Stadium, in dem Scheitern oder Erfolg möglich würden, wird gar nicht erst erreicht. Die Orientierung am scheinbar Möglichen und Angesagten wird im Laufe der Zeit zur neuen Normalität, als Handlungsimpuls verbleibt die Abweichung vom eigentlich Gewünschten. Eine permanente Verdrängung der Enttäuschung begleitet das Dasein, wird aber ebenfalls zur neuen Normalität.

Die Herrschaft in den Köpfen: Diskurs, Kategorien, Erwartungen, Standards

Markt und institutionelle Herrschaft (vor allem der Staat und von ihm legitimierte Institutionen) sind direkt sicht- und spürbar. Doch Herrschaft ist komplexer. Durch gesellschaftliche Zurichtung (Erziehung, Erwartungshaltungen, Anschauung gesellschaftlicher Praxis als „Normalität“), Sprache, gerichtete Kommunikation und die Propagierung von Standards (technische Normen, „das machen alle so“ oder „so ist das nun mal“, Verhaltenskodex usw.) entstehen Fremdbestimmung und unterschiedliches Wertigkeitsempfinden zwischen Menschen.

Alle werden in ihrem Leben für eine bestimmte soziale „Rolle“ beeinflusst, d.h. „konstruiert“ wurden.

Frauen gegenüber Männern, Jugendliche gegenüber Erwachsenen, Menschen ohne Abschluss gegenüber solchen mit akademischem Grad, Arme gegenüber Reichen, ArbeitnehmerInnen gegenüber ArbeitgeberInnen oder Selbständigen, sog. Behinderte gegenüber „Gesunden“, Nichtdeutsche gegenüber Deutschen (und jeweils umgekehrt) – diese und viele Unterschiede bestehen auch dann, wenn Menschen frei aller sonstigen Herrschaftsverhältnisse wären. Das ist nicht Schuld der Menschen oder ihrer Zusammenschlüsse, aber nichtsdestotrotz der Fall. Es ist auch nicht einheitlich, denn die oben genannten Personenkreise sind keine einheitlichen Gruppen – aber in der Tendenz sind sie gesellschaftlich „konstruiert“, d.h. ihnen wird über Jahre und Jahrzehnte eine gesellschaftliche Rolle, Erwartungshaltung und ein Selbstwertgefühl vermittelt. Innerhalb dessen leben sie „funktional“ in den realen Gesellschaftsverhältnissen, d.h. sie empfinden ihre Position als richtig für sich selbst, nehmen sie deshalb nicht mehr als konstruiert wahr und wehren sich nicht gegen diese.

Die Verbindung mit direkten und marktförmigen Herrschaftsformen: Diskurse sind beeinflussbar – über Bildung, Medien, Streuung gezielter Informationen sowie über Wissenschaft. Gerade letztere hat viel dazu beigetragen, biologistische Normen zu schaffen. Dass Frauen gefühlsbetonter sind, dass Schwarze sportlicher, aber weniger intelligent sind, dass Minderjährige nicht mündig sind, was als behindert gilt – all das hat seinen Hintergrund in wissenschaftlichen Diskursen und dem ständigen Weitertragen im Alltag.

File:Athens skyline.JPG

Die Institutionen der Herrschaft nutzen die Diskurse und beeinflussen sie über ihre herausgehobenen Möglichkeiten. Beispiele der letzten Jahre sind die humanitären Kriegen (weitgehend gelungener Diskurs), der Wohlstand durch globale Märkte (in grossen Teil gescheitert, weil offensive Proteste ihrerseits wieder Diskurse stark prägten) oder das Gute an der Demokratie einschliesslich der Verschleierung ihrer Herrschaftsförmigkeit (weitgehend gelungen).

Zu unterscheiden ist Herrschaft von den Begriffen „Macht“ und „Möglichkeit“. Macht bezeichnet die Möglichkeit zur direkten Ausübung von Zwang gegenüber anderen Menschen, die aber nicht kontinuierlich auf den bestehenden Rahmenbedingungen beruht, sondern auf das konkrete Verhältnis zwischen den Menschen bzw. einzelnen Gruppen.

Zudem wird der Begriff auch im Sinne von „Möglichkeiten“ benutzt: „Ich habe die Macht zu …“. Dabei wird nicht mehr zwingend von einem Verhältnis zwischen Menschen ausgegangen, sondern in dieser Bedeutung ähnelt Macht dem Begriff „Fähigkeit“. Für eine emanzipatorische Debatte erscheint das Wort „Möglichkeit“ zielgenauer.

Mit „gleichberechtigte Möglichkeit“ z.B. zur Reproduktion, zur Rohstoffnutzung usw. ist dann gemeint, dass die Menschen auf alle gesellschaftlichen Ressourcen gleichberechtigt zugreifen können, d.h. die Vielfalt der Welt und die unterschiedlichen Lebensentwürfe entstehen durch freien Willen – nicht mehr durch soziale Herkunft, Reichtum usw.

Die Konstruktion und Instrumentalisierung kollektiver Identitäten

Menschen treten nicht nur als Individuum, sondern auch als Gruppe auf. Nur in wenigen Fällen jedoch sind diese Gruppen das Ergebnis freier Vereinbarung, also die gleichberechtigte Einigung auf eine gemeinsame Organisierung unter Sicherung der Autonomie des Einzelnen.

Die meisten Gruppen basieren auf der Schaffung kollektiver Identität und/oder der Erzwingung der Mitwirkung in einer Gruppe. Kollektive Identität: Durch Festlegung scheinbar gemeinsamer Eigenschaften der zu einer identitären Gruppe zusammengefassten Menschen entsteht ein Kollektiv. Regelmässig ist das verbunden mit einem offensiven Bezug auf das „Wir“ im Sinne einer Konstruktion des gemeinsamen Seins und des gemeinsamen Willens.

Typisch ist zudem die Abgrenzung gegen das Andere – oft ist diese Abgrenzung der Hauptvorgang der Bildung kollektiver Identität.

Daher ist Ausgrenzung in einer Gesellschaft kollektiver Identitäten der Normalzustand und findet auf allen Ebenen der Gesellschaft und in fast allen Gruppen und Zusammenhängen von Menschen (gesellschaftliche Subräume) statt.

Kollektive Identität besteht aus der Definierung des Identitäres, also des die Menschen Verbindenden. Hier können diskursive Herrschaftselemente wie die Zurichtung auf Geschlecht, sozialer Gruppe, Nation, Verein usw. ebenso wirken wie die Entwicklung bestimmter Verhaltens-, Kleidungs- oder Sprachcodes als verbindendes Element einer identitären Gruppe. Sympathie und Antipathie beruhen auf diesen Identitäten.

Abgrenzung gegen das „Andere“ schärft das Erleben des Menschen mit gleichen Eigenschaften als soziales Umfeld. Das Kollektive entsteht durch die Wahrnehmung und Formulierung des Identitären als Gleiches und Gemeinsames. Am häufigsten geschieht das durch den Einsatz des Wortes „Wir“ – verstärkt wiederum in Verbindung mit der Abgrenzung gegenüber dem Anderen als „Ihr“ oder „Du“.

„Wir“ bezeichnet dann eine kollektive Identität, wenn es nicht einen tatsächlichen Ablauf beschreibt („Wir waren gestern in X-Stadt“ oder „wir haben überlegt, die und die Sache jetzt zu machen“), sondern als vereinnahmendes Wort genutzt wird, d.h. also durch die Nutzung die Kollektivität hergestellt wird. Ein solches „Wir“ schafft erst den gemeinsamen Willen. Daher ist es ein typischer Teil dominanten Sprachstils, als „Wir“ zu sprechen und damit eine Entscheidungsfindung oder eine Vielfalt selbstbestimmter Meinungen durch eine kollektive Identität zu ersetzen.

Allerdings sind auch andere Sprachformen als das „Wir“ möglich, z.B. der Verweis auf Traditionen („Es ist schon immer so gewesen“ u.ä.). Auch hier wird Einheitlichkeit dadurch hergestellt, dass sie beschrieben wird. Ein kollektiv-identitäres „Wir“ unterscheidet sich vom beschreibenden „Wir“ also dadurch, dass der zeitliche Ablauf umgekehrt ist. Das beschreibende „Wir“ versucht, einen Prozess im Nachhinein zu beschreiben.

Das kollektiv-identitäre „Wir“ schafft die Einheitlichkeit durch die Benutzung des „Wir“. Erzwungene Mitgliedschaft in Gruppen: Teil eines Kollektivs zu sein, ohne gefragt zu werden bzw. sich dazu frei entscheiden zu können, ist immer Herrschaft. Solcher Zwang entsteht durch Definition ohne Rücksprache, z.B. die Festlegung von Nationalität, Geschlecht, die Anmeldung an einer Schule, in einem Verein oder die nicht lösbare Bindung in eine Familie.

Vor allem für jüngere Menschen ist diese Ausübung von Zwang alltäglich. Ebenso entsteht Zwang, wenn es keine Alternative zur Mitgliedschaft in einer Gruppe gibt oder ein Verzicht mit erheblichen Nachteilen verbunden wäre. Schliesslich führen Vermischungen mit anderen Typen von Herrschaft zu Zwängen, z.B. die Zurichtung durch Erziehung, Medien usw. in einer Weise, die Menschen so konditioniert, dass sie sich zum Teil einer Gruppe machen.

Kollektive Identitäten und erzwungene Mitgliedschaften erfordern die Existenz von Personen, die die Identität (das „Wir“) definieren oder einen Zwang ausüben. Sie sind niemals Ergebnis eines gleichberechtigten Einigungsprozesses, also einer Organisierung von unten.

Diese würde immer klären, dass die sich organisierenden Menschen je nach Fragestellung unterschiedliche Auffassungen haben und niemand in der Lage wäre, ohne Klärung der Auffassungen in einem Sprachstil des „Wir“ aufzutreten.

Beispiele für kollektive Identitäten:

• Volk und Vaterland: Beide entstehen durch die Konstruktion einer kollektiven Identität über die Beschreibung scheinbarer gleicher Eigenschaften, Traditionen, Umwelt, Fähigkeiten usw. sowie die Abgrenzung gegen das Andere, was von aussen kommt und das „Wir“ direkt oder zumindest in der völkischen Reinheit bedroht.

Ein Volk entsteht nie durch die Einigung von Menschen darauf, ein Volk sein zu wollen, sondern durch Benennung des Kollektivs und der Benutzung des „Wir“ als kollektive Identität. „Wir Deutschen“ ist das Ergebnis einer Organisierung von Menschen zwischen Flensburg und Konstanz, sondern eine Formulierung, die die Identität erst schafft.

• Nation: Im Gegensatz zum Volk ist die Nationalität eine erzwungene Mitgliedschaft durch formalen Akt in der Regel bei der Geburt. Sie ist herrschaftsförmig, weil zumindest kraft Geburt ohne Einwilligung durch die betroffene Person. Ähnlich wirkt die Zwangszugehörigkeit zu einer Familie, einer Religion, einem Geschlecht u.ä., die oft auch bereits bei der Geburt entschieden wird und ab dann das Leben prägt.

• Identitäre Gruppen: Die meisten Cliquen, religiösen oder politischen Gruppen sind identitäre Kollektive, denn ihre Mitglieder unterwerfen sich mehr oder weniger deutlichen Codes an Verhalten, Sprache und manchmal sogar Aussehen (Kleidung, Frisur). Zudem gibt es meist ein „Wir“, das über ein beschreibendes Wort hinausgeht, und klare Unterschiede darin, wer dieses „Wir“ wie einsetzt und damit die Identität der Gruppe prägt.

Es ist Standard auch und gerade in politischen Zusammenhängen, dass einige Menschen privilegiert sind, Verhalten, Organisierungsform und politische Position der Gruppe zu definieren – nach aussen und nach innen. Ständige Aus- und Abgrenzungen gegenüber dem „Anderen“ sind die wenig überraschende Begleiterscheinung und zeigen nicht nur die herrschaftsförmige Organisierung, sondern sind für diese auch wichtig.

Denken in der Metaebene und ihr Fehlen

Eigentlich zeichnet genau das den Menschen aus und unterscheidet ihn nach dem Stand der Wissenschaft grundlegend von allen anderen Lebewesen: Er kann sich ausserhalb seiner selbst stellen und quasi aus der Vogelperspektive sich selbst und sein Umfeld betrachten. Dadurch sind Reflexionen des eigenen Handelns, das Planen von Strategien, das Abschätzen zukünftiger Entwicklungen und das Abwägen verschiedener Optionen möglich.

Tatsächlich verzichten die meisten Menschen in fast allen Situationen auf diese Fähigkeit des menschlichen Gehirns und Bewusstseins.

Das ist eine Folge von Zurichtung und des mangelnden Willens, sein eigenes Leben zu gestalten.

– Erziehung und die fremdbestimmte Ausrichtung des eigenen Lebens auf vorgegebene Lebenswege sind wichtige Gründe dafür, das Menschen sich nur innerhalb des Gewohnten bewegen. Selbst die Ausbruchsversuche bleiben dem Bewährten verhaftet, d.h. auch Protestkulturen z.B. unter Jugendlichen sind nur Wiederholungen im kollektiv-identitären Dasein. Das „Funktionieren“ im Gewohnten vermittelt Erfolgsgefühl und Geborgenheit.

– In einer Gesellschaft, die vorgegebene Lebensorientierungen belohnt, ist das Verharren in diesen einfacher als der Weg selbstorganisierten, kreativen Verhaltens. Der dauernde Druck der Verhältnisse und des sozialen Umfelds zur Normalität macht Selbstbestimmung zu einem kraftzehrenden Dauerkrieg zwischen der handelnden Person und allem drumherum. Demgegenüber ist selbst die Verweigerung attraktiv, weil die plurale Gesellschaft längst Nischen für den zeitweisen Ausstieg aus der dauernden Verwertungslogik geschaffen hat.

In der Folge verzichten die meisten Menschen auf die Benutzung ihrer Denkfähigkeit zur Metaebene, d.h. zur selbstbestimmten Gestaltung ihres Lebens. Dieses setzt voraus, dass der Mensch sich einen Überblick über seine Handlungsmöglichkeiten verschafft, um zwischen diesen wählen oder sich neue schaffen zu können.

Das Denken in der Metaebene analysiert den Zugang zu Ressourcen oder die sozialen Verhältnisse innerhalb einer Gruppe ebenso wie Reaktionen eines Umfelds, Gefährdungen oder vieles andere.

Innerhalb sozialer Gruppen fehlt solches Denken oft ganz. Die Personen, die zumindest teilweise in der Metaebene denken, erreichen schnell eine dominante Stellung. Oftmals reduziert sich ihr Denken auch auf bestimmte Bereiche, z.B. die Handlungsfähigkeit der politischen Gruppe, WG, Familie oder den Betrieb: Ist genug Geld da? Stimmt das Miteinander? Wo sind Konflikte? Solche und ähnliche Fragen analysieren die Lage in der Gruppe aus einer Metaebene.

Aerial of the U.S. Capitol under restoration 04879v.jpg

Wer so denkt, hat einen Vorsprung an Handlungsmöglichkeiten gegenüber denen, die auf solche Betrachtungen verzichten. Das schafft ständig Unterschiede. Wer mehr Überblick über die Potentiale und Konflikte in einer Gruppe hat, verfügt über mehr Handlungs- und Steuerungsmöglichkeiten. Allerdings führt die Dominanz nicht zum Glück – ganz im Gegenteil: Verzweiflung und Frust sind bei denen, die aus der Metaebene schauen, eher das Alltag. Denn der Zustand der meisten Gruppen ist aus Effizienz- und herrschaftskritischer Sicht katastrophal. Nur merkt mensch das gar nicht, wenn niemals ein Blick aus der Vogelperspektive auf das eigene Dasein versucht wird.

Herrschaft als alles durchdringender, sich ständig reproduzierender Systemkern

Herrschaft ist überall und tritt in verschiedenen Formen auf. Ebenso reproduziert sich Herrschaft auf sehr unterschiedliche Weise. Die institutionellen Formen werden über formale Herrschaft organisiert. Sie treten innerhalb der Gesellschaft im Grossen (Regierungen, Konzern-Hierarchien, Bildungssystem usw.) wie im Kleinen (Vereine, Familien, Arbeitsplatz/Ausbildung usw.) auf, sind also überall präsent, überlagern und beeinflussen sich. Fast immer ist jeder Mensch in jedem Augenblick in mehreren formalen Herrschaftsverhältnissen gefangen.

Noch durchdringender sind die beiden anderen Typen von Herrschaftsverhältnissen: Erstens das marktförmige, also die ständige Notwendigkeit zur markt- und meist geldförmigen Reproduktion sowie die Taxierung aller Dinge und immer öfter auch von Menschen nach ihrem Warenwert. Zweitens das diskursive, also die Normen, Erwartungshaltungen, Zurichtungen und Rollenlogiken zwischen den Menschen. Sie beherrschen den Alltag der Menschen in jeder Minute.

Menschen richten ihr Verhalten nach den Erwartungshaltungen des sozialen Umfeldes aus, taxieren einander nach Nützlichkeit, versuchen ihre Rolle auszufüllen und fordern von anderen selbiges ein – vielmals sehr unterschwellig, aber deshalb nicht weniger wirksam. Ob mensch einkaufen geht oder nur spazieren, ob mensch schläft oder wacht, fernguckt oder fussball spielt – immer gelten die Normen, immer ist definiert, was sich in diesem Moment und für die konkrete Person gehört. Regeln, Wertkategorien und mehr durchziehen das gesamte Leben („Bio-Macht“).

Dieses „System“ Herrschaft durchzieht nicht nur alles, sondern es reproduziert sich ständig neu. (Fast) alle Menschen sind nicht nur beherrscht durch Institutionen, Rollen und Erwartungshaltungen, Normen und Zurichtungen, Inwertsetzung und Verkauf der eigenen Fähigkeiten, sondern agieren auch selbst als aktives Subjekt zur Herstellung von Herrschaft.

Menschen werden zugerichtet und richten zu. So durchdringt Herrschaft alle Beziehungen zwischen Menschen. Besonders offensichtlich wird das bei der Betrachtungsweise der Gesellschaft als eine räumliche Einheit.

Der Gesamtraum ist herrschaftsförmig organisiert, es gibt die Institutionen der Macht, die Kontrolle, die Regeln und Gesetze sowie eine Vielzahl subtiler Formen der Normierung und Zurichtung.. Der Gesamtraum kann in viele Subräume zerlegt werden – und immer wieder finden sich die gleichen Logiken von Herrschaft. Immer und immer weiter ist Gesellschaft bis in kleinste Zellen menschlichen Zusammenlebens zerteilbar.

Die Zellen überschneiden sich, kaum ein Mensch ist nur Teil einer Familie oder nur Teil der MieterInnen in einem Haus, der ArbeitnehmerInnen am Arbeitsplatz, der SchülerInnen in einer Klasse usw. Aber in jeder Zelle spiegelt sich das volle Programm von Herrschaft wieder.

Diese Zellen sind ständig im Fluss, sie vergehen und andere entstehen neu. Diese Neuentstehung ist der deutlichste Punkt, wie Herrschaft funktioniert und allgegenwärtig ist bzw. sich reproduziert. Wo neue soziale Gruppen entstehen, z.B. Vereine, Firmen, Familien oder eben auch politische Gruppen und Zentren, so ist jedes Mal theoretisch zunächst ein leerer Raum geschaffen.

Die Frage der Herrschaft muss sich dort neu regeln. Es spricht nichts dafür, dass es ein Naturgesetz ist, wie sich Herrschaft dort organisiert, denn es gibt keinen Hinweis, dass das „System“ von Herrschaft auch aus biologischer Sicht irgendwie schlüssig oder auch nur erfolgreich wäre. Dennoch wird Herrschaft in jedem neu geschaffenen Raum wieder neu hergestellt.

Die Logiken gleichen denen des Umfeldes mit einer Tendenz zur ganz allmählichen, stetigen Modernisierung der Formen von Herrschaft, ohne selbige ganz oder teilweise zu überwinden.

Die diskursiven Vorgaben sorgen dafür, dass Menschen sofort in ihre Rollen springen und sich so „wie von selbst“ Verhaltensweisen reproduzieren, die die AkteurInnen auch vorher in anderen Subräumen zeigten. Veränderungen, bei Menschen immer möglich, bewegen sich in den Kanälen des Normalen und Normierten, d.h. Personen springen von einer Rolle zur anderen, aber nie raus aus den gesellschaftlich vorgedachten, diskursiv geprägten Rollentypen.

Meist verbinden sich die diskursiven Verhältnisse mit den marktförmigen Zwängen, die in allen Subräumen reproduziert werden – Reiche bleiben reicher als andere, ständig wird über Geld und davon abhängige Möglichkeiten nachgedacht usw. Und schliesslich kommen die institutionellen Herrschaftsverhältnisse hinzu: Wer kommt ans Konto ran, hat die Schlüssel zu einem Raum, kann nach aussen vertreten, ist formaleR ChefIn, wird von aussen als Autorität angesprochen oder dargestellt usw.

Herrschaft ist etwas, was sich selbst immer wiederherstellt. Das ist Normalität. Emanzipation ist daher nur als energischer und aktiver Gegenprozess vorstellbar. Die politische Bewegung ist das beeindruckendste Beispiel für die Überlegenheit des allumfassenden „Systems“ Herrschaft selbst gegenüber dem formulierten Willen der AkteurInnen. In krassem Gegensatz zu den eigenen Slogans, ständigen Beteuerungen und politischen Positionen sind politischen Zusammenhänge insgesamt und in jedem Subraum von Hierarchien und genormten Verhalten intensiv durchzogen.

Zurichtungen, Erwartungenshaltungen, unterschiedliche Möglichkeiten, die ständige Sortierung nach Nützlichkeit oder auch formale Hierarchien prägen den Alltag politischer Arbeit. In jeder neuen Gruppe und in jedem neuen Projekt reproduziert sich diese Herrschaft ständig – und sie gleicht den Logiken von Herrschaft, wie sie in der Gesellschaft auch insgesamt gelten. Insofern ist politische Bewegung ein fester Bestandteil des „Systems“ – sie ist ebenso an der Aufrechterhaltung von Herrschaft beteiligt wie jeder andere Teil von Gesellschaft.

Das ist nicht überraschend, sondern entspricht der Logik einer sich diskursiv, marktförmig und institutionell im gesamten Leben verankernden und überall reproduzierenden Herrschaft.

Aber es ist fatal. Politische Bewegung ist nicht das Gegenmodell zur Herrschaft, sondern eher „zuständig“ für die Organisierung von Herrschaft in den Subräumen politischer Arbeit. Sie ist damit systembildend, ob sie will oder nicht. Noch mehr: Gerade die Selbstreproduktion von Herrschaft in „linken“ politischen Gruppen führt zur Modernisierung von Herrschaft, weil dort verkrustete, allzu offensichtliche oder uneffiziente Führungstechnologien offensiver in Frage gestellt und durch neue Techniken ersetzt werden.

Auch von daher ist nicht überraschend, dass es gerade Ex-„Linke“ sind, die nach Erklimmen der Karriereleiter später an anderer Stelle der Gesellschaft Herrschaft moderner umsetzen und erneuern – siehe die effizienten neoliberalen „Reformen“ gerade rot-grüner oder rot-roter Koalitionen oder die Modernisierung zentralistischer NGO-Strukturen durch die instrumentellen Herrschaftsverhältnisse bei Attac. Doch auch die „linksradikalen“ Organisierung mit Plena, Delegiertenräte und Orga-Gruppen sind nur Modernisierung überkommener Strukturen wie Mitgliederversammlungen usw.

Offen bleibt aber die Frage, ob das so sein muss (z.B. weil der Mensch „so ist“ oder weil er Herrschaft und Orientierung braucht) oder es aufgrund der überwältigenden Prägung von Gesellschaft durch das Prinzip „Herrschaft“, aufgrund von Zwängen und Erwartungshaltungen nur unendlich schwer fällt, diese Vereinnahmung zu sprengen. Vieles spricht für zweiteres – oder anders gesagt: Eine Aussage darüber, ob Herrschaft überwindbar und ein Leben freier Menschen in freien Vereinbarungen möglich ist, kann nur über den Versuch und die Auswertung desselben erfolgen.

Dabei ist der Versuch ein dauernder Prozess, denn Befreiung im emanzipatorischen Sinne kann nur das ständige Zurückdrängen von Herrschaftsförmigkeit in allen Ebenen von Gesellschaft und allen Facetten von Leben sein mit einem offenen Ausgang, welche Gesellschaft dann entsteht und sich wieder weiterentwickelt und wie sich Menschen von ihren Möglichkeiten selbstbestimmten Lebens verändern.

In politischen Gruppen, die wie alle kleinen und grossen Strukturen als Subräume der Gesellschaft gesehen werden können – also teil-eigenständig, aber ebenso intensiv verwoben mit allen -, können für die ständige Reproduktion von Herrschaft klare Gründe erkannt werden:

• Akzeptanz der formalen Zwänge von aussen (Geld, gesetzlicher Rahmen für Rechtsformen, Räume, Versammlungsrecht, Strafrecht usw.).

• Selbstreproduktion von Normierungen, Dominanzen, Rollenverhalten usw. in den Gruppen und Netzen.

• Durchsetzung eines kollektiv-identitären „Wir“, Aufbau kollektiver Identitäten, d.h. der Organisierung nach sozialen Codes verbunden mit ständigen Ab- und Ausgrenzungen gegenüber dem „Anderen“.

• Effizienzstreben (nicht als solches das Problem) unter den herrschenden Bedingungen, die Erfolg an gesellschaftskonformes Verhalten zu binden scheinen.

• Integration strategisch erfahrener Politaktivisten in herrschaftsförmige Organisationsformen (z.B. „Aufsaugen“ durch die NGOs).

Jedenfalls sollte gelten: Im Fall, dass Herrschaft weder genetisch noch naturgesetzlich erforderlich ist, wäre es ein „Muss“ für eine politische Praxis mit emanzipatorischem Anspruch, das Zurückdrängen von Herrschaft, also von Normierungen, äusseren Zwängen, internen Hierarchien usw. zu versuchen.

Sonst ist alles nur Schein – Emanzipation kann es nur geben, wenn der Ausbruch wenigstens versucht wird und eine politische Bewegung nicht selbst die Herstellung von Herrschaft in den politischen Subräumen bedeutet.

Gleiches gilt für die Menschen, die Emanzipation anstreben, für ihre Lebensbereiche. Familien, (Nicht)Arbeitsplatz, Freizeittreffen … alles kann nur einfach Reproduktion von Herrschaft sein oder zum Kampffeld der wichtigsten gesellschaftlichen „Schlacht“ werden – der um die ständige Wiederherstellung und Erneuerung von Herrschaft oder deren Überwindung.

Konkrete Politik als Förderung von Kooperation

Politische Forderungen und konkrete Projekte müssen kooperatives Verhalten fördern, Handlungsmöglichkeiten erweitern und Fremdbestimmung abbauen. Die beschriebenen Bedingungen einer Gesellschaft, in der Konkurrenz unattraktiv sowie Kooperation vorteilhaft für jeden Menschen wird, müssen als Massstab für die politische Praxis dienen – zumindest dann, wenn sie einen emanzipatorischen Charakter haben soll.

Das behaupten zwar fast alle politischen Gruppen aus den Bewegungen im Umweltschutz, zu sozialen Fragen, feministische oder Queer-Zusammenhänge bis hin zu internationalen Themen, Frieden oder allgemein den Menschenrechten und menschenwürdigen Lebensbedingungen. In ihrer Praxis aber missachten sie, was Kooperation fördert oder blockiert.

Daher seien an dieser Stelle in kurzer Form politische Grundpositionen benannt, die als Rahmen für emanzipatorische Politik und Projekte dienen können. Herrschaft abwickeln! Herrschaft verbessert die Möglichkeit zum konkurrierenden Verhalten.

Daher ist es immer falsch, neue Herrschaft zu fordern, um die Folgen der bisherigen mildern zu können. Für Reformen bedeutet das, dass jeder Vorschlag und jeder Schritt auch dem Abbau von Herrschaft dienen muss.

Neue Gesetze oder Veränderungen von Institutionen müssen die Freiräume der Menschen vergrössern und nicht deren Leben weiter verregeln, Kontrolle unterwerfen und Unterschiede ausgleichen, die auf Herrschaftsverhältnissen beruhen. Und sie sollten Ansatzpunkte für weitere Prozesse aufbauen.

Revolutionäre Forderungen oder Umstürze müssen ebenfalls Herrschaft beenden oder abbauen, müssen Prozesse der immerwährenden Befreiung schaffen statt eines neuen Status Quo, der dann wiederum herrschaftsförmig verteidigt wird.

Verwertung und Profit abschaffen!

Verwertung und Profit basieren bereits auf institutionellen Herrschaftsverhältnissen, fügen dieser dann durch die weitere Elemente der Unterdrückung, Diskriminierung usw. hinzu. Das wichtigste Herrschaftsinstrument, ohne das Verwertung nicht möglich ist, ist das Eigentum – im weitesten Sinne, d.h. zum einen an materiellen Dingen, Boden, Rohstoffen, zum anderen aber auch an Wissen, Wort und Bild, Genen, Lebensgrundlagen, Kommunikationswegen usw. Die Tatsache, dass Verwertung und Profit von Herrschaftsstrukturen abhängen, widerlegen auch das oft benannte Bild eines Gegensatzes von Staat und Markt.

Ohne Herrschaftsstrukturen (also in den allermeisten Fällen der Staat) wäre Verwertung nicht durchsetzbar. Wer Staat und Markt als Gegenpole darstellt, verschleiert das allumfassende „System“ Herrschaft und trägt damit zu ihrer Absicherung bei.

Eigentum aufheben: Freies Wissen und Freie Produkte!

Gemeinschaftseigentum, Allmende, Copyleft usw. sind Begriffe für Versuche der Überwindung von Konkurrenz bereits heute. Sowohl politische Forderungen als auch die konkrete Praxis können so organisiert sein, dass sie immer wieder Projekte, einzelne Zellen und Prozesse schaffen, die der Verwertungslogik entrissen sind – Kommunikation, Häuser und Plätze, Software oder Maschinen …

Demokratisierung von Flächen- und Rohstoffnutzung!

Herrschaft bedeutet nicht nur das Vermögen, Entscheidungen anderer zu beeinflussen, sondern auch, eigene Entscheidungen so zu treffen, dass andere die Folgen ertragen müssen. Auf dieser Grundlage findet die Umweltzerstörung statt – Umweltzerstörung ist also ohne Herrschaft nicht vorstellbar. Das Gegenbild ist ein emanzipatorischer Umweltschutz: Die Menschen werden zu AkteurInnen. Die Strassen, Häuserblöcke und Landschaften müssen den Menschen gehören, die in ihnen leben. Niemand kann über Flächen und Orte bestimmen, ohne selbst betroffen zu sein.

„Demokratisierung von Flächen- und Rohstoffverbrauch“ heisst das Gegenkonzept zu Ordnungsrecht oder dem kapitalistischen Instrument Ökosteuer. Vision ist eine Welt von unten. Die kleinen Schritte dahin bestehen aus konkreten Projekte, die die Menschen zu den EntscheiderInnen machen: Windanlagen, die den Menschen drumherum gehören (statt teurer Grossanlagen ohne örtliche Akzeptanz), Stromnetze im Besitz der BürgerInnen, ökologische Bauernhöfe im Gemeinschaftsbesitz, lokale Ökonomien ohne Apparate und vieles mehr.

Nationen, Geschlechter, Rassen, Behinderungen, Unmündigkeit, Psychiatrisierung und alle anderen Kategorien überwinden!

Nicht nur die Diskriminierung nach diesen Kategorien, sondern ihre Bildung ist bereits Herrschaft. Sie treibt Menschen in eine bestimmte „Ecke“, also Rolle in dieser Gesellschaft – mit den Erwartungshaltungen und den Reaktionen anderer Menschen. Eine konkrete Praxis sowie politische Forderungen müssen Diskriminierungen aufgrund der Kategorien und die Kategorien selbst aufheben.

Standardisierung und Normung aufheben!

„Norm“alität brechen! Gesetzliche, technische und diskursive Normen durchziehen den Alltag, sie regeln und prägen Verhalten und Erwartungen. Wer aus der „Norm“ fällt, verliert Akzeptanz und muss mit repressiven Reaktionen rechnen – des Staates oder des sozialen Umfeld.

Herrschaft demaskieren!

Verbunden mit jeder Herrschaft ist ihre Verschleierung. Herrschaft kann nur überleben, wenn sie ihre eigene Akzeptanz beschafft. Wo sie darauf verzichtet oder die Akzeptanzbeschaffung nicht gelingt, verliert die Herrschaft ihre Basis, d.h. die Beherrschten wünschen sich nicht nur eine Änderungen, sondern fordern sie bzw. setzen sie durch.

Als Akzeptanzbeschaffung für Herrschaft dienen: Biologismen; Scheinzwänge und -gesetzmässigkeiten; Religionen, Ideologien, Esoterik; Belohnung und Abhängigkeit; „There is no alternative“, d.h. die Vermittlung der Alternativlosigkeit; Integration von Kritik und Abweichung: Teile und herrsche.

Diese und andere Formen von Herrschaft zu enttarnen, anzugreifen und, wenn möglich, Alternativen zu benennen, gehört zum Weg der Befreiung. Der quadratmeterweise Aufbau von Freiräumen in Alltag und Politik sowie der Widerstand samt Demaskierung gegenüber Herrschaft fördern sich gegenseitig und sind zusammen die Motivation, solche emanzipatorische Praxis auch als dauerhaften Prozess zu entwickeln.

Praktische Formen von Widerstand

Konkrete politische Forderungen auch im Hier & Jetzt sind wichtig. Sie ersetzen aber nicht die politische Aktion. Auch für diese muss gelten, dass sie nur als herrschaftskritisch gelten kann, wenn sie solche Positionen transportiert. Das tun viele politische Aktivitäten heute nicht – ganz im Gegenteil fordern sie den Zugriff des Staates ein (im Sinne der jeweiligen politischen AkteurInnen) oder träumen gar von mehr Staatlichkeit (neue Behörden, Kontrollgremien, Gerichtshöfe usw.). Andere setzen auf Marktmechanismen, z.B. Effizienzstrategien oder Geldanlage.

Zudem schaffen sie ständig neue Subsysteme, die selbst wieder von Herrschaft durchzogen sind. Viele sich als „linksradikal“ verstehende Projekte vermitteln einen autoritären Charakter von Gesellschaft, kokettieren mit der Ausgrenzung von Menschen (z.B. ihren politischen GegnerInnen) oder treten selbst uniformiert bis militaristisch auf. Im folgenden sollen einige Aspekte einer emanzipatorischen politischen Praxis benannt werden.

„Emanzipatorisch“ als zentrale Kategorie

Politische Positionen und Strukturen werden zur Zeit nach sehr verschiedenen Kategorien bewertet. Klassisch in vielen politischen Gruppen ist die Einteilung nach „links“ und „rechts“.

Was genau links und was rechts ist, lässt sich aber kaum noch klären. Galt früher „links“ wenigstens noch annähernd als internationalistisch, aufklärerisch, fortschrittlich oder sozial(istisch), so agieren heute sehr verschiedene Strömungen mit diesem Begriff, unterstützen z.B. reaktionäre nationale Befreiungsarmeen, die in ihrer Ideologie (nationalistisch, religiös-fundamentalistisch oder anderes) und Struktur (militaristisch-mackerig, feudal usw.) aus emanzipatorischer Sicht schlicht widerlich sind, oder konservative bis biologistische Naturromantiker.

Die Globalisierung aus der kapitalistischen Mitte ist deutlich dynamischer als jede internationale Perspektive der „Linken“, CDU, F.D.P. und end-sozialdemokratisierte SPDlerInnen setzen auf Fortschritt. Mit der oft zu lesenden Analyse, der Kapitalismus oder die Globalisierung käme von „Rechts“ ist spätestens jegliche politische Schärfe verloren. Um ein klareres Bild politischer Positionen zeichnen zu können, sind präzisere Analysen wichtig.

Bei Reduzierung auf ein Begriffspaar bietet sich eher „emanzipatorisch“ und „anti-emanzipatorisch“ an. Danach wäre das Ziel „emanzipatorischer Politik“ die Loslösung aus Zwängen und Zurichtung aller Art, der Abbau von Fremdbestimmung, von institutioneller und diskursiver Herrschaft, die Schaffung von FreiRäumen und die Erweiterung von Reproduktions- und Handlungsmöglichkeiten – gleichberechtigt für alle einschliesslich dem Zugang zu allen Ressourcen.

Bei genauerer Betrachtung aktueller politischer Positionen fällt auf, dass dieses Ziel kaum eine politische Gruppe verfolgt (siehe die Quellenanalyse im Buch „Nachhaltig, modern, staatstreu“, www.projektwerkstatt.de/materialien).

FreiRäume schaffen

Jede politische Gruppe und jede Aktion, jedes Projekt und jeder neu geschaffene soziale Ort kann entweder selbst Herrschaftsverhältnisse reproduzieren oder sich als Kampffeld dagegen begreifen. Letzteres hat zwei Richtungen: Zum einen der Widerstand gegen die Zwänge von aussen, die aktive Organisierung von Unabhängigkeit, die Nicht-Übernahme gesellschaftlich prägender Organisierungs- und eventuell Rechtsformen. Zum anderen die interne offensive nichthierarchische Organisierung.

Dieses bedeutet einen dauernden aktiven Prozess gegen die Selbstwiederherstellung von Herrschaft über die Zurichtungen der beteiligten Personen und vorhandene Unterschiede im Zugang zu Wissen, Ressourcen usw. Beides, die Zwänge und Erwartungshaltungen von aussen sowie die interne Selbstreproduktion von Dominanzen, stärken sich gegenseitig.

FreiRäume schaffen ist der Versuch, Experimentierfelder zu eröffnen und Strategien der Überwindung von Herrschaftsverhältnissen zu entwickeln. FreiRäume sind dabei nicht nur, aber auch örtlich gemeint. Jede Gruppe und sogar jeder zeitlich begrenzte Zusammenhang kann als ein solcher „FreiRaum“ begriffen und gestaltet werden.

Selbstverständlich gilt das auch für bestehende Gruppen, Zusammenhänge und Räume, die in Richtung des Abbaus von Zwängen und Zurichtungen sowie gleichberechtigter Handlungsmöglichkeiten entwickelt werden können.

Visionäre Ansätze sichtbar machen

Das Richtige im Falschen zu schaffen, ist nicht möglich. Das Richtige im Falschen zu versuchen, aber sehr wohl. Das bietet dann viele Handlungsmöglichkeiten, zum einen tatsächliche Erleichterungen im Alltag, zum anderen das Aufzeigen von möglichen Richtungen und die darauf aufbauende Debatte um herrschaftsfreie Utopien. Als ein Beispiel von vielen seien hier Umsonstläden genannt. Es wäre extrem verfehlt, in ihnen bereits selbst ein grosses Stück Vision zu sehen.

Zwar ist richtig, dass ein solcher Laden sowohl die materielle Not von Menschen lindern kann als auch solchen, die selbstorganisierter zu leben versuchen, den Zwang zu Lohnarbeit und ständiger Geldbeschaffung reduziert. Wichtiger aber ist aus politischer Sicht die Chance, rund um einen Umsonstladen die Diskussion um eine verwertungsfreie Gesellschaft zu führen. Auch Linux und freie Software ist so ein Beispiel – es ist teilweise gut gelungen, an das konkrete Projekt eine Debatte über Visionen anzuhängen (siehe z.B. www.oekonux.de).

Völlig verfehlt ist jedoch die Annahme, Linux sei bereits selbst Praxis visionärer Gesellschaft.

Wie peinlich war es, als sich Linux-Fans darüber freuten, dass die Software jetzt auch im Bundestag Verwendung findet (vielleicht demnächst Cruise Missiles mit Linux-Programmierung?) oder die SPD im bayrischen Landtagswahlkampf mit „Mehr Linux. Mehr Freiheit“ auf Plakaten warb. Nur die kreative Verbindung von visionär ausgerichteten Projekten im Hier & Jetzt und einer intensiven Vermittlung darüber hinaus gehender Ideen gibt Chancen.

Reibung erzeugt Wärme

Der Angriff auf das Herrschaftsförmige schafft nicht allein die Herrschaftsfreiheit. Diese Erkenntnis ist banal – und doch kein Grund, das Widerständige sein zu lassen. Ganz im Gegenteil bietet die kluge direkte Aktion die Chance zur darüber hinaus gehenden Vermittlung, ganz ähnlich dem visionären Baustein im Hier & Jetzt.

Wer in den Konsumtempeln der Republik Entwertungsaktionen macht (Barcode mit anderen Botschaften überkleben, Preisschild auf Null setzen, Zettel in Bücher und Zeitschriften einlegen …), wer per Aufkleber geschlechterrollen-trainierendes Spielzeug verändert oder per Improvisationstheater den Wahlkampf demaskiert, kann dadurch Ansätze für intensive Kommunikation schaffen.

Das genau ist auch das Ziel der direkten Aktion – und nicht die Selbstbestätigung mittels Durchführung der immer selben Aktionsformen, wie es in der „Linken“ zur Zeit üblich ist. Wer Normalität brechen will, muss das vom Inhalt und der Aktionsform auch tun. Dazu kann auch Militanz gehören, aber für sie gelten die gleichen Überlegungen. Sie müssen emanzipatorische Ziele vermitteln, Kommunikation erzeugen und führen (zu kreativen Widerstandsformen siehe im Internet: www.direct-action.de.vu).

Sich selbst als Teil einer visionären Gesellschaft begreifen

Ob nun „linke“ oder „emanzipatorische“ Politik – sie ist immer Teil der Gesellschaft. Es gibt kein „Draussen“. Wer Fremdbestimmung abbauen und Selbstbestimmung stärken will, kann das auch dort tun, wo es am schnellsten möglich sein könnte: Im eigenen Lebensumfeld. Politische Gruppen sind ein Teil davon – neben Arbeit, Ausbildung, FreundInnenkreis, Familie, Hobbygruppen usw.

Sie alle sind zur Zeit Orte der Selbstreproduktion von Herrschaft, der formalen und informellen Dominanzen, der Bildung kollektiver Identitäten oft mit Aus- und Abgrenzung.

Sie könnten aber auch Experimentierfelder für andere Formen der Kooperation, der Entscheidungsfindung von unten usw. sein – wie der Demaskierung der vorhandenen Herrschaftsverhältnisse in der Gruppe, des Experimentierens mit Methoden, der Reflexion und Weiterentwicklung, der aktiven Herstellung gleichberechtigten Zugangs zu allen Ressourcen und des Verzichts auf zentrale Entscheidungsfindung, egal ob „von oben“ (Vorstand u.ä.) oder „von unten“ (Basisdemokratie).

Gerade politische Gruppen und Projekte sind für solche Auseinandersetzungen und Versuche geeignet, da sich hier die konkrete Handlung mit der Diskussion um politische Ziele und Strategien mischt und sich interne und externe Praxis einander motivieren und vorantreiben

—————————————————————-

Grafikquellen       :

Oben         —          Moscow-City, August 2009

Urheber Dmitry A. Mottl       /        Quelle     —    Eigenes Werk

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

———————————-

2.) von Oben        —    Skyline inof Frankfurt am Main.

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.
Namensnennung: Carlos Delgado

—————————

3.)  von Oben          —        Skyline ofAthens, seen from the Akropolis

Urheber Orlovic      /        Quelle       —    Eigenes Werl
Namensnennung Weitergabe unter gleichen Bedingungen This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International, 3.0 Unported, 2.5 Generic, 2.0 Generic and 1.0 Generic license.

————————

Unten         —      Aerial of the U.S. Capitol under restoration, Washington, D.C.

Abgelegt unter International, Kultur, Mensch, Umwelt | Keine Kommentare »

Morales-Sturz in Bolivien

Erstellt von DL-Redaktion am 16. November 2019

Wir alle waren verliebt in ihn

Movimientos sociales respaldan al Presidente Evo Morales (9211613243).jpg

Ein Artikel von  Katharina Wojczenko

Evo Morales war mehr als ein Präsident, für die Indigenen Boliviens, für Linke in aller Welt. Jetzt ist er im Exil – und spaltet, statt zu versöhnen.

Es lag etwas in der Luft, sagt die Politikwissenschaftlerin Nadia Guevara. Sie denkt an mindestens drei verschiedene Märsche, die am Sonntag vergangener Woche durch die Stadt La Paz im Westen Boliviens zogen. Einer davon war organisiert für die Rechte der Frauen, ein anderer von den Bergarbeitern aus der Region Potosí, ein weiterer von pensionierten Polizisten. Sie alle richteten sich ­gegen die Regierung von Boliviens Präsident Evo Morales.

Genau drei Wochen zuvor hatte es Wahlen gegeben, bei denen Morales im Amt bestätigt werden wollte, zum vierten Mal, obwohl die Verfassung nur eine Wiederwahl zulässt. Am Wahl­abend sah es so aus, als müsste er in die Stichwahl ­gegen den Oppositionskandidaten Carlos Mesa. Der würde die Unterstützung der ausgeschiedenen Kandidaten erhalten und die Stichwahl wohl gewinnen. Dann brach plötzlich die Veröffentlichung neuer Wahlergebnisse ab, ohne Begründung.

Er werde mit den Stimmen der ländlichen Provinzen die Wahl noch in der ersten Runde gewinnen, prophezeite Morales. Bei der nächsten Veröffentlichung über 24 Stunden später sagten die Zahlen genau das: Morales hatte mehr als 10 Prozentpunkte Vorsprung und wäre damit Sieger ohne Stichwahl. Gleichzeitig häuften sich Berichte über Wahlbetrug. Von einer „unerklärlichen Trendwende“ sprach die Beobachtermission der Organisation Amerikanischer Staaten (OAS). Und im ganzen Land gingen Menschen auf die Straße und protestierten.

Movimientos sociales respaldan al Presidente Evo Morales (10196046836).jpg

An jenem Sonntag vor einer Woche dann die Wende. Am Morgen kündigte Morales Neuwahlen an, sprach von „neuen politischen Akteuren“. „Alle feierten, es war verrückt“, erinnert sich Nadia Guevara. Sie war mittendrin, Fahne in der Hand, das Baby im Tragetuch auf dem Rücken, ihr Mann hatte die Tochter an der Hand. Von der Regierungspartei Movimento al Socia­lismo (MAS) trat ein Politiker nach dem anderen zurück.

Sie waren gerade zur Haustür herein, da verkündete Morales seinen Rücktritt. Kurz zuvor hatte Militärchef Williams Kaliman den Präsidenten dazu aufgefordert – und Nadia Guevara und ihre Familie kehrten wieder um, sie wollten feiern. „Es war bewegend“, sagt sie. „Alle schrien: Somos libre!“ (Wir sind frei!)

Dann kamen die ersten Nachrichten von Freunden der oberhalb von La Paz gelegenen Nachbarstadt El Alto aufs Handy – und damit die Angst: „Feiert nicht. El Alto brennt.“ „Haut ab mit den Kindern, sie kommen herunter.“ Sie, damit seien die Unterstützer der MAS-Partei gemeint gewesen. Im Fernsehen liefen die ersten Bilder von brennenden Häusern in El Alto und der Zona Sur in La Paz. In der Nacht hörte sie grölende Gruppen ans Metalltor der Wohn­anlage schlagen, wo Guevara und 84 andere Familien leben. „Es war eine Horrornacht.“

Seitdem kommen die Menschen nicht zu Ruhe. Auf beiden Seiten. Sebastián González, 18 Jahre alt, will seinen richtigen Namen nicht nennen. Seit Tagen kann er nicht mehr schlafen. Der Musikstudent hat am 20. Oktober für Evo Morales gestimmt, wie die meisten in seiner Familie. Er hat Angst. Um seine Familie, um seine Großmutter und seine Tante, die in El Alto leben. In ihrem Viertel wurde ebenfalls geplündert. „Meine Großmutter ist verängstigt, weil eines ihrer Kinder in Santa Cruz lebt. Sie kamen dort mit Motorrädern und zerstörten die Läden, die einzige Einnahmequelle der einfachen Leute.“ Sie, das sind in diesem Fall die anderen. Die Gegner von Morales, die Rechten, die Polizisten, die sich gegen Morales gestellt haben.

Auf Videos sind weinende, verzweifelte Menschen zu sehen. González hat viele Videos gesehen in den letzten Wochen. „Sie fingen an, die Menschen in El Alto zu beschimpfen, sie seien Schweine, dreckig. Früher waren masistas einfach Anhänger der MAS-Partei, jetzt ist es wie eine Beleidigung“, sagt er. „Hier zeigen die Medien fast nur die Seite der Opposition. Wie die indigenen und ländlichen Gemeinschaften eingeschüchtert werden, zeigen sie nicht.“

Wie alle MAS-Anhänger spricht er von einem Staatsstreich, und wie die meisten in seiner Familie hat er seither alle verräterischen Bilder von seinen sozialen Medien gelöscht, kommentiert nicht mehr und passt auf, was er sagt.

Sebastián wohnt mit seinen Eltern und seinen beiden jüngeren Geschwistern im selben Viertel wie Nadia Guevara, die Politikwissenschaftlerin, vielleicht eine halbe Stunde zu Fuß entfernt. Sein Vater ist Argentinier. Sebastiáns Großeltern waren links und beide engagierte Gewerkschafter in Zeiten der argentinischen Militärdiktatur. Eines Tages gaben sie Sebastiáns Vater und dessen Schwester bei einer Nachbarin ab und baten sie, sie als ihre Kinder auszugeben.

Quelle         :        TAZ            >>>>>        weiterlesen

—————————————————————-

Grafikquellen        :

Oben     —     Cochabamba (Bolivia), 4 de julio 2013. Los movimientos sociales y comunidades indígenas de Cochabamba se congregaron en el coliseo de Las Coronillas para respaldar al Presidente de Bolivia, Evo Morales, ante el trato indigno que Francia, España, Italia y Portugal dieron al Mandatario al impedir los permisos de vuelo en sus territorios. El encuentro contó con la participación de los Presidentes de Ecuador, Rafael Correa; Venezuela, Nicolás Maduro; Argentina, Cristina Fernández; Uruguay, José Mujica; y, Surinam, Desi Bouterse, quienes se solidarizaron con su homólogo boliviano por los lamentables hechos sucedidos. “Se ha destrozado el Derecho Internacional, la inviolabilidad de los Jefes de Estado, no entendemos por qué se ha actuado así contra la querida Bolivia”, expresó el Mandatario ecuatoriano. Foto: Fernanda LeMarie – Cancillería.

———————————-

Unten       —       Homage to Evo Morales by Circus Amok

 

Abgelegt unter Amerika, International, Medien, Schicksale | Keine Kommentare »

Vom Osten lernen

Erstellt von DL-Redaktion am 16. November 2019

Die Linke und das Jubiläum der DDR-Annexion

File:Amsterdam Grafitti Freedom Lives When the State Dies.png

Quelle        :       untergrund-blättle CH.

Von   Peter Schaber / lcm

Wann immer sich irgendeines der Ereignisse zur deutschen Einheit jährt, füllen sich die Feuilletons mit Jubelarien, die Plätze mit Jubelariern und die Talkshows mit Jubelexperten.

Der immense Aufwand wird benötigt, weil die Erfolgsstory „deutsche Wiedervereinigung“ zu den wichtigsten Mythen dieser Republik zählt. Und weil dieser Mythos immer und immer wieder gebetsmühlenartig wiederholt werden muss, damit er sich als Realität in den Köpfen der Menschen verfestigt.

Denn die traurige Geschichte, die mit Deutschlandwimpel überdeckt und mit Rotkäppchen-Sekt aus dem Gedächtnis gelöscht werden soll, ist: Besonders gut gelaufen ist die „deutsche Einheit“ nicht. Wiedervereinigung war sie keine, sondern eine mit einer Schocktherapie durchgesetzte rasant vollzogene Annexion. Ein historisch gewachsener Staat – wie auch immer man ihn bewerten will – wurde ökonomisch, politisch, juristisch und kulturell ausgelöscht. Bleiben sollte nichts: Keine volkseigenen Betriebe, kein einheitliches Schulsystem, keine Marxist*innen an Universitäten, keine Ostdeutschen in Leitungspositionen.

Begleitet wurde dieser Prozess durch das wahrscheinlich grösste Wirtschaftsverbrechen der deutschen Nachkriegsgeschichte: Die sogenannte Treuhand. Der wurde zunächst das – ja formal der Bevölkerung gehörende – Vermögen der DDR einverleibt – angeblich, um es zu bewahren. In einem Wildwestverfahren wurde privatisiert, verscherbelt, zerschlagen, abgewickelt. Am Ende der Bilanz war der Osten deindustrialisiert, Millionen Menschen arbeitslos oder in Kurzarbeit, einige Westfirmen hatten sich bereichert oder einfach vorsorglich Konkurrenten zerstört. Immense Werte wurden einfach vernichtet.

Was die Treuhand auf ökonomischem Gebiet leistete, wurde auf akademischem und kulturellem auch durchgesetzt. Wer den Kapitalismus nicht aus vollem Herzen wie den Laib Gottes in der Sonntagsmesse empfing, wurde abgesägt – und dafür musste man keineswegs altgediente*r SED-Funktionär*in sein. Die berufliche Ausgrenzung wurde vervollständigt durch das Bild des „Ossis“, das bis heute als negativ konnotierter Topos für den rückständigen, schwer zufriedenzustellen, andauernd jammernden, undankbaren Ostdeutschen in den Feuilletons und an den westdeutschen Stammtischen reproduziert wird.

Einige Autoren – darunter der italienische Ökonom Vladimiro Giacche sowie die Publizisten Wolfgang Dümcke und Fritz Vilmar – sehen in der Art des Anschlusses der DDR sogar Elemente einer „Kolonisierung“. Und in der Tat konnten sich auch jeder Sympathie mit dem ehemaligen sozialistischen Staat unverdächtige Zeitgenossen wie der Ex-Treuhandchef Detlev Rohwedder dieses Eindrucks nicht erwehren: „Manche westdeutschen Unternehmen benehmen sich wie Kolonialoffiziere“, konstatierte der wenig später ermordete Chef-Privatisierer.

Ob man den Begriff „Kolonialisierung“ verwenden will oder nicht, der Anschluss zerstörte in vieler Hinsicht ein gesellschaftliches Gefüge. Es gibt wenige ostdeutsche Familien, und zwar unabhängig von ihrer Stellung zur SED, für die die „Wende“ nicht auch einen krassen Bruch ihrer persönlichen Lebensgeschichte bedeutete. Westdeutsche Professoren fluteten ostdeutsche Universitäten, westdeutsche Manager die Betriebe, westdeutsche Politiker die Parteienlandschaft. Die Folgen dieses Prozesses prägen Ostdeutschland bis heute. Lohnunterschiede, die Besetzung von Leitungspositionen mit Westdeutschen, die Repräsentanz in Politik und Kultur bleiben ungleich zwischen Ost und West. Zehnmal mehr Menschen „pendeln“ vom Osten in den Westen zur Arbeit als umgekehrt.

Die fortbestehende Diskriminierung und Erniedrigung von Ostdeutschen sowie die eigenständige Geschichte in einem – nun verschwundenen – Staat führt dazu, dass es so etwas wie eine eigenständige ostdeutsche Identität gibt.

Und hier kommt die Linke ins Spiel: Wir – insbesondere als westdeutsche ausserparlamentarische Linke – verstehen diese Identität nicht, wir respektieren sie zu wenig und wir versuchen viel zu wenig, ihre progressiven Elemente zu bestärken. Dafür wäre eine Voraussetzung, eine eigenständige Einschätzung dessen zu gewinnen, was sich in diesem Teil Deutschlands denn eigentlich vollzogen hat. Doch grosse Teile der radikalen Linken sehen den ostdeutschen Staat und die Wende durch die Brille der bürgerlichen Geschichtsschreibung.

Bodman-Ludwigshafen - Ludwigshafen - Hafenstraße - Ludwigs Erbe r 11 (Ackermann) ies.jpg

Dabei wäre eine eigenständige Perspektive – jenseits von kritiklosem Abfeiern auf der einen, massloser Diabolisierung auf der anderen Seite – bitter nötig. Denn eine Prämisse sollte klar sein: die DDR gehört – mit allen ihren Fehlern – zur eigenen Geschichte der sozialistischen Bewegung. Die BRD, dieser aus Ex-Nazis aufgebaute, kapitalistische Staat mit Westbindung nicht. Und genauso wie die DDR gehört die Demokratisierungsbewegung an ihrem Ende zur selben Geschichte demokratischer Aufbrüche. Auch deren Erfolge wie ihr Scheitern – angetreten als Versuch, die Verknöcherung aufzubrechen, geendet in einem Deutschland aus Kohl, Krieg, Kapitalismus und Nationalismus – lohnt es sich jenseits der bürgerlichen Mythenbildung zu betrachten.

Denn einerseits lernt man nichts aus den Fehlern eines Sozialismusversuchs, wenn man sich einfach nicht mehr mit ihm auseinandersetzt, weil einem irgendwelche bürgerliche Experten ja ohnehin schon erklärt haben, dass es da gar nichts zu lernen gibt. Und zum anderen lässt sich ohne historisches Verständnis der DDR, der Demokratiebewegung an ihrem Ende und ihrer beider Abwicklung durch den Westen auch heute im Osten keine politische Strategie entwickeln, die in der Lage wäre dort gesellschaftliche Hegemonie nach links zu verschieben.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

———————————————————————–

Grafikquelle        :

Oben          —       Graffiti on the train line leading to Centraal Station in Amsterdam. Photo by Gary Mark Smith. ( Freiheit lebt, wenn der Staat stirbt.)

Author

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————

2.) von Oben        —      Relief Ludwigs Erbe by Peter Lenk, close to Zollhaus and tourist information, Hafenstraße 5, Ludwigshafen am Bodensee, Bodman-Ludwigshafen in Germany: Right-hand part of the triptych: Josef Ackermann

Abgelegt unter Deutschland, Kultur, Regierung, Schicksale | Keine Kommentare »

Stadtgespräch aus Venedig

Erstellt von DL-Redaktion am 15. November 2019

Venedig unter Wasser – Schöne Katastrophe

Chilone-San Marco Flooded.jpg

Kommt alle her, welche vom Mühsal überlastet sind, hier könnt ihr mir folgen und lernen über das Wasser zu gehen.

Von Petra Reski

Die Hochwasser in Venedig sind längst zur medialen Kulisse geworden. Die Stadt leidet derweil an ihrer touristischen Übernutzung.

Schon komisch, wenn man von der größten Hochwasserkatas­trophe in Venedig seit 53 Jahren nichts anderes sieht als das schöne Spiegelbild der Goldmosaiken des Markusdoms und tapfere Touristen in Wegwerfstiefeln, die den Gezeiten die Stirn bieten. Keine Spur von der zerstörten Uferbefestigung an der Riva dei Sette Martiri, wo ein 40 Tonnen schweres Vaporetto auf das Ufer gespült wurde, nichts von den Marmorsäulen, die kreuz und quer herumliegen, als hätte ein Riese kegeln gespielt. Nichts vom Zeitungskiosk, den das Hochwasser in den Giudecca-Kanal geschwemmt hat. Nichts von den venezianischen Kindern, die nicht zur Schule gehen können, nichts vom venezianischen Alltag.

Acqua alta a Venezia nel settembre 2009.jpg

Nichts davon, dass die Menschen in den wenigen verbliebenen Werkstätten (und ja, es gibt in Venedig noch Handwerker und Unternehmer, die Arbeitsplätze geschaffen haben, die nichts mit dem Tourismus zu tun haben!) zu retten versuchen, was noch zu retten ist, Arbeitsmaterial, Lagerbestände. Nichts davon, dass in den Restaurants die Kühlzellen überflutet und Tonnen von Lebensmitteln vernichtet wurden. Alles muss mühevoll mit Süßwasser abgewaschen werden. Auf Knien rutschend versuchen die Venezianer ihre Existenz zu retten.

Dass nur der schöne Schein zählt, wissen die Venezianer seit jener Zeit, als ihre Stadt von einer geschäftstüchtigen Unternehmerclique im Faschismus zur Museumsstadt erklärt wurde. Mit dem Hafen von Marghera wurde der Großraum Venedig geschaffen: das Festland als Schlafstadt für die Arbeiter des Hafens, der Schiffswerften und der Petrochemie­anlage von Marghera. Heute leben in Venedig noch 52.000 Venezianer – der Großraum hingegen zählt knapp 260.000 Einwohner. Auch Luigi Brugnaro, Unternehmer und Bürgermeister Venedigs, wohnt auf dem Festland, wo die überwältigende Mehrheit der Stadträte lebt, die Hochwasser offenbar nur aus dem Fernsehen kennen.

In seiner Rede gegen die Venezianer, jene „glücklich in ihrem Wasser faulenden Dummköpfe“, beschied der Futurist Marinetti, dass es besser sei, Venedig zu zerstören, als zuzusehen, wie es zu einer mumifizierten Museumsstadt zum ausschließlich touristischen Gebrauch verkomme. Sein aus Florenz stammender Schriftstellerkollege Giovanni Papini schrieb: „Wir sind Hausmeister in Leichenhallen und Dienstboten exotischer Vagabunden.“

Quelle       :           TAZ       >>>>>        weiterlesen

—————————————————————-

Grafikquellen         :

Oben        —         Chilone-San Marco Flooded

——————————

2.) von Oben      —     Flood in Venice in september 2009: On the way to Saint Mark’s Square

————————-

Unten       —         1913

Abgelegt unter Europa, Feuilleton, Kultur, Umwelt | Keine Kommentare »

Newmans : Postanarchism

Erstellt von DL-Redaktion am 14. November 2019

Praktiken des Austretens und gemeinsamer autonomer Lebensgestaltung statt anarchistischer Gesellschaftsentwürfe und Programme

File:Amsterdam Grafitti Freedom Lives When the State Dies.png

Quelle         :     untergrund-blättle CH.

Von  Jonathan Eibisch

Der seit 2006 an einer Londoner Uni angestellte Professor der Politischen Theorie dürfte manchen Leser*innen ein Begriff sein.

Immerhin prägte Newman stark den Begriff des „Postanarchismus“ mit seiner Arbeit From Bakunin to Lacan. Anti-Authoritarianism and the Dislocation of Power (2001), über Max Stirner (2011), wie auch mit der äusserst inspirierenden anarchistischen politischen Theorie in The Politics of Postanarchism (2010). In Letzterem stellt er die interessante These auf, dass sich der klassische Anarchismus mit seiner Betonung von Ethik und Utopie bewusst nicht politisch organisiert und orientiert hätte, während der Postanarchismus darauf abziele, in das unauflösliche Spannungsfeld zwischen dieser Anti-Politik und dennoch notwendiger Politik hineinzugehen um neue Politiken der Autonomie zu entwickeln.

Newman hatte 2010 geschrieben, Postanarchismus sei keine spezifische Form oder Strömung des Anarchismus mit neuen Programmen oder Richtlinien. Noch nicht einmal sei er eine bestimmte politische Theorie, sondern ein Projekt um die anarchistische Politik zu erneuern und zu radikalisieren. Dies sollte vor allem durch die Dekonstruktion verschiedener problematischer Annahmen im klassischen (= modernen) Anarchismus geschehen.[1] Beispielsweise sei „Gesellschaft“ keine natürliche oder gar organische Form des Zusammenlebens, welche dem künstlichen Staat entgegen gesetzt werden könne. Zu problematisieren sind so auch weitere Annahmen der Aufklärung wie das teleologische Geschichtsbild, die (bürgerliche) Vorstellung des „autonomen“ Subjektes oder auch die Universalität von Moral und Vernunft.

Schliesslich kommt er zu dem Ergebnis: „Weil Anarchismus in einem unerwarteten neuen Licht erscheint, nämlich als Horizont von heutiger Politik, müssen wir seine klassischen Grundlagen auf Weisen überdenken, die zugleich seinem wesentlichen Ethos von Freiheit, Gleichheit, Anti-Autoritarismus und Solidarität treu bleiben. Mein Argument war, dass Anarchismus sich selbst etwas Neues zu lehren hat. Anarchismus ist beseelt durch einen lebendigen, atmenden ‚Geist‘ der Anarchie, welcher seine eigenen statischen Formen und fixierten Identitäten stört. Postanarchismus enthüllt diese freudvollen Moment von Anarchie innerhalb des Anarchismus und nutzt sie darüber hinaus, um das Politische und das Ethische in neuen Wegen zwischen den Zwillingspolen Politik und Anti-Politik zu denken“.[2]

Im aktuellen Buch mit dem schlichten Titel Postanarchism[3] widmet sich Newman nun vor allem dem „Geist der Anarchie“, welcher jegliche Festschreibungen aufbricht oder sich ihnen entzieht. Es wird betont, dass Postanarchismus eben keine politischen Programme oder bestimmte anarchistische Organisationsformen entwickelt, sondern sich vor allem damit beschäftigen würde, wo Anarchie im Hier&Jetzt vorkomme. Diese sei nicht als Ergebnis anarchistischer Kämpfe, sondern gewissermassen als Ausgangspunkt für jene zu verstehen: Weil es einen Willen zur freiwilligen Knechtschaft gibt, muss es potenziell auch immer Möglichkeiten von „Freiheit“, zur „Eigenheit“ oder „Autonomie“ geben.

Wenn mit dem Postanarchismus keine anarchistische Gesellschaft theoretisiert wird, sondern vielmehr jene Praktiken der Freiheit untersucht werden, die innerhalb des Bestehenden schon wesentliche Unterschiede machen (würden), wendet sich Newman von den bedeutenden politischen Implikationen, die The Politics of Postanarchism beinhaltete, offenbar teilweise wieder ab. Freiheit und Autonomie auch zu einer Frage des Willens zu erklären und dabei von Einzelnen auszugehen, ist eine durchaus anarchistische Sichtweise. Diese sollte jedoch nie eingenommen werden, ohne zugleich die materiellen und sozialen Bedingungen in den Blick zu nehmen, auf welchen individuelle Sehnsüchte nach Autorität, die eigene psychische Verhaftung in Herrschaft und damit ebenfalls die Chancen auf Distanzierung von Herrschaftsverhältnissen sowie eine selbstbestimmte Lebensgestaltung beruhen. Offenbar vollzieht Newman hier wieder eine Wende zurück zu seiner individualanarchistischen Herkunft.

Am Beginn des Buches steht die „postmoderne“ Annahme vom Ende der Meta-Narrative[4], also auch der Vorstellung einer „staatenlosen Gesellschaft“. Statt sich Anarchismus als sozialrevolutionärer Bewegung zu widmen, geht Newman dem Konzept einer ontologischen Anarchie nach. Dies umfasst, dass Vorstellungen und Handlungen keine „eigentlichen“, ihnen „wesentlichen“ Gründe und festgelegten Ziele haben.

Handlungen werden anarchisch, wenn sie sich nicht in vorgefertigte Raster einfügen, was zu Erfahrungen der Freiheit und ethischen Reflexionen führen kann, wenn wir gewissermassen nie aufhören Fragen stellen, anstatt immer schon die Antworten zu wissen. Dies ist zunächst nachvollziehbar. Dennoch wird die Frage aufgeworfen, warum das Fragen-Stellen dem experimentellen Entwerfen von Alternativen im Wege stehen soll. Betreibt Newman mit diesem Gedankengang nicht im Grunde genommen eine Privatisierung von Anarchismus als persönliche Denkweise und Haltung, also seine Verkürzung als philosophische Lebenseinstellung?

Zentral am Anarchismus ist für ihn „die Idee autonomen Denkens und Handelns, welches die gegenwärtigen sozialen Räume in diesem Sinne verändert, welches aber zugleich kontingent und unbestimmt ist, indem es keinen vorbestimmten Logiken und Zielen untergeordnet wird. Das heisst nicht, dass Anarchismus keine ethischen Prinzipien haben oder von bestimmten Idealen angeregt sein sollte – stattdessen sollte er nicht und kann er sich vielleicht nicht länger als bestimmtes revolutionäres Programm oder politische Organisation verstehen. Das bedeutet selbstverständlich nicht, dass alle Projekte aufgegeben werden sollten, sondern vielmehr, dass es kein ‚Projekt von Projekten‘ gibt, dass die anderen zusammenfasst“[5]. Newman geht darum mit Michel Foucault von einer ‚Non-Power‘, einer Nichtakzeptanz der Macht aus, wobei ich mir nicht sicher bin, inwiefern er damit die eigene politische Ohnmacht verklärt.

Im zweiten Kapitel wird mit Singularitäten ein (poststrukturalistisches) Verständnis von Einzelnen entfaltet, welches der neoliberalen Regierung des Lebens widerstehen können soll. Das Leben in seiner „nackten“ Form sei unregierbar und entzöge sich der Kontrolle, schreibt Newman in Anlehnung an Giorgio Agamben. Er möchte Individuen weder als Klassensubjekte, partikulare Identitäten (bürgerlicher Subjekte) oder einem (souveränen) Volk zugeordnet denken. In Hinblick auf den Gebrach sozialer Medien ist Newman dabei ziemlich kritisch, inwiefern sie echte Potenziale für die Erzeugung anderer Menschen bieten. (Dazu passt, dass er an anderer Stelle bemerkt, um den Kapitalismus zu überwinden, müssten wir uns auch von unseren kapitalistischen Wünschen lossagen und ein einfacheres Leben wählen.)

Die Klassendimension sei zwar weiterhin vorhanden, doch von einem Klassenbewusstsein zu sprechen, gehe an der Realität vorbei, in der Subjekte disparat [= widersprüchlich], fragmentiert und heterogen seien. Gleichzeitig wendet sich Newman gegen „Identitätspolitik“: „Im besten Fall wird Identitätspolitik eine gutartige Form von Liberalismus, besessen von der Repräsentation immer weiterer partikularer und marginaler Identitäten – wie in LGBTQ. Im schlimmsten Fall führt das Bestehen auf eine authentische Identität, das heisst, auf eine konstant zum Opfer gemachten Identität, zu einer Politik vergleichbar einer Form des Fundamentalismus.

In jedem Fall erreichte diese Art von Politik von Repräsentation und Anerkennung einen Punkt der Erschöpfung“[6]. Dagegen könnten radikale Kämpfe jedoch ebenfalls nicht mit Mitteln populistischer Politik geführt werden, weil mit dieser immer nach Führenden verlangt wird und sie zumindest in der Gefahr stehen, rassistisch und nationalistisch zu werden. Das Konzept von sozialen Singularitäten beschreibt dagegen Menschen, die sich – in Auseinandersetzung mit anderen – selbst begründen und gestalten und dabei Gemeinschaften gründen, in denen verschiedene koexistieren können.[7] Dieses Konzept des Philosophen Jean-Luc Nancy verbindet Newman nun mit jenem des „Einzigen“ von Max Stirner. Individualistisch von Einzelnen auszugehen soll allerdings nicht dazu führen, dass diese auf Andere keine Rücksicht nehmen oder sie mitdenken, sondern freiwillige Assoziationen nach Affekten und Anziehung statt erzwungener Gemeinschaften ermöglichen.

Darauf aufbauend entwickelt Newman ein Konzept von Aufstand („insurrection“), welcher wie die Soziale Revolution darauf abzielt, soziale Beziehungen zu transformieren, dabei aber im Unterschied zu dieser entscheidend von der Selbst-Befreiung motiviert wird und somit auf Selbstermächtigung beruht. Ziel ist nicht die Errichtung einer neuen sozialen Ordnung, sondern die Entwicklung von Autonomie, welche sozusagen erst im Moment des Aufstands entsteht bzw. sich weiterentwickelt. Der Aufstand unterscheidet sich von den meisten politischen Handlungen und ist „eine mikro-politische Transformation des Selbst in seiner Beziehung zur Macht durch die wir befähigt werden, uns selbst aus dem System der Macht und unserer Abhängigkeit von ihr, sogar unserer Sehnsucht nach ihr, herauswinden“.[8]

Mit der Veränderung des Selbst liegt sein Fokus auf der Veränderung der „unmittelbaren Beziehungen zu Anderen und auf der Entwicklung von autonomen Lebensweisen, die versuchen die Falle der Macht zu vermeiden. Der Aufstand ist der relationale Raum der Freiheit, der geöffnet wird wenn wir unser Leben ausserhalb jenen institutionellen Rahmens und vorgeschriebener Ziele zurückfordern und bestärken“[9]. Was die Einzelnen dabei aus der gewonnenen Freiheit machen, ist ihnen selbst zu überlassen. Das bedeutet umgekehrt nicht, dass im Anarchismus keine ethischen Massstäbe entstehen können. Dafür zentral ist die präfigurative Politik, das heisst, dass gegenwärtige Aufstände konkrete neue Arten von Solidarität und in-Gemeinschaft-sein hervorbringen sollen.

Die (philosophische) Besprechung von Aufständigkeit führt Newman unweigerlich zur Frage der Gewalt. Hierbei bezieht er sich einerseits auf den Mythos des Generalstreiks des umstrittenen George Sorel sowie Walter Benjamins „Kritik der Gewalt“. Dazu stellt er dar, warum in anarchistischem Denken von einem „sozialen Krieg“ ausgegangen wird, den die herrschenden Klassen gegen die Unterworfenen führen – auch wenn es darin Phasen einer Befriedung gibt, die allerdings entscheidend durch Gewalt durchgesetzt und aufrechterhalten wird. Gezeigt wird, dass Sorels militaristisch anmutende Beschreibungen von Gewalt vor allem auf Ermächtigung abzielen und in diesem Sinne viel weniger gewaltsam sind, als das bestehende System einerseits, aber auch politische Revolutionen andererseits.

So ist die „Idee von Autonomie für den proletarischen Generalstreik zentral: Sie hat nichts damit zu tun, mit dem System über bessere Bedingungen zu verhandeln, vielmehr stellt sie eine vollständige Loslösung der Arbeiter*innen vom Staat und Kapitalismus durch die Kultivierung alternativer sozialer Praktiken, Subjektivitäten und ethischen Beziehungen, dar“[10]. Benjamin denkt wiederum vor, wie nach ethischen Richtlinien statt nach Gesetzen gehandelt werden kann, die selbst durch Gewalt eingesetzt und aufrechterhalten werden. Postanarchismus mit Nicht-Gewalt gleichzusetzen wäre zu einfach. Die offensive Thematisierung von Gewalt führe jedoch zu ihrer Transformation und Möglichkeiten zur gemeinsamen Setzung ethischer Richtlinien statt moralischer Befehle und Gesetze.

Wie aber können Menschen mit ihrer freiwilligen Knechtschaft brechen? Zunächst, indem sie sich von der Herrschaft distanzieren und vor allem selbst mit ihrer Sehnsucht nach Beherrschung/Herrschen auseinandersetzen, die sich in vielen Formen von Identifikation, Passivität, konformen Verhaltensweisen, Verhaltens- und Kommunikationsmustern widerspiegelt. Als erste Person scheint Étienne de La Boétie das Phänomen der freiwilligen Knechtschaft behandelt zu haben (1548). Die Frage, warum Menschen gehorchen und sich selbst unterwerfen ist dabei so einfach, wie tatsächlich bis heute ungeklärt.

Fest steht, dass sie nicht allein passiv, vor allem aus Angst vor Bestrafung, oder aufgrund eines „falschen Bewusstseins“ geschieht, sondern Menschen ihre Beherrschung immer wieder aktiv wählen oder gar einfordern. Newman arbeitet heraus, dass La Boétie drei Faktoren dazu ausmacht. Erstens, die Gewöhnung an die Knechtschaft und das „Vergessen“ der Freiheit. Zweitens, die Verführungen und Verwirrungen mit denen Herrschaft arbeitet, um uns mit Spektakel und Ritualen irrezuführen. Drittens konstruiert Macht selber hierarchische Beziehungen und Netzwerke der Abhängigkeit von ihr, sodass unsere Unterordnung und unser Gehorsam durch jene abgesichert werden, welche in der Hierarchie unmittelbar über uns stehen.[11]

Der Knackpunkt bei La Boétie ist, dass er davon ausgeht, dass alle Macht von den Menschen selbst kommt, welche sie dem Tyrann (oder anderen, auch symbolischen Herrschern) übertragen. Wenn Herrscher aber aus sich selbst heraus keine wirkliche Macht haben, bedeutet dies, dass sie ihnen prinzipiell verweigert werden kann. Selbstermächtigung führt dabei automatisch zur Schwächung der Herrschaft, wenn sich mit ihr nicht einfach in Opposition gestellt, sondern aus dem Machtspiel tatsächlich ausgetreten wird. Im Unterschied zu den meisten (konservativen) Vorstellungen, dass es Herrschaft bräuchte, die eine Ordnung der Freiheit ermögliche, kann von La Boétie daher abgeleitet werden, dass „Freiheit“ umgekehrt durch keine Herrschaftsordnung erreicht werden kann. Praktiken und Beziehungen der Freiheit sind dabei aber nicht einfach gegeben, sondern fortwährend zu üben und weiterzuentwickeln.

Auf Grundlage der vorherigen Überlegungen zu Anarchie als vorhandenen Praktiken und Beziehungen, zu Singularitäten, Aufstand und freiwilligen Ungehorsam thematisiert Newman schliesslich wie es möglich ist, ausserhalb des Bestehenden zu denken. Erneut begreift er dabei Postanarchismus nicht als bestimmtes revolutionäres Projekt, sondern als bestimmte Empfindsamkeit, Haltung oder Lebensweise aufgrund vorhandener Freiheiten. Unter Autonomie wird allgemein Selbstregierung verstanden. Diese will Newman allerdings deutlich von liberalen Vorstellung von ihr unterschieden wissen, da beispielsweise Immanuel Kant Gehorsam als Ausdruck vernünftigen Willens begreift und den Staat als Ergebnis einer universellen Moral und Vernunft ansieht.

Vor allem beruht sie auf der Idee von einander abgeschnittener, konkurrierender „bürgerlicher“ Individuen. Doch das Selbst „hat kein Wesen, sondern ist eine Abfolge von Werden, ein weiterführendes Projekt der Selbstgestaltung ohne klares Ende oder Ziel („telos“). Aus dieser Perspektive sollte Autonomie nicht als Status gesehen werden, den jemand erreicht, sondern vielmehr als Reihe agonistischer [= „kämpferischer“] Praktiken, hervorgebracht im Kontext von Zwängen und Begrenzungen, sowohl äusseren, als auch inneren“[12]. Ungehorsam bedeutet demnach heute nicht nur bestimmte Gesetze zu übertreten sondern verlangt andere Lebensformen und Selbstwahrnehmungen.

File:ILÜ der Bundeswehr am 24.09.2012 -- Panzergr.jpg

Wichtig ist Newman zudem Autonomie und Demokratie voneinander zu unterscheiden. Wenn sich Menschen egalitär und beispielsweise basisdemokratisch organisieren, sei dies nicht Voraussetzung für autonome Lebensformen, sondern umgekehrt Ausdruck dieser. Demokratie sei somit eine notwendige aber nicht ausreichende Bedingung für Autonomie und nicht nur aufgrund von Mehrheitsprinzipien zu kritisieren, sondern auch wegen Zwängen zur Unterordnung unter entfremdete, als allgemein behauptete, Wertvorstellungen und Ideen. „Demokratische Souveränität und Autonomie sind daher zwei sehr unterschiedliche Prinzipien: das erste ist kollektivistisch und absorbiert das Individuum in einen gespenstigen Volkskörper, der dazu tendiert eine Figur staatlicher Souveränität zu sein; das zweite ist singulär und verkörpert die Möglichkeit ethischer und politischer Differenz die sich bisweilen gegen den Willen von Leuten richten mag“.[13]

Autonomie im hier verstandenen Sinne ist also eine ethische Anfechtung von Herrschaftsverhältnissen und wird durch (widersprüchliche) Versuche der Selbstorganisation verwirklicht. Deswegen besteht für radikale Politik „heute die zentrale Herausforderung nicht darin, bessere Prozeduren und Kanäle für demokratische Beratung zu entwickeln; aus Demokratie sollte kein Fetisch gemacht werden. Stattdessen muss das Gemeinsame mit und durch die Einzelnen gedacht werden, müssen Formen der Assoziation und Gemeinschaft gedacht werden, die singuläre Projekte der Einzigkeit und ethischen Selbst-Transformation nicht verdecken, sondern diese im Gegenteil intensivieren durch ihre Unterschiedlichkeit. […] Statt Versuchen ein Volk zu konstruieren und die Staatsmacht zu übernehmen – ein Projekt dass nur durch Vertreter*innen erreicht werden kann, die darin enden ‚das Volk‘ von seiner eigenen Macht zu entfremden – bekräftigt radikale Politik heute eine souveräne Indifferenz [= Gleichgültigkeit] gegenüber Macht“.[14]

Nach der Lektüre von Postanarchism bleibt der Eindruck, ein kompliziertes, aber spannendes Buch gelesen zu haben. Die Bekräftigung unserer Möglichkeiten anders zu handeln und anders zu werden, sind enorm wichtig unter Bedingungen, in denen Menschen permanent Ohnmacht erfahren, sich hilflos fühlen und autoritäre Sehnsüchte nach Beherrschung und Herrschaft sich nicht einfach durch einen antiautoritären Stil aus der Welt schaffen lassen. Dennoch scheint es mir wie eingangs geschrieben sehr wichtig, die sozialen Bedingungen unter denen Praktiken der Freiheit geübt werden können zu benennen. Dies tat Newman allerdings auch 15 Jahre zuvor nicht, wo er schon die meisten der hier behandelten Fragen anfängt zu diskutieren.[15] Hier bleibt eine Leerstelle auch wenn die Überlegungen insgesamt sehr inspirierend sind. Nach dieser gründlichen Selbstkritik sollten Menschen meiner Ansicht jedoch anschliessend wieder anarchistische Programme entwickeln und vorschlagen.

———————————————

Saul Newman: Postanarchism. Polity 2015. 180 Seiten, ca. 22.00 SFr. ISBN: 978-0745688749 Fussnoten:

[1] Newman, Saul, The Politics of Postanarchism, Edinburgh 2010, S. 4f.

[2] Newman, Saul, The Politics of Postanarchism, Edinburgh 2010, S. 182. / Alle Zitate aus eigener Übersetzung.

[3] Newman, Saul, Postanarchism, Cambridge 2016.

[4] Meta-Narrativ bedeutet „grosse Erzählung“, also beispielsweise die Vorstellung, dass sich die ganze Gesellschaft (zwangsläufig oder durch Kämpfe) zum Sozialismus hin entwickeln wird. Auch die kapitalistische Gesellschaft beruht auf so einer Erzählung, die allerdings lange behauptet hat, „ideologiefrei“ (und alternativenlos) zu sein. Seit der globalen Finanz- und Wirtschaftskrise ab 2011 wird Kapitalismus zunehmend wieder als Ideologie verstanden. Allerdings scheint die (umfassende und „realistische“) Alternative zu ihm zu fehlen. Auch wenn Anarchie vor allem eine praktische Angelegenheit ist, ist es wichtig, dass aus dem Anarchismus heraus neue Erzählungen entwickelt werden, wie und wohin die heutige Gesellschaft grundlegend geändert werden kann.

[5] Ebd., S. 13.

[6] Ebd., S. 31.

[7] Siehe zu dieser Thematik auch: Kuhn, Gabriel, Jenseits von Staat und Individuum. Individualität und autonome Politik, Münster 2007.

[8] Ebd., S. 54.

[9] Ebd., S. 56.

[10] Ebd., S. 79.

[11] Ebd., S. 101f.

[12] Ebd., S. 124.

[13] Ebd., S. 101f.

[14] Ebd., S. 136f..

[15] Saul Newman, From Bakunin to Lacan. Anti-Authoritarism and the dislocation of power, Plymouth 2007 [2001].

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————–

Grafikquellen         :

Oben          —       Graffiti on the train line leading to Centraal Station in Amsterdam. Photo by Gary Mark Smith. ( Freiheit lebt, wenn der Staat stirbt.)

Author

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————

2.) von Oben        —           Systemkritische Protestfahne „BananenRepublik Deutschland“

This file is licensed under the Creative Commons Attribution 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on by the administrator or reviewer File Upload

Abgelegt unter Mensch, Positionen, Regierung, Umwelt | Keine Kommentare »

Internaltionale Textilien :

Erstellt von DL-Redaktion am 12. November 2019

Textilindustrie: Ausbeutung bleibt in Mode

Quelle      :         INFOsperber CH.

Von Red

Nur zwei von 45 Modeunternehmen zahlen den Textilarbeitern Löhne, die zum Leben reichen. Das zeigt eine aktuelle Firmen-Befragung.

Unmenschliche Arbeitsbedingungen und Hungerlöhne, die kaum zum Leben reichen: Seit Jahren stehen Modekonzerne deswegen in der Kritik. Und seit Jahren bemüht die Branche dieselben Ausreden, gelobt Besserung und verweist auf freiwillige Massnahmen einzelner Unternehmen oder Brancheninitiativen, die für faire Löhne in den Zulieferfabriken sorgen sollen. Nur: In der Praxis sind diese Absichtserklärungen nichts wert. Ausbeutung bleibt in der Textilindustrie der Normalfall. Zu diesem Schluss kommen Public Eye und die Clean Clothes Campaign (CCC) in ihrem neuen Firmencheck 2019: «Existenzlöhne in der globalen Modebranche».

Die Organisation hat 45 internationale Modeunternehmen unter die Lupe genommen. Das Resultat ist ernüchternd: Kein einziges Unternehmen stellt sicher, dass alle Arbeiter in der Lieferkette einen Lohn erhalten, der zum Leben reicht. Nur zwei der befragten Unternehmen (Nile und Gucci) zahlen wenigstens einem Teil der Beschäftigten in der Produktion einen existenzsichernden Lohn (siehe Kasten).

Anteil der Arbeiterinnen in der Lieferkette*, die einen existenzsichernden Lohn erhalten:0 Prozent: Adidas, Albiro, Aldi, Amazon, C&A, Calida Group, Chicorée, Coop, Decathlon, Esprit, Fruit of the Loom, Gap, G-Star RAW, H&M, Holy Fashion Group, Hugo Boss, Inditex, Intersport, KiK, Levi’s, Lidl, Mammut, Manor, Maus Frères, Migros, Nike, Odlo, Otto Group, Peek & Cloppenburg, PKZ, Primark, Puma, PVH, Remei AG, Sherpa Outdoor, Tally Weijl, Tchibo, Triumph, Under Armour, Uniqlo, Workfashion, Zalando, Zebra Fashion AG

Mindestens 25 Prozent: Gucci (für einige italienische Produktionen)

Mindestens 50 Prozent: Nile

* Mindestens auf Ebene der Konfektionierung

Laut Definition der Clean Clothes Campaign muss der Existenzlohn die Grundbedürfnisse einer Familie mit zwei Kindern abdecken. Und es sollte noch etwas Geld übrigbleiben für unvorhergesehene Ausgaben. Doch die meisten Beschäftigten in der globalen Modeindustrie erhalten gerade mal den lokal geltenden Mindestlohn. Der ist jedoch in den meisten Produktionsländern so niedrig, dass er kaum zum Leben reicht.

Freiwilligkeit reicht nicht

Neun Unternehmen, darunter C&A, H&M, Inditex, Mammut, Nile und Tchibo haben sich – zumindest auf dem Papier – verpflichtet, Existenzlöhne zu zahlen. Allerdings konnte «keine Firma eine messbare, transparente und glaubwürdige Strategie mit einem Aktionsplan vorweisen, um einen existenzsichernden Lohn zu erreichen», stellt der Bericht fest.

File:Tovarna Banglades.jpg

Einige Unternehmen (C&A, Esprit, H&M, Inditex, Tchibo, Primark, PVH, Zalando) beteiligen sich am freiwilligen Programm ACT, das die Löhne in der Textilindustrie durch nationale Branchen-Tarifverträge erhöhen will. Allerdings blieben die Verhandlungen zwischen Gewerkschaften und Lieferanten bisher ergebnislos.

Coop, Migros, Manor, Calida Group, PKZ, Aldi, Lidl, Chicorée, Tally Weijl und zahlreiche andere Modeanbieter haben sich der freiwilligen Unternehmensinitiative amfori BSCI angeschlossen. Bei amfori BSCI wird der Existenzlohn als «erstrebenswertes Ziel» angesehen und nicht als unmittelbar umzusetzende Verpflichtung.

Die ernüchternde Schlussfolgerung des Firmenchecks 2019: Trotz vieler freiwilliger Einzel- und Brancheninitiativen hat sich in den letzten Jahren die Lohnsituation in den Kleiderfabriken der Billigproduktionsländer kaum verbessert. Dabei seien die Firmen oft eher Teil des Problems als der Lösung, stellen die Verfasser fest – «indem sie im Standortwettbewerb Fabriken und Produktionsländer gegeneinander ausspielen, sich nicht klar und öffentlich für höhere Löhne einsetzen und keine Garantien für faire Einkaufspreise abgeben». «Die Modekonzerne müssen endlich verbindliche Massnahmen hin zu Existenzlöhnen ergreifen», fordern Public Eye und Clean Clothes Campaign. «Ein Aktionsplan mit konkreten Zielsetzungen, rechtsverbindlichen Vereinbarungen und einem ambitionierten Zeitplan ist absolut überfällig.»

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

—————————————————————-

Grafikquellen      :

Oben       —       Das eingestürzte Gebäude

—————————

Unten        —          Textilní továrna v bangladéšské Dháce

Author NaZemi

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Arbeitspolitik, International, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Elektroautos : Aus Aachen

Erstellt von DL-Redaktion am 12. November 2019

Versucht die fossile Autoindustrie dies zu verhindern?

File:StreetScooter C16.jpg

Quelle       :     Scharf  —  Links

Von Walter Schumacher

Vor über 100 Jahren wurden in Aachen schon mal Autos hergestellt [1].
Seit 2014 gibt es erneut eine Autoproduktion: mit dem „Streetscooter“ und dem e.Go“ werden zwei besonders sinnvolle Elektro-Auto-Typen [2] entwickelt, serienreif gemacht und hergestellt, die wirklich beispielhaft sind für „vernünftige“ E-Autos! [3]

Während einerseits alle politischen und wirtschaftlichen Indikatoren in Richtung eines großen Erfolgs für das Produkt stehen, kommen aber weder die Produktion noch die Auslieferung dieser Fahrzeuge richtig in Gang!

Manipuliert die „fossile“ Autoindustrie die Herstellung vernünftiger Elektro-Autos?

Als kraz beobachten wir diesen erstaunlichen Widerspruch schon seit langem und stellen uns die Frage: Wird die Produktion vernünftiger E-Autos in Aachen gewollt behindert? Und warum könnte das geschehen?

Vorweg das Besondere an Streetscooter und e.Go

  • Der erste war der „Streetscooter“ (10/2015). Er ist ein Elektro-Lieferwagen und es gibt ihn in zwei Größenvarianten: „klein“ wie ein VW-Transporter und „groß“ wie ein Mercedes-Sprinter. Es ist ein zweckmäßig konstruiertes, einfaches Fahrzeug. Die Einzelkomponenten sind weitestgehend Standardprodukte.
    Er passt perfekt in das Anforderungsprofil „Versorgungs- und Arbeitsfahrzeuge im Nahbereich“ (<150km) mit vielen Zwischenhalten, Rückkehr zu einem festen Standort und einem Fahrzeugpool bei flexibler Nutzung von Firmen. Ein perfektes Fahrzeug für ALLE städtischen und regionalen Lieferdienste.
    Die Streetscooter gingen sehr schnell an die Kunden. Seither laufen etwa 10.000 Fahrzeuge in einem harten Alltagsbetrieb. Es sind keine bemerkenswerten Produktionsfehler bekannt geworden.
  • Das zweite Aachener Fahrzeug ist der „e.Go“ (seit 2016), ein kleiner Stadtwagen. Vom Raumangebot her ist er zwischen Smart und Fiat 500/VW Lupo angesiedelt. Technisch ist er komplexer als der Streetscooter, basiert aber auf den Erfahrungen bei dessen Entwicklung. Auch hier werden sehr einfache Komponenten verwendet. Es gibt keine technisch-sachlichen Gründe für Lieferprobleme der Komponenten (außer: man will nicht liefern). Ebenso wenig sind Probleme bei der Zulassung des Wagens bekannt.
    Das Anforderungsprofil ist gezielt für den innerstädtischen Ein-/Zwei-Personenverkehr konzipiert; entweder als Firmenpool-Wagen oder aber als privater Zweitwagen. Mit einem Preis von <20.000€ ist der e.Go deutlich preiswerter als die heutigen anderen E-Autos!

Beide Wagen sind auf ein Käuferpublikum mit folgenden Eigenschaften ausgerichtet: Zweckmäßige Nutzung eines Fahrzeugs, ökologische Orientierung, kein Bedarf an psychologischem Imageaufbau/Protzen (ich-bin-männlich, ich-bin-sportlich, ich-bin-reich).
Diese positive Bewertung bezieht sich ausdrücklich auf das genannte Nutzersegment. [3] Es sind keine klassischen Allzweckautos – da müsste sich noch deutlich was an der Batterietechnik tun. Aber für die genannten Nutzungssegmente gibt es zur Zeit nichts besseres als diese beiden Wagentypen!

==> Hierzu ein positiver Bericht in Auto-Motor-Sport

Die bisherige (kurze) Geschichte von Streetscooter und e.Go

  • Der „Streetscooter“ startete 2014 fulminant und machte ansehnliche Produktionszahlen. Die Firma (Produktionsanlagen) wurde 2014 von der Post AG aufgekauft und sogar noch in Düren durch ein zweites Werk erweitert – und dann würde es plötzlich ganz ruhig um den Wagen.
    Anfangs war er ein Verkaufsrenner. Die Post hat über 10.000 Fahrzeuge im Einsatz, man sieht das Fahrzeug aber auch bei anderen Lieferdiensten. Trotz dieser Erfolge wird der Streetscooter mittlerweile als Sorgenkind präsentiert, Gerüchte besagen, dass die Post das Werk wieder verkaufen will.
  • Den „e.Go“ gibt es seit 3/2017. Seit 5/2017 kann man den Wagen prinzipiell! kaufen. Und mittlerweile arbeiten 500 Leute in dem e.Go-Werk – aber der Wagen wird einfach nicht ausgeliefert!
    Seit mindestens 11/2018 gibt es auf der Hohen Straße in Köln einen großen ‚e.GO Pop-Up Store‘, in dem systematisch Werbung für den Kauf des e.Go macht. Die Verantwortlichen werden das Geld dafür doch nur in die Hand genommen haben, weil sie selber den baldigen Verkauf des Wagens erwartet hatten.
    Stattdessen werden halbjährlich Ausreden für die Nicht-Auslieferung veröffentlicht und die (willigen) Kunden immer wieder vertröstet. Ursprünglich sollten 3000 Fahrzeuge bis Ende 2019 produziert werden. Die Auslieferung ist aber erneut ins Jahr 2020 verschoben worden.
    Den e.Go gibt es „theoretisch“, aber aus irgendwelchen dubiosen Gründen ist er einfach nirgends zu kaufen! Auch der OB Philips wartet nach eigener Aussage immer noch auf „seinen“ e.Go!

Warum also Probleme – bei beiden E-Fahrzeugen?

Diese mysteriöse Geschichte über „Produktionsprobleme“ wird halbjährlich in den lokalen Zeitungen mit wortreichen Ausreden und erstaunlichen Meldungen begründet. Die letzte Überschrift dazu lautet am 19.10.2019 in den AN „e.Go räumt Produktionsprobleme ein.

  • Zu Problemen beim „Streetscooter“ ist (öffentlich) nichts bekannt!
  • Beim e.Go werden öffentlich folgenden Gründe genannt:
    • Der Lieferant ‚Ford‘ liefert nicht. (Was, welche Teile und warum? Ist unklar)
    • Der Batterielieferant ‚BMZ‘ ziert sich mit Lieferungen.
    • Und echt witzig: in den AN vom 19.10.19 wird eine „IP67-Regel für technische Geräte“ zitiert, die folgende skurrile Auflage enthält: „technische Geräte müssen auch nach einem mind. 30 minütigem Tauchbad im bis zu einem Meter tiefen Wasser voll funktionsfähig sein“. Und weil Lieferkomponenten diese Regel nicht erfüllen, darf der e.Go nicht gebaut werden?? Hmm!?

Es gibt ein ganz anderes, aber echtes Problem beim e.Go

Dort entstehen monatliche Unkosten von 2-3 Mio Euro! Seit Monaten sind dort ca. 500 Leute beschäftigt, was bei e.GO mindestens 2-3 Mio Euro Kosten, ohne jedwede Einnahmen erzeugt. Es müsste also ein Kostenproblem existieren – das aber öffentlich NICHT problematisiert wird.

Wieso führt das eigentlich nicht zum Bankrott? Wer bezahlt das?
Sorgt VW dafür, dass das Werk nicht pleite geht? Sorgt VW für Ruhe an den Arbeitsplätzen (wo ja faktisch nicht produziert wird) und „erkauft“ sich (wörtlich) so die Zeit, um seine wesentlich teureren Modell an den Markt bringen zu können? Die Erklärung könnte in der „Strategischen Partnerschaft“ von VW und e.Go liegen (siehe weiter unten).

Unsere Vermutung:
Es gibt einen Boykott der Auto-Industrie gegen ein vernünftiges E-Auto!

Je öfter sich die Ausreden für die Nicht-Lieferung des e.Go wiederholen, desto mehr fragen wir uns, ob wir gerade Zeugen werden, wie die (fossile) deutsche Autoindustrie mit trickreichen Mitteln verhindert, dass endlich mal vernünftige Elektro-Autos (statt der gigantischen E-SUVs) auf den Markt kommen?

Wir haben deshalb mal zusammengestellt, was wirklich hinter dieser eigenartigen und für Aachen (als perspektivischem Produktionsstandort) etwas bitteren Geschichte stecken könnte.

Indizien für eine „gewollte Produktionsbehinderung der sinnvollen E-Autos“

Unser Denkansatz lautet: Die Produkte Streetscooter und e.Go sind (vom Timing und der Funktionsweise) viel zu gut, sodass sie den ganz Großen in der Automobilbranche als Konkurrent echten ökonomischen Ärger machen und deshalb auf dem Markt stark „eingehegt“ oder besser noch „verhindert“ werden müssen. Möglicherweise hatte die fossile Autoindustrie beim Streetscooter noch erwartet, dass die RWTH-Newcomer es nicht schaffen würden. Aber nachdem der Streetscooter dann doch ein Erfolg wurde, wollten sie beim e.Go „besser aufpassen“. Die folgenden Argumente gelten für beide Fahrzeuge.

  • „Zeit schinden, um noch ein/zwei Jahre fossile Autos verkaufen zu können“ (= ExtraProfit-sichern). Jeder Monat spätere Auslieferung guter E-Autos schafft „Zeitraum“ für den Verkauf weiterer (gewinnbringender) Fossil-Autos.
  • „Zeit schinden, um als erstes Protz-E-Autos verkaufen zu können“ (=ExtraProfit-sichern). Solche sinnvollen E-Autos kommen für die fossile Autoindustrie „zu früh“, weil:
    • der Markt für dicke E-SUVs & schnelle E-PKW frei bleiben soll. Leute mit viel Geld wollen sich ein „grünes Image“ kaufen und zahlen dafür auch gerne viel Geld ….
    • erst nach Abdeckung dieses Marktanteils, „lohnt“ sich auch die Belieferung des preiswerteren Marktsegments.
      Sobald einmal der e.Go für 16.000 – 19.000 € auf der Straße zu sehen sein wird, brechen mit Sicherheit die Verkaufszahlen all der wunderschönen E-Golfs E-Opels, E-BMW, E-Benz ein, die zwar (sinnloserweise) in 3 Sek von Null auf 100 km/h „können“, aber preislich mindestens ein/zwei Klassen teurer sind.
  • „Diskreditieren“
    Diese Protz-E-Autos werden die Diskussion um die E-Mobilität bestimmen, weil viele ernsthafte Umweltschützer leider ausschließlich den Irrsinn der Protz-E-Autos sehen werden. Die Relevanz von sinnvollen E-Autos wird dann (wie beabsichtigt?) in den Hintergrund gedrängt.
  • „E-Auto als Spielzeug“?
    siehe zusätzlich auch den Artikel „Produziert e.Go Mobile bald ein VW-Funcar?

Eine vergiftete „strategische Partnerschaft“ mit VW?

Es gibt eine vertraglich/kommerzielle Verbindung zwischen VW und e.Go, die ebenfalls für die von uns unterstellte, bewusste Behinderungs-Strategie spricht: Wir wissen, VW will e.Go als Basis für die eigene, zukünftige E-Mobilitätssparte haben. (In den AN vom 5. März 2019 heißt es dazu: „… Der Weltkonzern öffnet seinen Elektrifizierungsbaukasten (MEB), mit dem es ab 2020 die neue Generation von Elektroautos bauen will, … e.GO ist weltweit der erste Partner in der Elektrosparte … Das Aachener Unternehmer profitiert doppelt von der Kooperation: Zum einen kann der Baukasten in die gerade anlaufende Produktion des eigenen e.GO life integriert werden. Und beide Unternehmen entwickeln in den kommenden Monaten gemeinsam ein Elektro-Auto, das die VW-Flotte ergänzen soll….“ (https://www.aachener-nachrichten.de/nrw-region/kooperation-von-ego-und-vw-neue-elektroautos-in-aachen-produziert_aid-37182963)

Das würde einerseits erklären, wer und warum die Übernahme der aktuell entstehenden Kosten übernimmt. Unfreundlich formuliert ist das dann ein „Leerlauf-Geld“ oder „Bestechungsgeld“ von VW, damit im Aachener e.Go-Werk Ruhe herrscht und man „freiwillig“ nicht liefert, um so den Markt für die in 2020 kommenden (erhofften) VW-Modelle „frei“ zu halten.

Beides macht Sinn für VW: Einerseits so den gefährlichen Newcomer klein halten; gleichzeitig sich dessen Know-how für die eigenen (eigentlich zu spät) kommenden Goliath-Aufgaben an zu eignen!

Es KÖNNTE aber auch ganz anders sein…

Es gibt doch echte Probleme bei der Produktion – eine simplere Erklärung?
Dann wären die Produktions- und Auslieferungsverzögerungen Ergebnis echter Probleme und zeigen nur, dass eine RWTH (bzw. das kommerzielle Spin-Off) nicht in der Lage ist, ein sinnvolles verkäufliches Produkt zu entwickeln, technisch zu planen und zu produzieren. Wir von der kraz glauben DAS nicht.

Zum Schluss eine Bitte

Wir haben versucht, eine wichtige Wirtschaftsentwicklung in Aachen zu beschreiben. Uns fehlen eine Reihe von Fakten, wir haben nur „mögliche“ Erklärungen geliefert. Unsere LeserInnen mögen selber entscheiden, was da eigentlich los ist.

Als kraz-Redaktion würden wir uns aber freuen, wenn wir Insider-Informationen bekämen, die unsere genannten Thesen entweder stützen oder aber widerlegen. Uns geht nicht um das „Recht-Haben“, wir wollen „verstehen“.

Anmerkungen

[1] Zur Geschichte der Aachener Auto-Produktion
Zu Beginn des vorigen Jahrhunderts (1903) gab es eine Automobilproduktion in Aachen durch die Firmen Fafnir und Cudell. Aber schon 1926 war alles wieder vorbei. Deshalb war es schon eine Sensation, als Streetscooter und e.Go als Spin-Offs der RWTH neu auftauchten.

[2] Das Missverständnis im Namens „Elektro-Auto“
Ein Elektro-Auto heißt so, weil der Antrieb „elektrisch“ ist. Der Strom für den Antrieb kann prinzipiell auf unterschiedliche Art ins Fahrzeug gelangen (Straßenbahnen und O-Busse bekommen ihn per Oberleitung). Bei Autos ist der heutige Standard eine (Lithium)-Batterie. Sie könnten aber genauso gut durch Brennstoffzellen (Wasserstoff) mit Strom versorgt werden! Eine (veraltete) Zwischenlösung war ein kleiner fossiler Motor im Fahrzeug, der dessen Batterie und damit die Elektromotoren mit Strom versorgt.

[3] Unser hohes Lob für den Streetscooter und den E.Go könnten so wirken, als ob wir E-Autos für DIE Lösung der städtischen oder gesellschaftlichen Problematik des Autoverkehrs halten.
Nein, wir wissen sehr wohl, dass Elektrofahrzeuge auch den gleichen Platz verbrauchen, den Fuß- und Radverkehr gefährden und verdrängen, die Städte mit Lärm verpesten usw. usf.. Elektroautos sind nur in einigen Bereichen ein echter Fortschritt gegenüber den fossilen Autos. In anderen sind sie genauso schlecht und für das „schlechte Gewissen bei der Autonutzung“ sind E-Autos sogar eher verführerisch, um sich so ein reines Gewissen zu verschaffen!
Wir wissen, dass die wirkliche Lösung ein anderes Verkehrskonzept (= anderer Modalsplit) mit viel mehr Öffentlichem Verkehr (ÖV) sein muss und sein wird. Hierzu gab und gibt es in Aachen Überlegungen („Renaissance der Tram“), über die wir in einem längeren Artikel berichten werden.

Datei:Streetscooter 3.JPG

ABER: Wir wissen auch, dass die Umformung unserer Lebenswelt in Auto-gerechte-Städte – und leider auch des „Denkens“ der Menschen im Sinne einer ‚Windschutzscheibenperspektive‘ – „erfolgreich“ gesteuert durch die Profitlogik der Autoindustrie gelungen ist und dass mit dem aktuellen Höhepunkt der Perversion durch SUVs und der aktuellen Automode mit den hochgeschürzten, aggressiven Frontpartien der Autos eine spezielle Form der „Männlichkeit“ bedient wird.

Deshalb wird es – egal wie schnell ein deutlich besserer ÖV entwickelt wird – noch lange individuell fahrende Autos geben, die bestimmte Bereiche in den Städten und Regionen mit Autos statt mit ÖV bedienen. Unklar ist, wie lange es noch dauert, bis die selbstgesteuerten durch autonom fahrende Fahrzeuge ersetzt werden. Und spätestens DANN wird ein hoher Bedarf an elektrischen – statt fossilen Antrieben bestehen.

Deshalb wünschen wir uns jetzt schon die beschleunigte Entwicklung der Elektroautos – und gerne auch Aachen als die Stadt, in der die Vorreiterfahrzeuge entwickelt und produziert werden. Heute polemisieren noch nur noch genau diejenigen gegen E-Fahrzeuge, die bisher immer die fossile Industrie und ihre Protz-Autos erhalten wollten. Wenn sie dabei heute das Argument „mehr ÖV“ verwenden, ist das nur verlogen. Wir sagen das aus Kenntnis der Verkehrspolitik der letzten 35 Jahre, die sich an zwei wichtigen Lobbyorganisation manifestiert hat: Dem ADAC (als reine Autolobby) und dem VCD (=Verkehrsclub Deutschland), der sich seit seiner Gründung 1986 eindeutig für ein sinnvolles Miteinander ALLER Verkehrsteilnehmer: Fußgänger, Radfahrer, ÖV-Nutzer und Autofahrer einsetzt.

Quelle: https://www.kraz-ac.de/elektroautos-made-in-aachen-5974

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen          :

Oben           —         Prototyp StreetScooter Leichtelelektromobil     C 16

Author Franz Haag

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

——————————-

Unten      —          Streetscooter – Ein batteriebetriebenes Lieferfahrzeug für die Deutsche Post, gebaut in Aachen von der Talbot Services GmbH

Urheber RudolfSimon

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Medien, Nordrhein-Westfalen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Dies ist die Rechnung

Erstellt von DL-Redaktion am 11. November 2019

Eine Protestwelle rollt über den Globus

Datei:US Navy 110315-N-2653B-148 A tug boat is among debris in Ofunato, Japan, following a 9.0 magnitude earthquake and subsequent tsunami.jpg

Jack Shenker | The Guardian  / Der Freitag

Widerstand Eine Protestwelle rollt über den Globus, denn eine Generation fürchtet um ihre blanke Existenz.

„Ich bin 22 Jahre alt und das ist mein Abschiedsbrief“, sind die ersten Worte des jungen Mannes. Der Großteil seines Gesichts ist mit einem schwarzen Tuch verhüllt; nur die Augen sind zu sehen mit ihrem müden und harten Blick unter dem ungeordneten Pony. „Ich habe Angst, dass ich sterben und euch nie wiedersehen werde“, fährt er mit zitternden Händen fort. „Aber ich habe keine Wahl, als auf die Straße zu gehen.“ Der namenlose Demonstrant, einer von vielen in Hongkong, die ihren Familien und Freunden schreiben, bevor sie sich wachsender Polizeigewalt in der Stadt entgegenstellen, ist von der New York Times in einem anonymen Treppenhaus mit der Kamera aufgenommen worden. Aber er hätte überall sein können, und das nicht nur, weil die Wände hinter dem 22-Jährigen weiß und nichtssagend sind, um seine Identität zu schützen. Von Ostasien bis Lateinamerika, von Nordeuropa bis Nahost versammeln sich gerade junge Leute in Hauseingängen und Hinterhöfen, Gassen und Kellern, deren Gesichter eine ähnliche Mischung aus Hochgefühl und Erschöpfung zeigen.

„Das ‚Chaos von Hongkong‘ ist inzwischen in der westlichen Welt angekommen“, schreibt der einstige chinesische Diplomat Wang Zhen in einem offiziellen Papier der Regierung in Peking. Die Demonstranten in Barcelona würden von denen in Hongkong inspiriert. „Es ist zu erwarten, dass diese Flutwelle andere Staaten und Städte trifft.“ Womit Wang richtigliegt. In der Woche, da Demonstranten für Kataloniens Unabhängigkeit den Flughafen von Barcelona besetzten und die Autobahnen zum Stillstand brachten, besetzten „Extinction Rebellion“-Umweltaktivisten Brücken und Kreuzungen in London, was zu fast 2.000 Festnahmen führte. Beide Mobilisierungskampagnen übernahmen Taktiken aus Hongkong, darunter die der beweglichen Ziele – inspiriert von Bruce Lees berühmtem Mantra „Sei wie das Wasser“ und einer Sammlung von Handzeichen, um die Sicherheitskräfte auszutricksen.

Verlust von Gewissheiten

Unterdessen wird der Libanon von den größten Demonstrationen seit Jahrzehnten erschüttert, und im Irak sind bei regierungskritischen Protestaktionen mehr als 250 Menschen getötet worden. In Ägypten hat ein allgemeines Dissensverbot durch die brutale Diktatur von Präsident Abdel Fatah al-Sisi nicht verhindern können, dass Ende Oktober im ganzen Land sporadisch Anti-Regime-Proteste aufflammten. In Algerien schwelt die Legitimationskrise einer politischen Ordnung weiter. Auf dem südamerikanischen Kontinent, wohin Wang früher als Botschafter Chinas entsandt war, erleben Länder wie Ecuador, Chile, Argentinien und Haiti Bürgeraufstände, die für die jüngere Vergangenheit beispiellos sind. Es gehen große Menschenmengen auf die Straße und treffen auf Sicherheitskräfte, die sie in Schach halten sollen.

Jeder dieser Aufstände hat einen eigenen Auslöser – erhöhte Transportkosten in Santiago oder eine Steuer für Nutzer von Nachrichtenkanälen wie Whatsapp in Beirut. Und jeder kennt unterschiedliche Muster von Governance und Widerstand. Von der sozialen Zusammensetzung her können die indigenen Demonstranten in Ecuador nicht mit denen verglichen werden, die gegen die Inhaftierung der Separatistenführer in Katalonien aufstehen; ebenso wenig steht das staatliche Verbot von Protesten in London auf der gleichen Stufe wie die Repression in Hongkong, wo ein Polizist einem Teenager mit scharfer Munition in die Brust schoss.

Unbestreitbar ist, dass wir den größten globalen Anstieg an Protestaktivität seit Anfang der 2010er Jahre beobachten. Vieles erinnert mit der Übernahme des öffentlichen Raumes an den Arabischen Frühling Anfang 2011, damals gefolgt von Occupy-Demonstrationen auf der Nordhalbkugel. Historisch gesehen gab es im vergangenen Jahrzehnt mehr Proteste als zu irgendeiner Zeit seit den 1960er Jahren. Trotz unterschiedlicher konkreter Ursachen gibt es einige Momente, die bei den jetzigen Rebellionen stets von Neuem auftauchen. Sich dies klarzumachen, kann helfen, unsere augenblickliche Anfälligkeit für politische Schwankungen und das sich ausbreitende Bewusstsein für den Verlust von Gewissheiten zu verstehen.

Datei:G20-Protestwelle Hamburg Rathausplatz 03.jpg

Eine offensichtliche Erklärung für das Phänomen des Aufruhrs ist auch die oberflächlichste: die Rolle der sozialen Medien. Sicher haben die digitalen Technologien flexiblere und horizontalere Organisationsmöglichkeiten geschaffen. Aber die Allgegenwärtigkeit dieser Werkzeuge im Jahr 2019 sagt nichts über die Motive, die die Menschen auf die Straßen treiben. Tatsächlich sind die sozialen Medien in vielen Staaten heute sowohl Instrument der staatlichen Repression wie der Revolte. Die wichtigste Gemeinsamkeit des Aufruhrs resultiert aus der Generation, die sich zeigt. Die Mehrheit derjenigen, die heute demonstrieren, sind Kinder der Finanzkrise von 2008/09. Eine Generation, die in den seltsamen und fiebrigen Jahren nach dem Kollaps einer kaputten ökonomischen und politischen Orthodoxie groß wurde, für die bisher kein Ersatz in Sicht ist.

Quelle          :      Der Freitag             >>>>>           weiterlesen

—————————————————————————-

Grafikquellen           :

Oben           —       Ofunato, Iwate Prefecture, Japan (March 15, 2011) A tug boat is among debris in Ofunato, Japan, following a 9.0 magnitude earthquake and subsequent tsunami. (U.S. Navy photo by Mass Communication Specialist 1st Class Matthew M. Bradley/Released)

Urheber U.S. Navy photo by Mass Communication Specialist 1st Class Matthew M. Bradley
Dieses Bild ist das Werk eines Seemanns oder Angestellten der U.S. Navy, das im Verlauf seiner offiziellen Arbeit erstellt wurde. Als ein Werk der Regierung der Vereinigten Staaten ist diese Datei gemeinfrei.

———————————

Unten      —         

Deutsch: Kundgebung bei der G20-Protestwelle auf dem Hamburger Rathausplatz
Datum
Quelle Eigenes Werk
Urheber Frank Schwichtenberg
Ich, der Urheber dieses Werkes, veröffentliche es unter der folgenden Lizenz:
w:de:Creative Commons
Namensnennung Weitergabe unter gleichen Bedingungen
Diese Datei ist lizenziert unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 4.0 international“.

Diese Datei steht unter einer Lizenz, die mit den Lizenzbedingungen von Facebook inkompatibel ist. Es ist daher nicht gestattet, diese Datei auf Facebook hochzuladen. Die Benutzung dieser Datei auf Facebook stellt eine Schutzrechtsberühmung und Urheberrechtsverletzung dar.

Abgelegt unter International, Medien, Mensch, Regierung | Keine Kommentare »

Schöner Kämpfen in Berlin:

Erstellt von DL-Redaktion am 10. November 2019

Das Hauskollektiv der K9

File:Berlin-Friedrichshain Kinzigstraße.jpg

Quelle       :        untergrund-blättle CH.

Von kinzig 9

Die Geschichte der Hausbesetzung an der Kinzigstrasse 9. Das Haus an der Kinzigstrasse 9 in Berlin ist mehr als ein reines Wohnprojekt. Es ist der Versuch, gemeinsam ein anderes Leben jenseits von gesellschaftlichem Anpassungsdruck, Vereinzelung und Entpolitisierung zu ermöglichen. Nach jahrelanger Besetzung wurde das Haus gekauft und in ein Genossenschaftsmodell überführt.

Im Jahre 1874 wurde die Kinzigstrasse strassenbaulich und planerisch erschlossen. Bereits 1881 errichtete man eine Remise, Ställe und kleinere Lagerschuppen auf dem Grundstück. Auf den Fundamenten dieser Erstbebauung entstanden später der Seitenflügel und die heutige Remise. Die für den damals noch Kolonie Friedrichsberg genannten Berliner Vorort rund um die Kinzigstrasse typische Bebauung mit kleineren Manufakturgebäuden und Ställen kann heute noch auf den benachbarten Grundstücken Kinzigstr. 25-29 besichtigt werden.

Die Entstehungszeit 1874 – 1900

1892/93 wurden die heute erhaltenen fünfgeschossigen Gebäude auf dem Grundstück Kinzigstrasse 9 (damals noch Blumenthalstrasse 42) unter der Leitung des Zimmerermeisters W. Schlundt errichtet. Auftraggeber war Tischlermeister T. Weinrich. Vorderhaus und Seitenflügel wurden als Wohngebäude, das Quergebäude als Fabrikgebäude für Weinrichs Tischlerei errichtet. 1893/94 wurden die noch vorhandenen Schuppen im Hof abgerissen und durch die heute vorhandene zweigeschossige Remise ersetzt.

Das Vorderhaus wurde im historisierenden Stil des Neobarock gestaltet. Die aufwändig gestaltete, repräsentative strassenseitige Stuckfassade enthält neben hauptsächlich barocken auch Renaissance-Motive und ist heute noch in weiten Teilen erhalten. Während die Strassenfassade in den ersten acht Jahren keinen Farbanstrich erhielt, wurden für die Innengestaltung, vor allem der Treppenräume des Vorderhauses, aufwändige Handmalereien angebracht. Für die damalige Zeit ebenso aufwändig und entsprechend kostspielig fielen die Tischlerarbeiten aus, welche in weiten Teilen erhalten geblieben sind. Auffällig ist auch die für den Erbauungszeitraum ungewöhnlich massive Bauweise mit preussischen Kappendecken und diversen Stahlkonstruktionen im Quergebäude und äusserst soliden Holzbalkendecken im Vorderhaus.

Ab 1894 wurde im grossen Laden im Vorderhaus rechts, sowie im Erdgeschoss des Seitenflügels eine Schlachterei betrieben. Im Hof wurde geschlachtet und Wurst gemacht. Der kleine Laden wurde zunächst von einer Blumenhandlung, später aber durchgehend als Wohnung genutzt. Im Quergebäude betrieben mehrere Tischlereien Manufakturen, die Remise diente als Holzlager.

Die Wurstfabrik 1901 – 1945

1901 erwarb ein Schlächtermeister das gesamte Gebäude und begann das Quergebäude zur Wurstfabrik umzubauen. Die räumliche Nähe zum Viehhof an der Eldenaer Strasse machte diese Nutzung lukrativ. Mehrere Räucherkammern und grosse Wurstkessel wurden eingebaut, die Remise zum Pferdestall umgebaut.

1910 erwarb der Schlächtermeister Ernst Remané das Gebäude. Remané besass noch mehrere andere Gebäude. Die Kinzigstrasse wurde jedoch zum Stammsitz der Familie ausgebaut. Bereits im Jahre 1911 liess er umfangreiche Umbauten am Gebäude vornehmen. Das 1. OG des Vorderhauses und des Seitenflügels wurde zur herrschaftlichen Wohnung mit grossem Salon, Badezimmer und gefliester Dienstbotenküche umgebaut. Aufwändige Mosaikparkett- und Linoleumböden, teure Linkrusta-Tapeten sowie neue Deckenstuckelemente wurden in die Wohnung eingebaut. Die Vorderhaus–Treppenräume wurden vermutlich zu dieser Zeit mit kostspieligen Jugendstilmalereien neu gestaltet. Diese Malereien sind heute als Nachbildung wieder im Treppenhaus vorhanden. Zur selben Zeit wurden auch alle hofseitigen Fenster einschliesslich der des Quergebäudes mit neuen Jugendstil- Profilen versehen.

Schon 1910 liess Remané einen grossen Lastenaufzug am Quergebäude montieren. Dieser wurde vermutlich im 2. Weltkrieg zerstört, seine Lage ist aber heute noch an fehlenden Gesimsteilen des Quergebäudes zu erkennen. Bis zum 2. Weltkrieg wurde die Nutzung des Gebäudes als Wurstfabrik immer weiter intensiviert. Bald wurde die linke Hälfte des Seitenflügels in die Produktionsstätten integriert. Das Quergebäude wurde vom Keller bis unter das Dach mit Kühlräumen und Räucherkammern versehen, die Kellerräume des Seitenflügels dienten als Schweineställe, die des Vorderhauses teilweise als Kühl- und Lagerräume. Der grosse Laden im Vorderhaus wurde zum geräumigen Verkaufsraum, die Remise zum Schlacht- und Brühraum ausgebaut.

Im Hof wurden zahlreiche Kochkessel, Lagerschuppen und Sickergruben errichtet. Die meisten dieser Ein- und Umbauten waren illegal, was 1929 die Bauaufsicht zu mehreren Anzeigen veranlasste. Das Quergebäude erlitt vermutlich zu dieser Zeit durch die zu grossen Lasten der Wurstkessel und stark überdimensionierten Feuerstätten schwere, statisch relevante Bauschäden, welche bei der Sanierung im Jahre 2000 zu erheblichen technischen Problemen führten.

Friedrichshain, Berlin, Germany - panoramio (74).jpg

Die Wohnverhältnisse in der Kinzigstrasse 9 waren exemplarisch für die soziale Situation in Berlin am Beginn des 20. Jahrhunderts. Während die Eigentümerfamilie unter luxuriösen Verhältnissen ein ganzes Geschoss des Hauses bewohnte, lebten in den anderen Geschossen bis zu fünf Familien unter extrem ärmlichen Bedingungen. In der Kinzigstrasse 9 existierten von Beginn an so genannte 2-Generationen-Wohnungen, in denen sowohl die Eltern, als auch Tochter und Schwiegersohn mit Kindern und Grosseltern in einer gemeinsamen Wohnung bestehend aus zwei Küchen und zwei Zimmern lebten.

Eine dieser Wohnungen ist heute noch weitgehend im 2.OG des Vorderhauses erhalten. In einer solchen etwa 60qm grossen Wohnung lebten bis zu 12 Personen. Die Toiletten lagen teilweise in den Treppenhäusern, zum Teil aber auch im Hof. Die hygienischen Bedingungen in der Kinzigstrasse 9 waren katastrophal. Schriftliche Berichte von Mietern der damaligen Zeit beschreiben, dass es aufgrund der Dampf- und Rauchentwicklung durch die Wurstfabrik nie möglich war, über den Hof, geschweige denn in den Himmel zu blicken. Einzelne Wohnungen grenzten direkt an schlecht isolierte Kühlräume und waren dadurch nicht ausreichend zu beheizen. Das ganze Jahr hindurch wurden die Schlachtabfälle offen im Hof gelagert. Mehrere Fälle von Tuberkulose sind aktenkundig. Die Gesundheitsbehörden wurden mehrfach in der Kinzigstrasse 9 aktiv.

Über die Verhältnisse im Haus während des Nationalsozialismus ist wenig bekannt. Nachweisbar ist nur, dass Eigentümer Remané noch in den dreissiger Jahren das gesamte Vorderhaus-Treppenhaus im expressionistischen Stil der damaligen Zeit neu streichen liess. Diese Wandbemalung ist in ihrer aufwändigen Gestaltung die einzige heute in Berlin bekannte, da zu jener Zeit in der Regel nicht die notwendigen finanziellen Mittel für solche Arbeiten vorhanden waren. Im 2. Weltkrieg wurde der Dachstuhl des Quergebäudes zerstört. Ansonsten erlitt die Kinzigstrasse 9 keine relevanten Kriegsschäden.

Die Lederwarenfabrik 1945 – 1980

Nach dem Krieg wurde das Quergebäude zunächst von einer Firma für Maschinen- und Anlagebau genutzt. 1954 liess die Tochter des ehemaligen Eigentümers Brunhilde Waschke geb. Remané das Quergebäude für die Lederwarenfabrik Ludwig Georg Lumpe umbauen und fast alle noch von der Wurstfabrik vorhandenen Einbauten entfernen. Das Erdgeschoss des Seitenflügels diente als Büroraum, die Remise als Lagerschuppen. 1962 wurde auch der grosse Laden im Vorderhaus für die Lederwarenfabrikation umgebaut. Im gleichen Jahr wurde auch die Sichtmauerwerksfassade des Quergebäudes verputzt. Dazu wurden alle Gesimse abgeschlagen und grosse Teile des Sichtmauerwerks schwer beschädigt. Diese Fassade wurde im Jahr 2000 aufwändig rekonstruiert.

Verfall und Abrissplanung 1980 – 1989

Zu Beginn der 80er Jahre begann die Kommunale Wohnungsverwaltung (KWV) mit der Umgestaltung der Wohnblöcke südlich der Frankfurter Allee. Geplant war der Abriss fast sämtlicher Altbauten von der Niederbarnimstrasse bis zum S-Bahnhof Frankfurter Allee und deren Ersetzung durch Neubauten in industrieller Plattenbauweise. Das Planungskombinat des so genannten „Baufeld Nr. 5“ sollte ursprünglich in der Kinzigstrasse 9 residieren.

Die dafür geplanten Umbauten wurden jedoch nie realisiert. Während sich die Eigentümerin die 80er Jahre hindurch beharrlich gegen ihre Enteignung wehrte, wurde in der Umgebung ein Häuserblock nach dem anderen gesprengt. Teile des Gebäudes standen nun leer. Der Seitenflügel wurde baupolizeilich gesperrt. Das Quergebäude wurde zunächst von einer Firma für Elektroarbeiten, später durch eine Schlosserei und für Lager- und Unterkunftsräume des VEB Bau genutzt.

Die Kinzigstrasse 9 wurde zur Sprengung vorbereitet. Davon zeugen heute noch die rot-weissen Sprengzeichen an der Strassenfassade, sowie ein Sprengschlitz unterhalb des untersten Fassadengesimses. Aufgrund der Verzögerungen bei der Zwangsenteignung endete die Neubaustelle zunächst in der Kinzigstrasse 7. Am 30.September 1989 wurde Brunhilde Waschke rechtskräftig enteignet und in ein Altenwohnheim umgesiedelt. In der Folgezeit stand das Haus vollständig leer. Im Mai 1990 wurden die Häuser Kinzigstrasse 11-15 gesprengt.

Die Zeit der Hausbesetzung 1990 – 1999

Am 4. August 1990 verhinderte die Besetzung des Gebäudes schliesslich die Sprengung. Die Kinzigstrasse 9 wurde aus einer Grossdemonstration gegen die Wohnungspolitik des Berliner Magistrats heraus und mit massgeblicher Unterstützung von Hausbesetzern aus der benachbarten Mainzer Strasse besetzt. Zu diesem Zeitpunkt waren die Plattenbauten gegenüber und neben dem Haus noch im Bau. Der Grund für die Besetzung der Kinzigstrasse 9 war nicht nur die drohende Sprengung, sondern auch die umfangreichen Möglichkeiten, die die grossen Räume im Quergebäude boten.

In der Folge diente das Quergebäude sowohl für Tagungen des Berliner Besetzerrates, als auch für Parties und andere grössere Veranstaltungen. Während der militärischen Räumung der besetzten Häuser in der Mainzer Strasse vom 12. bis 14. November 1990 existierte auch ein Räumungstitel für die Kinzigstrasse 9, der jedoch – vermutlich wegen logistischer Probleme der Berliner Polizei – nicht umgesetzt wurde. Dennoch verliess die ursprüngliche Besetzergruppe noch im November desillusioniert das Haus. Die Kinzigstrasse 9 stand daraufhin für kürzere Zeit wieder leer.

Im Winter 1990/91 wurde das Haus Stück für Stück von kleineren Besetzergruppen und Einzelpersonen bezogen, die jedoch keine zusammenhängende Hausgruppe darstellten. Darunter waren Punks, Obdachlose und Trebejugendliche, aber auch Drogendealer. In der Folge kam es zu zwei Drogentoten in der Kinzigstrasse 9. Die Punks warfen schliesslich die Drogendealer aus dem Haus und etablierten eine geschlossene Hausgemeinschaft. In der Folge erlangte die Kinzig 9 als „härtestes Punkhaus Deutschlands“ grosse Bekanntheit und wurde zum Treffpunkt für Punks aus ganz Europa. Das gesamte Quergebäude wurde im Jahr 1991 Tag und Nacht für Parties genutzt, in Vorderhaus und Seitenflügel wohnten zeitweise bis zu 80 BewohnerInnen und Gäste.

Es kam zu schweren Konflikten zwischen den neu eingezogenen Nachbarn der Plattenbauten und den BesetzerInnen, vor allem aufgrund von ruhestörendem Lärm und Sachbeschädigungen. Mehrere Räumungsbegehren der zuständigen Wohnungsbaugesellschaft wurden vom Senat ignoriert. In den Jahren 1991-92 verübten Neonazis mehrere Brandanschläge auf die Kinzigstrasse 9. Dabei wurden Teile des Vorderhauses, vor allem die herrschaftliche Wohnung im 1.OG und die Stuckdecken der Durchfahrt unwiederbringlich zerstört. Von der Ausstattung des 1.OG blieben lediglich die Fliesen der Küche, sowie einige grossflächige Teile der Mosaiklinoleumböden und der Linkrusta-Tapete erhalten, die heute in Berlin Einzelstücke aus der Erbauungszeit darstellen. Teile des Vorderhauses waren in der Folge unbewohnbar; die Zahl der BesetzerInnen nahm stark ab.

Anfang 1992 zog eine weitere Besetzergruppe aus dem Umfeld der ehemaligen Mainzer Strasse in den mittlerweile wieder leerstehenden Seitenflügel und das Quergebäude ein und begann mit der Instandsetzung. Das Vorderhaus wurde weiterhin von Punks bewohnt. Die beiden BewohnerInnengruppen konnten sich nicht auf ein gemeinsames Vorgehen einigen, und es kam zu gewalttätigen Auseinandersetzungen untereinander. In den Folgejahren agierten beide Gruppen isoliert voneinander. Der grosse Laden des Vorderhauses wurde als Kneipe genutzt. Im Quergebäude entstanden eine gemeinnützige Tischlerei und ein Veranstaltungssaal, die von der BesetzerInnengruppe als Jugend- und Kulturprojekte betrieben wurden. Teile des Quergebäudes wurden zu Wohnräumen umgebaut. Einzelne Wohnungen im Seitenflügel erhielten Mietverträge, der Rest des Hauses blieb bis 1998 besetzt.

Die senatseigene Wohnungsbaugesellschaft WBF führte in den 90er Jahren mehrfach Bau- und Instandsetzungsmassnahmen durch, welche die denkmalschutzrelevante Substanz des Gebäudes teilweise zerstörten. So wurde der Seitenflügel 1993/94 so saniert, das heute fast nichts mehr an sein ehemaliges Erscheinungsbild erinnert. Obwohl das Gebäude bereits im September 1995 unter Denkmalschutz gestellt wurde, liess die WBF 1996 die beiden Hoftore der Durchfahrt entfernen und verschrotten. Das jetzige Hoftor ist ein Nachbau.

Friedrichshain, Berlin, Germany - panoramio (36).jpg

Ebenfalls 1996 begann die WBF mit dem Abschlagen der maroden Strassenfassade, was nur durch die Intervention der BesetzerInnen und des Denkmalamtes unterbunden werden konnte. Der fehlende Stuck auf der linken Fassadenseite wurde damals zerstört. Die WBF versuchte in dieser Zeit mehrfach das Gebäude zusammen mit dem angrenzenden Bauland an grössere Investoren zu verkaufen. Diese Bemühungen scheiterten jedoch aufgrund der Denkmalschutzauflagen und der Besetzung des Gebäudes. Am 8.10.1996 wurde das besetzte Vorderhaus polizeilich geräumt, in der Folgezeit aber von den BesetzerInnen des Quergebäudes nach und nach wiederbesetzt.

Legalisierung und Selbstverwaltung

Ende 1998 erwarb die BesetzerInnengruppe mit ihrem gemeinnützigen Verein die Kinzigstrasse 9 von der WBF. Das Haus wurde der Wohnungsbaugenossenschaft Selbstbau e.G. geschenkt und mit dieser ein langfristiger Pachtvertrag abgeschlossen, da das Ziel von Hausgruppe und Verein hauptsächlich in der gemeinnützigen Arbeit, jedoch nicht im Eigentum an Immobilien liegt. In den Jahren 1999-2002 rekonstruierten die BewohnerInnen das die Gebäude in Eigenregie. Die Finanzierung wurde durch Fördergelder aus dem Selbsthilfe-Programm des Berliner Senats, durch Zuwendungen des Landesdenkmalamtes, sowie durch Eigenmittel der BewohnerInnen gesichert.

Bei der denkmalgerechten Rekonstruktion wurde versucht, die wechselhafte Geschichte des Hauses in seinem Erscheinungsbild zu dokumentieren. So zeigt vor allem die strassenseitige Fassade die vielseitigen Spuren und Narben der Hausgeschichte.

Auch die heutige Nutzung des Gebäudes zeigt Parallelen zu vergangenen Zeiten. So ist der Anteil der Gewerbeflächen nach wie vor relativ hoch: Auf 600qm verteilen sich verschiedenste gemeinnützige Dienstleistungsangebote. Siebdruckwerkstatt und Kneipe nutzen die strassenseitigen Läden. Die Remise dient als Gästehaus, in den Gewerberäumen des Seitenflügels sitzt das Vereinsbüro. Das 1. OG des Quergebäudes wird als Atelier genutzt. Hochparterre und Souterrain des Quergebäudes werden unter dem Namen „Grössenwahn + Leichtsinn“ von den BewohnerInnen gemeinschaftlich als öffentliche Kiezkulturstätte betrieben. Die Räume können von verschiedensten politischen und kulturellen Initiativen für Veranstaltungen und Parties genutzt werden. (Diesbezügliche Anfragen können an groessenwahn@kinzig9.de gestellt werden.) Nach wie vor ist die Kinzigstr. 9 ein selbstverwaltetes Projekt. Alle 35 BewohnerInnen entscheiden auf gemeinsamen Plena über die Belange des Hauses und die Nutzung der öffentlichen Räume.

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-SA 2.0) Lizenz.

————————————————————————

Grafikquellen      :

Oben        —         Berlin-Friedrichshain Kinzigstraße

Author Assenmacher
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————–

2. ) von Oben          —      Friedrichshain, Berlin, Germany

————————

Unten         —           Friedrichshain, Berlin, Germany

Abgelegt unter Berlin, Mensch, Positionen, Regierung | Keine Kommentare »

Charlie : Erinnerung to go

Erstellt von DL-Redaktion am 10. November 2019

Checkpoint Charlie in Berlin

Aus Berlin Jan Pfaff, Hanna Voß, Felix Zimmermann

Einst ein Ort der Weltgeschichte, heute ein Rummelplatz: Wie der Checkpoint Charlie wurde, was er ist – und was er sein könnte.

Wie selbstverständlich steht sie plötzlich da, eine orangefarbene Hütte am Checkpoint Charlie, gerade groß genug für eine Person. „Sharepoint Charlie“ kann man auf ihrer Seite lesen. Aufgebaut ist sie vor der Nachbildung des U.S. Army Checkpoints und den aufgetürmten Sandsäcken, hinter denen jeden Tag Touristen aus aller Welt posieren. Ein Kameramann macht sich bereit, ein Mann in Soldatenuniform und einer mit Klemmbrett nehmen Positionen ein. Ein Werbespot für eine Autovermietungsfirma soll hier gedreht werden.

Aber bevor die erste Einstellung aufgenommen wird, kommen zwei Polizisten und erklären den Männern, dass sie hier nicht drehen dürfen. Sie hätten eine Drehgenehmigung für ganz Berlin, behaupten die Werbefilmer, nur gerade nicht dabei. Allgemeine Genehmigungen hätten hier keine Gültigkeit, für den Checkpoint Charlie bräuchten sie eine Sondernutzungserlaubnis, referiert ein Polizist. Aus dem Dreh wird nichts.

Die Szene erzählt von dem besonderen Status dieses Ortes – und seinen heutigen Problemen. Der Checkpoint Charlie ist ein Stück Weltgeschichte. Das Schwarzweißfoto, auf dem sich am 27. Oktober 1961 genau hier gefechtsbereite Panzer der zwei Supermächte gegenüberstanden, ihre Geschütze aufeinander gerichtet, gehört zum globalen Bildergedächtnis. Am Checkpoint Charlie trafen Ost und West aufeinander, Kapitalismus und Kommunismus, GIs und rote Armee, getrennt durch eine weiße Linie, die die Grenze zwischen den Berliner Bezirken Mitte und Kreuzberg markierte.

Heute besuchen den Ort jedes Jahr rund 4 Millionen Menschen. Und viele versuchen den Mythos für sich auszuschlachten, ein Geschäft damit zu machen – da sind die Straßenhändler, die Sowjetuniformen, Pelzmützen und Gasmasken anbieten, daneben die vollgestopften Souvenirläden mit ihren bunten Mauerbröckchen, DDR-Fahnen und Miniatur-Trabis.

Fastfoodketten und Würstchenbuden rangeln um Kundschaft, Sightseeingbusse rollen im Schritttempo über die einstige Grenzlinie, Hütchenspieler und Bettlergruppen tauchen plötzlich auf und verschwinden wieder. Das zügige Tempo, mit dem sich die Menschen sonst in dieser Gegend bewegen, kommt hier fast völlig zum Stillstand. Schulklassen blockieren die Gehwege, Touristen stehen auf der Straße herum.

Wer heute nur einige Minuten am Checkpoint Charlie herumläuft, hat das Gefühl, über einen großen Rummelplatz zu gehen. Geboten wird historische Erinnerung to go, hier schnell ein Selfie, da schnell eine Bratwurst. Wie hat sich der Ort, an dem einmal Menschen bei Fluchtversuchen starben und die Angst vor einem Dritten Weltkrieg ständig präsent war, in eine schäbige Flaniermeile verwandelt? Wie wurde der Checkpoint Charlie, was er heute ist? Und was erzählt das über unseren Umgang mit historischer Erinnerung?

Im Hinterzimmer des Cafés Einstein, direkt am ehemaligen Grenzverlauf, hängen Schwarzweißbilder aus den 60er Jahren, darauf Stacheldraht, Brachen und Soldaten in Wintermänteln. Darunter sitzt Smiley Baldwin und macht seinem Vornamen alle Ehre – er lächelt, während er sich zu erinnern versucht, wie das damals war, als er als amerikanischer Soldat Dienst am Checkpoint Charlie tat.

Baldwin kam 1987 als Militärpolizist nach Berlin, zuvor war er zwei Jahre bei Frankfurt stationiert. „Dort war die Studentenszene in den Reagan-Jahren gegenüber US-Soldaten sehr ablehnend. In Westberlin waren die Leute so nett zu uns – sie waren dankbar, dass wir da waren.“ Als Militärpolizist fuhr er zusammen mit Berliner Polizisten Patrouille. Er interessierte sich für die Geschichte der Stadt, lernte Deutsch. Abwechselnd wurde er am Checkpoint Bravo an der Transitautobahn zur BRD und am Checkpoint Charlie eingesetzt.

In dem Kontrollhäuschen arbeitete er als Assistent des Non-Commissioned Officer in Charge, des verantwortlichen Unteroffiziers. „Ich habe ihm beim Papierkram geholfen oder auch mal den Müll rausgebracht.“ Eigentlich sei das ein Bürojob gewesen. Die Russen wollten genau wissen, wer, wann, wieso in den Ostteil wollte, dafür galt es unzählige Formulare auszufüllen.

Aber wichtiger als die Bürokratie sei etwas anderes gewesen: „Es ging um Ästhetik. Es musste alles gut aussehen. Vor allem große, sportliche Jungs wurden hier eingesetzt“, erzählt Baldwin. „Meine Uniform konnte allein stehen, so steif war sie, damit sie keine Falten warf. Die Schuhe blitzten. Das Häuschen roch ganz neu und nach Putzmittel.“

Der Kontrollposten und die GIs gehörten zum „Schaufenster des Westens“, als das die Amerikaner Westberlin verstanden. „Wir mussten unserem Gegner zeigen, wie wir aussehen – und zwar tiptop“, sagt Baldwin. „Militärstrategisch waren wir ja tot.“ Es gab zwar Szenarien, wie sich die Soldaten der Westalliierten im Kriegsfall auf das Gebiet der BRD hätten zurückziehen sollen. „Aber jeder wusste, dass das bei der Übermacht der Sowjets und NVA-Soldaten völlig aussichtslos gewesen wäre.“

Das Schaufenster des Westens

Er erinnert sich an eine Situation am Checkpoint, die ihm gezeigt habe, was das eigentlich bedeutete: Kalter Krieg. „Ich stand hier und sah jemand, der von der anderen Seite auf uns zurannte. Fünf Meter vor der weißen Linie ist der Mann gestolpert. Wir durften ihm nicht helfen. Wenn einer von uns nur einen Schritt über diese Linie gemacht hätte, wäre die Welt in der nächsten Minute nicht mehr in Ordnung gewesen.“ In dem Moment war der Kalte Krieg kein abstraktes Konzept mehr, kein komischer Arbeitsplatz in einem fernen Land, sagt Baldwin. „Es war plötzlich sehr ernst. Wir haben zugeschaut, wie der Mann abgeführt wurde.“

1992 scheidet er aus der Armee aus und bleibt in dem nun wiedervereinigten Berlin. Er arbeitet als Türsteher, wird feste Größe des Berliner Nachtlebens, 17 Jahre macht er die Tür des legendären Clubs „Cookies“. Er ist der Einzige aus seiner ehemaligen Einheit, der in Berlin geblieben ist.

Wie blickt er heute auf diesen geschichtsträchtigen Ort? „Was mit dem Checkpoint Charlie geschieht, ist allein Sache der Deutschen“, sagt Baldwin. „Mit dem Fall der Mauer und dem Abzug der Soldaten ist unsere Verantwortung dafür vorbei. Und das ist gut so.“

Die Zeit nach 1989 bedeutet für den Checkpoint Charlie erst mal Rückbau. Die Mauer ist durchlässig geworden, jetzt soll sie ganz weg. Zwischen Juli 1990 und November 1991 werden in Berlin 155 Kilometer Mauer abgerissen, 302 Beobachtungstürme, 20 Bunkeranlagen, dazu die Grenzübergänge. Den Anfang macht der Checkpoint Charlie. In einer feierlichen Zeremonie mit den Außenministern beider deutscher Staaten, der USA, Frankreichs, Großbritanniens und der Sowjetunion wird die Kontrollbaracke der Amerikaner am 22. Juni 1990 abtransportiert. Die 298th U.S. Army Band spielt dazu „Berliner Luft“. Die taz, deren Redaktionsgebäude um die Ecke liegt, schreibt: „Letzte Vorstellung für Onkel Charlie“.

Und zunächst gibt es keinen Plan, was mit dem ehemaligen Grenzübergang passieren soll. Von einem Ort des Geschehens zu einem Ort des Erinnerns – das geht nicht von heute auf morgen. Was eben noch Gegenwart war, ist nicht gleich Geschichte, und damit ist es auch nicht gleich erinnerungswürdig.

Ganz nah am Unrecht

Es gibt aber jemand, der am Checkpoint Charlie praktisch von Anfang an da ist. Jemand, der Räume füllt, die andere offen lassen. Rainer Hildebrandt, ein ehemaliger Widerstandskämpfer gegen die Nazis, eröffnet im Juni 1963 am Checkpoint sein Mauermuseum. Weil viele Geschäfte wegen der schlechten Lage nach dem Mauerbau 1961 wegzogen, kann er die Räume eines ehemaligen Cafés übernehmen. Axel Springer, der in der Nähe sein neues Verlagshaus baut, schickt einen Elektriker vorbei, der die Leitungen verlegt. Viele Redaktionen und Bildarchive stellen für die Ausstellung kostenlos Fotos zur Verfügung.

„So nahe wie möglich am Unrecht sein, dort entfaltet sich die menschliche Größe am stärksten“, erklärt Hildebrandt zur Eröffnung mit dem Pathos eines Freiheitskämpfers die Ortswahl. Das letzte Haus vor der Mauer ist damals auch nicht nur Museum. Fluchthelfer beobachten durch ein kleines Fenster alle Bewegungen am Grenzübergang, Geflüchtete werden aufgenommen, Fluchtpläne entwickelt.

Nach der Wende wollen Rainer Hildebrandt und seine Frau Alexandra den Checkpoint zu einem Denkmal für die Westalliierten machen, dafür soll auch die ehemalige Kontrollbaracke zurückkehren. Nicht die größere Baracke, die 1990 feierlich abtransportiert wurde, sondern eine Nachbildung der ersten Alliiertenbaracke aus den 60er Jahren. Eine winzige Holzhütte mit einem Schild auf dem Dach: US Army Checkpoint. Die Hildebrandts lassen sie anhand von Fotos nachbauen, am 13. August 2000 wird sie enthüllt.

Da war die Mauer für Merkel und Gauck noch ein Schutzwall.

2004 stirbt Rainer Hildebrandt. Im Inneren der nachgebauten Baracke erinnern ein Porträtfoto und ein Gedenktext an ihn, am Eingang des Mauermuseums steht eine eiserne Statue des Gründers. Das Museum selbst wirkt heute, als ob ein Messie mit Hang zur Zeitgeschichte sich mal so richtig austoben durfte.

Quelle              :         TAZ        >>>>>         weiterlesen

——————————————————————-

Grafikquellen        :

Oben      —         Passing Checkpoint Charlie on the way to Berlin (West) 14 November 1989

———————————–

2.) von Oben      —      Checkpoint Charlie

Abgelegt unter Berlin, Deutschland, Regierung, Schicksale | Keine Kommentare »

Die Falschen Freunde ?

Erstellt von DL-Redaktion am 9. November 2019

Stolz und Einzelkämpfertum

File:Bremen, Loriotplatz, Parkbank mit Sitzfigur nach Loriot (2).jpg

Von Robert Misik

Viel wird über die sogenannten einfachen Leute gesprochen. Wer sind sie und was sind ihre Werte? Eine Spurensuche.

urz nach dem Wahlsieg von Donald Trump schrieb die amerikanische Rechtswissenschaftlerin Joan C. Williams einen großen Essay mit dem Titel „What so many people dont’t get about the U.S. working class“. Lange habe man die Bedrängnisse der Arbeiterklasse igno­riert, nun schleiche sich eine Art gutmenschliche Besorgnis ein. „Diese Haltung“, so Williams später in ihrem Buch „White Working Class“, in das weitere Recherchen und unzählige Zuschriften eingeflossen sind, „wird sie aber noch wütender machen und die ungesunde Klassenspaltung nur vergrößern“.

Williams weiter: „Sie wollen anerkannt werden für die Beiträge, die sie leisten – und für ihre Art zu leben.“ Anders gesagt: Die Arbeiterklasse will eben „nicht wie ein Stamm in einem Land behandelt werden, das weit entfernt ist“.

Von den USA bis ins Ruhrgebiet, von Mittelengland bis zu den Wiener Vorstädten, überall wird derzeit die Frage diskutiert, warum sich die „einfachen Leute“ als Verlierer fühlen und beklagen, keine Stimme mehr zu haben. Wobei es gleich mit der Frage beginnt, wer das denn überhaupt sein mag, diese viel besprochenen „einfachen Leute“.

Das sind einmal, grob gesagt, jene, die im Leben nicht auf die Butterseite gefallen sind – also eher Kleinverdiener, aber nicht nur. Es sind Arbeiter und Arbeiterinnen, bis hin zur Mittelschichts­familie im Einfamilienhaus mit zwei Autos vor der Tür. Leute, die sich als „die Normalen“ ansehen. Oft ist das auch eine stolze Selbstzeichnung. „Da, wo ich lebe, bedeutet ‚einfacher Mensch‘ ‚anständiger Mensch‘, weil bescheidenes (oder weniger bescheidenes) Auskommen mit ehrlicher Arbeit (meist körperlich) erschaffen“ wurde, so beschreibt das eine Frau aus dem österreichischen Mühlviertel.

Die „real existierenden“ Werte der arbeitenden Klassen sind über Jahrhunderte entstanden, hatten ihre Quellen teilweise noch in der vorindustriellen Handwerkskultur, mit ihrem Stolz auf die eigenen Fertigkeiten, den Vorstellungen von einem gerechten Lohn und einem fairen Preis. Hinzu kam ein Gemeinschaftsgeist mit einer starken Trennung in Insider und Outsider. Man kann auch die heutigen Werthaltungen der „populären Klassen“ nicht verstehen, ohne diese Geschichte zu verstehen.

Die alte Arbeiterklasse, so Joan C. Williams, habe einen Stolz gehabt und sie habe sich Anerkennung verschafft – bis sie gewissermaßen als zentrale soziale Schicht angesehen wurde oder sich zumindest so fühlen konnte. Diese Arbeiterklasse habe aber auch bestimmte Werte hochgehalten: den Stolz darauf, harte Arbeit zu leisten; die Vorstellung, dass man niemandem auf der Tasche liegen darf; dass man es mit eigener Tüchtigkeit schafft; dass man mit Handarbeit die Wirtschaft am Laufen hält, dass man zupackt, nicht zu verkopft ist. Dass man einfach „normal“ ist. Zugleich war dieser Stolz sehr verletzlich. Dafür, respektlos behandelt zu werden, hatte man immer ein feines Sensorium. Ein egalitärer Geist prägte die Arbeiterklassenmoral, und wer sich für etwas Besseres hielt, war schnell unten durch. Die Angehörigen der Arbeiterklasse schätzen rigide Selbstdisziplin, weil sie nötig ist, um einen harten Job, den man hasst, vierzig Jahre lang machen zu können.

Weniger solidarisch, als romantisierende linke Intellektuelle gerne glauben würden, ist die Arbeiterklasse mit „den Armen“, also mit jenen, die ihr Einkommen aus staatlichen Sozialtöpfen beziehen, weil sie mit Arbeit nicht über die Runden kommen, weil sie keine Jobs finden oder aus anderen Gründen am Arbeitsmarkt keine Chance haben. Die sieht man schnell als Leute an, die es sich leichtmachen, während man selbst jeden Tag aufstehen und rackern muss, einem nichts geschenkt wird.

Genau das klingt bei Lorraine, einer Gabelstaplerfahrerin, an, die im Zuge einer großen britischen Studie interviewt wurde. Sie ist alleinerziehend, Mutter zweier Buben, wohnt zur Miete, kennt die Stereotypisierungen, denen sie ausgesetzt ist, und sagt: „Ich bin unten, klar.“ Fügt dann aber hinzu: „Ich nenne mich Arbeiterklasse, aber ich glaube nicht, dass ich mich in der gleichen Klasse sehe wie jemand, der sich krallt, was er kann […]. Verstehst du, ich bin stolz auf das, was ich tue, ich stehe jeden Morgen auf […]. Ich kann mir nichts Ärgeres vorstellen, als jeden Tag daheim zu sein und nichts zu tun zu haben. Weißt du, die werden dann fett, oder? Und wundern sich, warum. Aber darf man das überhaupt sagen?“

Die weiße Arbeiterklasse habe das Gefühl, „aus dem Zentrum an den Rand des Bewusstseins ihres Landes gerückt worden zu sein“, formuliert auch der US-Politikwissenschaftler Justin Gest. Viele, so sagt er, fühlten sich außerstande, dagegen irgendetwas zu unternehmen. Gest hat für eine große Studie mehrere Monate erst in einem Arbeiterklassenbezirk in East London und danach eine Zeit in Youngtown, Ohio verbracht, Dutzende lange Gespräche geführt und die Ergebnisse in seinem Buch „The New Minority“ zusammengefasst.

Auch wenn hier bisher provisorisch von der „weißen Arbeiterklasse“ gesprochen wurde, ist dieser Begriff eher behelfsmäßig und unpräzise. Man sollte sich möglichst konkret vor Augen führen, wer eigentlich alles gemeint sein könnte, wenn man heutzutage, im postindustiellen Zeitalter, von Arbeiterklasse spricht

Quelle      :            TAZ            >>>>>        weiterlesen       

———————————————————————

Oben         —          Parkbank mit Skulptur (geschaffen 2016 von Roman Strobl, bemalt von Patrick Przewloka) nach der Titelfigur von „Loriots großer Ratgeber“ am Loriotplatz in Bremen

Author Karl432      / Sourcr    — Own work

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

————————-

Unten        —        Bpb      Bundeszentrale für politische Bildung

Abgelegt unter Kultur, Medien, Mensch, Überregional | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle  streifzuege.org

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.

Keep-it-in-the-ground.jpg

Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.

—————————–

2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.

—————————-

3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.

——————————–

Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

Abstieg eines Superstars

Erstellt von DL-Redaktion am 9. November 2019

30 Jahre Sieg des Kapitalismus

'Today capitalism has outlived its usefulness' MLK.jpg

Eine Kolumne von

Hochmut kam nach dem Mauerfall: 30 Jahre nach dem vermeintlichen Triumph wird offenbar, in welch dramatischer Glaubwürdigkeitskrise der Kapitalismus mittlerweile steckt.

Als im Sommer vor 30 Jahren der Kommunismus zu kollabieren begann, deklarierte der US-Politologe Francis Fukuyama, nun sei die Geschichte zu Ende. Die Menschheit hatte sozusagen den Idealzustand erreicht – Demokratie und Kapitalismus.

Aufgabe erledigt. Erde glücklich.

Heute wirkt der Befund wie eine bizarre intellektuelle Irrung. Drei Jahrzehnte nach dem Ableben des Kommunismus erscheint die Erde etwas glücklos:

  • Es drohen Klimakrisen;
  • das Auseinanderdriften von Reich und Arm hat vielerorts nur schwer tragbare Ausmaße erreicht;
  • bizarre Präsidenten einstmals marktwirtschaftlich vordenkender Nationen drohen mit Handelskriegen;
  • und mehr als die Hälfte der Erdbevölkerung wird von autokratisch oder populistisch Regierenden geführt, wie Nobelpreisträger Joseph Stiglitz jüngst ätzte.

Was ist da schiefgelaufen? Die Antwort könnte in jener Siegessicherheit liegen, die den Kapitalismus in den Jahrzehnten nach Überwindung des Kommunismus zu dem einen oder anderen Exzess trieb. Im Hochmut nach dem Mauerfall, sozusagen. Von wegen Ende der Geschichte.

Bittere Ironie

Die Ironie selbiger: Jetzt stecken Demokratie und Marktwirtschaft so tief in der Krise, wie es ohne den Übermut, der im Herbst 1989 seinen Lauf nahm, womöglich nie geschehen wäre.

Mit dem Fall der Mauer wurde dereinst ein Trend beschleunigt, der Anfang der Achtzigerjahre mit dem Antritt von Ronald Reagan in den USA und Margaret Thatcher in Großbritannien begonnen hatte. Demnach ist es wirtschaftlich per se immer gut, wenn der Staat sich zurückzieht; wenn jeder erst einmal an sich denkt, statt über Gesellschaft zu sinnieren; wenn jeder für sich vorsorgt, statt auf Hilfe vom Staat zu zählen; wenn alles dem strengen Wettbewerb ausgesetzt ist; wenn Reiche von Steuern entlastet werden; und wenn Banken wie andere Finanzjongleure so frei wie möglich mit Geld spekulieren können.

All das hatte als neues Dogma bis zum Mauerfall schon Risse bekommen – ob durch den Aktiencrash 1987 oder das Schuldenmachen von Reagan. Als der Kommunismus weg war, wirkte nur die normative Kraft des Faktischen viel stärker – und der sehr menschliche Gedankengang: Wer gewinnt, hat Recht.

Gewonnen ja – aber grenzenlos gut?

Sprich: Weil der Kommunismus ganz offenbar gescheitert war, was ja stimmt, galt der Kapitalismus als gut. Und umso schwerer war zu argumentieren, dass es deshalb trotzdem nicht gleich richtig ist, wenn der Kapitalismus sich nun ordentlich austobt.

Was das heißt, haben Ostdeutsche zu spüren bekommen, als ihnen blühende Landschaften durch Umschalten auf glorreiches Marktwirtschaften versprochen wurden. Und dann die Treuhand dem Gedanken freien Lauf ließ, wonach alles, was nicht auf Anhieb der Konkurrenz standhält, einfach nicht zu halten ist. Auch wenn das zu Massenarbeitslosigkeit führte.

In den Jahren danach machten Regierungen weltweit immer irrere Reformen zugunsten von Finanzwelt, Schattenbanken und Derivatejunkies; wurden unter dem Motto des glorreichen Wettbewerbs über Nacht Märkte für Billigkonkurrenz aus China geöffnet. Und selbst eine rot-grüne Regierung setzte durch, dass Reiche weniger Steuern zahlen und Schlechtergestellte sanktioniert werden.

Widerspruch? Zwecklos

Wer in diesen Zeiten Zweifel äußerte, ob denn gleich alles privatisiert werden müsse, dem wurde beschieden, dass ja wohl keiner zum Sozialismus zurückwolle. Totschlagargument. Wer will denn schon wieder den Honecker? Klar.

Bochum - Alleestraße144 14 ies.jpg

Was derlei Selbstgewissheit anrichten kann, ist heute zu beobachten. Wenn Reich und Arm in so vielen Ländern so dramatisch auseinandergehen, hat das natürlich mit Finanzmärkten zu tun, wo nur wenige zu den großen Gewinnern zählen – oder damit, dass Reichensteuern gesenkt wurden. Wenn in den USA ganze Regionen wirtschaftlich abstürzten, weil sie chinesischer Billigkonkurrenz so wenig standhalten konnten wie einst das eine oder andere Werk im Osten Deutschlands der Westkonkurrenz, hat auch das mit einer naiven Vorstellung von selbstregulierenden Märkten und menschlicher Anpassungsschnelle zu tun.

Quelle       :       Spiegel-online          >>>>>         weiterlesen

——————————————————————–

Grafikquellen      :

Oben         —          Banner at the 2012 Republican National Convention depicts Martin Luther King, Jr., and the quotation: „Today Capitalism has outlived its usefulness.“

————————————

Unten        —         Alleestraße 144 in Bochum

Abgelegt unter International, Kultur, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Aktivisten und Rebellen

Erstellt von DL-Redaktion am 7. November 2019

Über Demonstrationen und Aktionen

File:Extinction Rebellion Wellington Protest Flag 3.jpg

Quelle       :       untergrund-blättle CH.

Von   Eckhard Mieder

Neulich fiel es mir während einer sonntäglichen Autofahrt ins Bergische Land auf.

Ich schaltete das Radio ein, um den Verkehrsstand auf den Autobahnen zu erfahren, und geriet in die davor gesetzten Nachrichten, in die Verbal-Häppchen, die heutzutage als Radio-Nachrichten für das hungrige Welt-Ohr ausgegeben werden. Die Kurz-Rede ging u. a. von den Aktivisten, die in Hongkong demonstrierten.

Vor der Autofahrt hatte ich nach dem Frühstück in der Zeitung von Klima-Aktivisten gelesen; es gab eine Affinität und Diversität zwischen ihnen und den Aufrührern der Extinction Rebellion. Nicht lange davor erfuhr ich, dass der thüringische CDU-Chef Mike Mohring „CDU-Rebellen“ kontert, während in Syrien irgendwelche Rebellen gegen Assad (oder für ihn?) schossen. Auch gab es Aktivisten in Nordsyrien, und Aktivist*innen besetzen – ein Akt der Revolte oder Rebellion? – ein seit langer Zeit leer stehendes Haus in Berlin. Ausserdem retten Aktivisten auf dem Mittelmeer Menschen aus der Seenot bzw. agieren Aktivisten und Rebellen im Ukraine-Konflikt. Etc. pp.

Plötzlich hatte ich das Gefühl, dass es auf dieser Welt mehr Aktivisten und Rebellen als Bienen gibt. Es wimmelt von ihnen, um mich herum. Und ich stellte fest: Wenn ich alles Mögliche bin, eines bin ich nicht, ich bin kein Aktivist. Und der Rebell in mir meldet sich nur noch selten und bellt ein bisschen; ich sollte ihn eher einen Nörgler oder Motzer nennen, nicht einen Rebellen. Denn vor Rebellen habe ich Respekt. Obwohl … Oder …

Ich fuhr so dahin auf der A 5. Ich wollte zur Tropfsteinhöhle nach Wiehl, um mit Frau, Tochter und zwei Enkelkindern in die Erde hinabzusteigen. Ein aktiver Ausflug in die Natur, friedfertig und mit dem sanften Grusel des gesicherten Dunklen. Aber mich liessen die Aktivisten und Rebellen nicht in Ruhe. Sie zogen mir durch den Kopf wie die eine oder andere Demonstration durch eine Stadt.

Sollte ich nicht besser „Aktivisten“ und „Rebellen“ denken? Wenn sie so massenhaft daherkommen und in den Medien massenhaft aufmarschieren und für sehr verschiedene Haltungen, Tätigkeiten, Kämpfe etc. herhalten – dann können sich unter so hochwölbenden und unter sich allerlei Diversitäten versammelnden Begriffen alle einfinden, die aus dem Tritt bürgerlich-gemächlichen Ganges geraten? Wenn es sich um quasi wertfreie Begriffe handelt -, dann ist der gewesene Rebell Joschka Fischer der Papi des heutigen demonstrierenden Jungnazis. Dann ist die Aktivistin Greta Thunberg die Tochter von Erika Steinbach. Dann ist Edward Snowden als Aktivist ein Enkelsohn des „Aktivisten der faschistischen Arbeit“ Adolf Eichmann. Allerdings werden aktive Rechte und Ultrarechte nicht „Aktivisten“ und „Rebellen“ genannt. Logisch ist das nicht.

Oder die Journalisten und Politiker wissen nicht genau, wer sich hinter den „Rebellen“ und „Aktivisten“ verbirgt? Muss ja auch schnell gehen, die Zeit, jeden Akteur genau zu erkennen und zu benennen -, die hat’s eben nicht. Folglich passt das Etikett auf alles, was auf dem Prokrustes-Hackklotz zu handlichen Verbal-Würfeln gehauen wird. „Aktivist“/“Rebell“ – sitzt, passt, wackelt und hat Luft. Und ich darf mich korrigieren. Wieso bin ich kein Aktivist? Ich bin einer, weil ich ein zielbewusst und energisch handelnder Mensch bin. Sagen wir verhalten: sein kann. Als solcher bin ich übrigens einmal in meinem Leben als „Aktivist der sozialistischen Arbeit“ ausgezeichnet worden.

Ich erinnere mich nicht mehr genau; ich gehörte einem Kollektiv an, das als solches geehrt wurde. Ich glaube, es gab 50 Mark Prämie, für jeden. Ich erinnere mich auch nicht daran, etwas besonders Anderes gemacht zu haben als zu arbeiten. Das konnte reichen für eine Medaille; die sozialistische Arbeit war schliesslich keine Disziplin des Leistungssports.

Und darf ich mich nicht auch Rebell nennen, weil ich vor wenigen Jahren noch in Demos mitgelaufen bin? Die Protestierer wurden allerdings in Zeitungen und Polizeiberichten gern als Chaoten oder als Extremisten bezeichnet. Da hatte die Werte-Freiheit eines Über-Begriffs ihre Grenzen und die Zuordnung – sass, passte und wackelte nicht und hatte Luft. Und wie oft habe ich in meinem Leben schon die Fäuste geballt in der Hosentasche … Man kann ja auch Rebell sein, wenn man nicht in Lumpen oder mit Lumpen herumläuft. Wenn man die bürgerlichen Umgangsformen beherrscht, eine Krawatte binden kann und Manon Lescaut nicht für eine belgische Biersorte hält.

„Aktivist“ klingt irgendwie nach was Gutem. „Rebell“ klingt irgendwie nach was „Schlechtem“? Aber sind die Rebellen, die gegen Assad kämpfen – ja, was sind das für welche? Oder die in der Ukraine? Die guten? Weil „wir“ es behaupten? War Robin Hood ein guter Rebell, wirklich? Sind die CDU-Rebellen gut oder schlecht, und sind sie einfach nur ungezogen und – nun, rebellisch. Oder hilft „gut“ und „schlecht“ sowieso nicht, weil Einigkeit herrscht: „Rebellen“ und „Aktivisten“ sind nun mal halt so Begriffe, und wer unter dem einen, wer unter dem anderen erfasst wird -, hängt davon ab, wo man den oder jenen sehen möchte. Es könnte helfen, nach ihren Zielen zu fragen; kennen wir die genau? Ich weiss sie nicht mal genau von den benachbarten Gelbwesten, deren Aktionen mir in Frankfurt am Main näher sind als die Aktionen der Hausbesetzer im fernen Berlin. Ziemlich schwammig das Ganze, meiner Ansicht nach.

Mir sind, folge ich den Berichten, zu viele Aktivisten und Rebellen unterwegs. Sie bedrängen mich und stellen mich vor die Frage, ob ich nicht endlich auch in die Puschen komme und aktivistisch und rebellisch werden will. Wir brauchen Aktivist*innen und Rebell*innen; wobei eben das ist nicht sicher, weil ja jeder und alles darunter fällt. Also: Es gibt genug zu tun; mit der schlaffen Ergänzung „ … lassen wir es liegen“, kommst du nicht durch, wenn du dich beiseite hältst.

Wiehler Tropfsteinhoehle.jpg

Als ich mit den Enkelkindern in die Tropfsteinhöhle von Wiehl hinabstieg – das Gangsystem ist 868 Meter lang -, fühlte ich mich immerhin als Aktivist des Grossvatertums. Ich sah verblüfft, dass im künstlichen Licht der Lampen und in der hohen Luftfeuchtigkeit leuchtend grün Farn, Flechten und Moos wuchsen; das Grünzeug liess sich täuschen: Es hielt das elektrische Licht für die Sonne.

Da unten hörte ich von der Höhlen-Erklärerin zum ersten Mal im Leben vom Stalagnaten. Der entsteht, wenn ein Stalaktit und ein Stalagmit zusammenwachsen. Von oben nach unten, von unten nach oben, bis sie sich treffen. Von der Natur lernen heisst Neues lernen. Es mag ein bisschen an den Haaren herbeigedichtet sein, ich erfand für mich den Begriff „Aktibell“. So einer, glaube ich, bin ich.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

———————————————————————–

Grafikquellen      :

Oben         —           A flag from the Extinction Rebellion Protest in Wellington

Author Heapsrich     /      Source   :    Own work

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

———————-

Unten      —       Wiehler Tropfsteinhöhle

Abgelegt unter Energiepolitik, Kultur, Mensch, Umwelt | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 5. November 2019

Lebensstile von Politikern

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Robert Misik

Normal musst du sein! Dürfen linke Politiker Porsche fahren oder Brioni-Anzüge tragen? Wann immer solche Lebensstilfragen aufpoppen, geraten Argumente durcheinander.

Eine Freundin von mir vertritt die Ansicht, die Mentalitätsunterschiede zwischen Deutschen und Österreichern träten besonders plakativ in zwei Liedern zutage: in dem Song „Ruaf mi net an“ des verstorbenen Wiener Liedermachers Georg Danzer und in „Zu spät“ von den Ärzten.

Beide haben dasselbe Thema, nämlich verschmähte Liebe. Hauptfigur ist jeweils ein junger Mann, der von seiner Freundin verlassen wurde, weil sie sich einen klügeren, reicheren, prestigeträchtigeren Partner gesucht hat. Doch während in der deutschen Version die Ich-Figur in gigantomanische Fantasien verfällt, versinkt die österreichische Figur in weinerlichem Selbstmitleid.

Bei den Ärzten heißt es: „Doch eines Tages werd’ ich mich rächen / Ich werd’ die Herzen aller Mädchen brechen / Dann bin ich ein Star, der in der Zeitung steht / Und dann tut es dir leid, doch dann ist es zu spät.“

Bei Danzer dagegen tut der trauernde Twentysomething gar nichts, nimmt Tabletten, kann nicht mehr schlafen und verwünscht den neuen Liebhaber, der die Ex in Restaurants einlädt und ein teures Auto fährt. „I waß du hasd jetzt an Freund mid an Porsche / Geh sag ihm er soll do in Oasch geh.“ Allein dafür, dass er „Porsche“ auf „Oasch geh“ („in den Arsch gehen“) reimte, gebührt Danzer der Literaturnobelpreis. Der Porsche steht hier für Protzerei, für das Neureiche, auch ein bisschen für das Ludenhafte. Porsche repräsentiert auch ein wenig das Unse­riöse, Krösushafte.

Wir führen ja bei uns in Österreich meist ähnliche Debatten wie ihr in Deutschland, nur noch ein bisschen dümmer. Deswegen hatte die österreichische Sozialdemokratie zuletzt ihre „Porsche“-Debatte. Die SPÖ ist ja bei den vergangenen Parlamentswahlen auf 21 Prozent abgestürzt, Tags darauf trat der Bundesgeschäftsführer zurück und holte seine Habseligkeiten mit seinem schicken Oldtimer-Porsche aus der Parteizentrale. Als sich dann noch herausstellte, dass auch der Tiroler Landesvorsitzende mit einem modernen Porsche-Modell durch die Gegend kurvt, waren die „Luxus-Sozis“ in den Schlagzeilen und buchstäblich „im Oasch“.

Entkontextualisierte Debatte

Wann immer solche politischen Lebensstilfragen aufpoppen, geraten die Argumente durcheinander. Die einen meinen, linke Politiker müssten auch durch ihren Lebensstil ausdrücken, dass sie auf der Seite der einfachen Leute stehen, und dafür sind Villen, Luxuskarossen und teure Uhren, Brioni-Anzüge und Zigarren Gift. Die anderen meinen, dass diese Leute sich das Zeug ja erstens von ihrem verdienten Geld gekauft haben, sie daher auch niemandem Rechenschaft schuldig seien, dass es zweitens darum gehe, ob sie gute Politik machen, nicht ob sie in Sack und Asche herumliefen, und dass die Linken, drittens, doch für Wohlstand und Luxus für alle eintreten, nicht für Armut für jeden.

Quelle      :          TAZ        >>>>>         weiterlesen

—————————————————————-

Grafikquellen      :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Feuilleton, P. DIE LINKE, Überregional, Umwelt | Keine Kommentare »

Ein Sieg der Gerechtigkeit?

Erstellt von DL-Redaktion am 4. November 2019

Anmerkungen zu unbeantworteten Fragen zum Tod Baghdadi’s

File:Mugshot of Abu Bakr al-Baghdadi, 2004.jpg

Qzelle     :         Scharf  —  Links

Von Kai Ehlers

„Last night, the United States brought the world´s number one terrorist leader to justice.” So leitete US-Präsident Donald Trump seine triumphale Botschaft ein, mit der er vor einer Woche die Tötung des Chefideologen des „Islamischen Staates“ Abu Bakr al-Baghdadi’s durch ein Spezialkommando der US-Geheimdienste der Weltöffentlichkeit präsentierte.

Es sei eine „große Nacht für die Vereinigten Staaten und für die Welt“ gewesen, so Trump weiter. „The world is now a much safer Place“, erklärte er. Und er bedankte sich bei den im Raum Idlib militärisch engagierten Mächten, insonderheit bei den Russen dafür, dass sie den Luftraum für die amerikanischen Einsätze über dem Ort Barisha freigemacht hätten. Schließlich erklärte er den Schäferhund, der Baghdadi in seinem Fluchttunnel aufgespürt habe, noch zum Helden.

Zweifel Russlands und anderer

Durchaus nicht alle Kommentare, muss man sagen, stimmten in den Ton dieser Botschaft mit ein. Die Russen etwa distanzierten sich umgehend von dem Dank, den Trump ihnen dafür abstattete, dass sie den Luftraum über Idlib freigegeben hätten und meldeten Zweifel an der Darstellung Trumps an. Ausgerechnet in der Zeitung „Die Welt“, sonst ja keineswegs russenfreundlich, konnte man erfahren, dass der russische Generalmajor Igor Konaschenkow erklärt habe, Russland sei über den Einsatz nicht vorab informiert gewesen. Die russische Weltraumaufklärung habe auch keine Luftanschläge in der Region Idlib registrieren können. Im Übrigen sei die Gefahr des Terrorismus im Raum Idlib keineswegs gebannt.[1]

Und nicht in allen Kommentaren fand zudem Trumps Pose Zustimmung, mit der er durch die Veröffentlichung eines Fotos aus dem Lagezentrum des Weißen Hauses, das direkt mit den Einsatzkräften vor Ort in Syrien verschaltetet war, der Welt-Öffentlichkeit ein Live-Erlebnis der Tötungsaktion vermitteln wollte.

Kritisiert wird allerdings nicht der aus dem Foto herausspringende Voyeurismus einer tötenden Staatsmacht. Nur Vergleiche zu Back Obama werden angestellt, Stilfragen werden erörtert. Obama habe bei der Tötung Osama bin Ladens 2011 die gleiche Situation im Lagezentrum mit einem ganz anderen „swag and style“ „lebendig und authentisch“ inszeniert, so der SPIEGEL[2]. Trump dagegen habe sich, seinem Super-Ego entsprechend, in den Mittelpunkt der Szene gesetzt, und das noch bevor die Aktion überhaupt begonnen habe. Also statt „life“ Erlebnis zu vermitteln, wirke die Szene gestellt, steif und autoritär. Kein Vergleich zu der lebendigen Präsentation Obamas.

Auch halten nicht alle Medien die Aktion Trumps für einen entscheidenden Erfolg im Kampf gegen den „IS“. Da stehen die Russen mit der schon benannten Einschätzung nicht allein. Baghdadi sei zwar das „Gesicht“ des „Islamischen Staates“ gewesen und als „Kalif“ auch die oberste ideologische Autorität des „Kalifats“; gegenüber den strategischen Planern der Organisation und deren exekutivem Netz müsse er jedoch als Nebenfigur betrachtet werden. Eher könne Baghdadi’s  Tod sogar zu einer Straffung der Führunsgstruktur des „Islamischer Staat“ führen. Baghdadi’s  Tötung zum jetzigen Zeitpunkt sei amerikanischen Einschätzungen folgend wohl eher als Befreiungsschlag eines innenpolitisch in Bedrängnis geratenen Trump, denn als entscheidender Schlag gegen den „Islamischen Staat“ von Bedeutung.[3]

Dies alles sind mögliche, richtige oder unrichtige, wichtige und weniger wichtige aktuelle Kommentare und Fragen zu diesem Ereignis. Es muss und wird weiter aufgeklärt werden – bis dahin, dass mit ziemlicher Sicherheit in nicht allzu ferner Zeit auch die von Trump angegebene Selbsttötung Baghdadi‘s unter Überschriften wie „Was wirklich in Barisha[4] geschah“ oder so ähnlich von irgendjemand angezweifelt werden wird. Wir leben schließlich in Zeiten der „Fakes“ und Konter-Fakes– zumal dann, wenn es um geheimdienstliche Aktionen geht.

Was hat Trump mit „justice“ gemeint?

Nur eine Frage sucht man vergebens. Sie wurde bisher nicht, jedenfalls nicht öffentlich, jedenfalls in den herrschenden Medien nicht gestellt, nämlich: Was hat Trump gemeint, als er seine Botschaft mit dem Satz begann, Baghdadi sei „to justice“ gebracht worden?

‚Recht‘, ‚Justiz‘, ‘Gerechtigkeit‘ – das sind die möglichen Übersetzungen des von Trump gebrauchten Wortes „justice“. Das kann jede/r  in den heute zugänglichen Übersetzungshilfen nachlesen. Aber wo in dieser US-Aktion – wie auch in der früheren von Obama – haben diese Worte ihren Platz? Weder Recht, noch Justiz haben in der Tötung Baghdadi’s auch nur die geringste Rolle gespielt. Und Gerechtigkeit? Solange ‚Gerechtigkeit‘ darin besteht, Menschen ohne staats- oder völkerrechtliches Verfahren zu töten, gleich, was ihnen vorzuwerfen ist, kann weder von Recht, noch einer handlungsfähigen Justiz, noch von Gerechtigkeit die Rede sein.

Daesh Chief Abu Bakr Baghdadi Flees Mosul.jpg

Dabei spielt es bei der ganzen Aktion schon keine Rolle mehr, ob sie im eleganten Stil Obamas oder dem etwas plumperen eines Trump durchgezogen und präsentiert wurde. Was da von Staatswegen inszeniert wurde – schon bei Obama, um einiges plumper jetzt von Trump – ist nicht nur gesetzlose Lynchjustiz, es ist Terror, der seinerseits Terror hervorbringt. In seiner medialen Präsentation des Voyeurismus vergiftet er zudem die Gesellschaft nachhaltig – und zwar von beiden Seiten: sowohl durch die Gewaltvideos des „Islamischen Staates“ als auch durch solche Inszenierungen wie die Obamas 2011 und die Trumps vor einer Woche.

Noch erschreckender, wenn dies alles auch noch im Namen höherer Werte geschieht: „They will not escape the final judgement of god“, posaunte Trump in seiner Botschaft zum Tod Baghdadi’s. Worin, muss man fragen, unterscheidet sich solch ein Gottesglaube noch von dem des getöteten „Kalifen“ Baghdadi? Aber hier muss die wichtigste Frage gestellt werden: wer stellt solche Fragen?

Kai Ehlers, www.kai-ehlers.de

[1] Welt vom 27.10.2019 https://www.welt.de/politik/ausland/article202556016/Trump-bestaetigt-Tod-von-al-Baghdadi-Russland-bezweifelt-Angaben.html

[2] Spiegel online, 28.10.2019 https://www.spiegel.de/kultur/gesellschaft/foto-von-donald-trump-nach-toetung-von-baghdadi-asymmetrisch-a-1293687.html

[3] Siehe Anm. 1

[4] Ort, an dem Baghdadi sich in Idlib verbarg

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————

Grafikquellen         :

Oben         —       Mugshot of Abu Bakr al-Baghdadi taken by US armed forces while in detention at Camp Bucca in the vicinity of Umm Qasr, Iraq, in 2004.

Author U.S Army     /    Source    –   https://www.scribd.com/doc/256164952/Baghdadi-Detainee-File
This image is a work of a U.S. Army soldier or employee, taken or made as part of that person’s official duties. As a work of the U.S. federal government, the image is in the public domain.

———————————-

Unten          —         Daesh (also ISIL) chief Abu Bakr al-Baghdadi is reported to have abandoned Mosul.

Abgelegt unter Amerika, International, Regierung, Schicksale | Keine Kommentare »

Katarina Witt – Interview

Erstellt von DL-Redaktion am 3. November 2019

„Man schweigt den Schmerz weg“

File:Bundesarchiv Bild 183-1988-0911-030, Katarina Witt, Jutta Müller.jpg

Von Anja Maier und Katrin Gottschalk

Die Eiskunstläuferin Katarina Witt war ein Weltstar, der in der DDR lebte – nicht alle haben sie dafür geliebt. Doch auch ihr und ihrer Familie kam 1989 das eigene Land abhanden. Ein Gespräch über hartes Training, Helden des Ostens und Männer am Herd.

taz am wochenende: Frau Witt, wir haben hier Fotos aus Ihrer Zeit in Karl-Marx-Stadt.

Katarina Witt: Ach, guck mal an. Die Frau Müller und ich in der Trainingshalle in Chemnitz! Oh Gott, wie toll, da müsste ich ungefähr dreizehn gewesen sein.

Wen sehen Sie auf diesen Bildern, wer waren Sie damals?

Das ist ein anderes Mädchen als das, an das ich mich erinnere. Kurze Haare, sehr burschikos, eher wie ein Junge. Und ich gucke da ziemlich ernst, Frau Müller sagt mir offenbar gerade, wo’s langgeht. Ich höre zu und hab ein bisschen Schiss.

Sie war ab 1977 Ihre Trainerin, hatte eine fast soldatische Ausstrahlung. Wie streng war diese Frau Müller tatsächlich?

Frau Müller war noch strenger, als man sich das ausmalen möchte. (lacht) Sie wollte das Beste von uns, das ist nun mal der Trainerjob. Da musste sie auch manchmal extrem sein, ohne dass man das gleich persönlich nimmt und sofort der Rechtsanwalt angerufen wird, wie das heute läuft. Der Sport war schließlich auch für mich eine ernste Sache. Wenn es nicht lief, hat man sich das sehr zu Herzen genommen. Ein Sportler muss im Grunde jeden Tag über seine Schmerzgrenze hinausgehen können, auch langweilige Sachen geduldig wiederholen.

Jutta Müller ist eine starke Frauenfigur in Ihrem Leben.

Absolut. Sie hat mich geprägt, ich habe lange mehr Zeit mit ihr als mit meiner Mutti verbracht. Wenn wir ins Ausland gereist sind, da hat sie mir auch mal ’ne Stulle geschmiert oder ein Würstchen unterm Wasserhahn warm gemacht. Wir haben ins Ausland Schwarzbrot und Salami mitgenommen, weil wir kaum Westgeld hatten, um uns was zu kaufen.

Gibt es heute junge Frauen, die Sie fördern und fordern?

Na ja, ich fordere vor allem meine Umwelt heraus. (lacht) Aber klar, ich treffe oft Frauen, denen ich ein Vorbild war, für die ich ein anderes Bild von der DDR rübergebracht habe: nicht immer so trist, wie man uns darstellen wollte. Einige erzählen mir auch, sie seien nach mir benannt worden.

Sind Sie eine Heldin?

Überhaupt nicht. Helden sind andere. Ich war eine Leistungssportlerin und habe da meine Frau gestanden, auch unter immensem Druck. Wir haben Leistungen geliefert, aber wir waren keine Helden, haben uns nicht aufgebäumt gegen etwas. Helden sind für mich die Leute, die 1989 auf die Straße gegangen sind. Die haben Mut gezeigt, Rückgrat. Ich hatte im Sport dagegen das, was ich machen wollte.

Wie kommt es eigentlich, dass es heute in der gesamtdeutschen Erzählung so wenige Heldinnen und Helden aus dem Osten gibt?

Ich bemerke, dass es da noch immer eine Trennung gibt. Als ich zum Beispiel nach dem Tod von Sigmund Jähn, dem ersten Deutschen im All aus der DDR, ein älteres Foto von uns beiden auf Instagram geteilt habe, kamen aus dem Osten diese Reaktionen: einer von uns, einer unserer Helden, einer von unserer Seite. Diese Reaktionen bekomme ich zu meiner Person auch. Auch mein Leben hat vor 89 stattgefunden und nach 89. Klar haben wir Nena und Modern Talking gehört – aber „bei uns“ sage ich, wenn es mit meinem ehemaligen Land zu tun hat. Auch wenn ich dies nicht wieder zurückhaben will. Jetzt gibt es andere Helden, für viele wird das gerade Greta Thunberg.

Als Sigmund Jähn verstorben war, entwickelte sich eine Debatte, ob jemand, der Generalmajor der DDR gewesen ist, zum Helden taugt. Wie sehen Sie das?

Ich finde es richtig, dass diese Diskussionen geführt werden. Aber das ist ja so, als würde man den Sportlern aus der DDR sagen: Ihr könnt keine Helden gewesen sein, denn ihr habt ja ’ne Diktatur repräsentiert. Sigmund Jähn und auch ich sind in der DDR aufgewachsen und zur Schule gegangen. Jähn wurde es dort ermöglicht, als erster Deutscher ins All zu fliegen. Was will man ihm da vorwerfen?

Was wird Ihnen denn 2019 noch vorgeworfen? Sie galten lange als SED-Profiteurin.

Eigentlich nüscht. (lacht) Klar, es gab’ne Zeit, wo ich sehr polarisiert habe. Letztendlich sagen eigentlich alle, ob Ost oder West, dass ich auf eine gute Weise meine Meinung, meine Haltung beibehalten habe. Ich habe meinem Land und dem Sportsystem alles zu verdanken, meiner Trainerin, meinen Eltern. Trotzdem bin ich nicht mit geschlossenen Augen durch die Welt gegangen, ich habe gesehen, dass der Sport der Bereich war, in dem Menschen wie ich ihre Träume verwirklichen konnten. In anderen Bereichen ging das nicht, und das war natürlich schlimm für die Betroffenen. Anderen wieder wurde vorgeschrieben, was sie lernen, studieren sollen.

Bundesarchiv Bild 183-1984-0831-421, Berlin, Sportlerball im Palast der Republik.jpg

Die Älteren erinnern sich an Sie als die Gold-Kati aus dem Osten, Jüngere haben Sie eher als Fernsehpromi auf dem Schirm. Als wer möchten Sie denn erinnert werden?

Ich will nicht als Fernsehpromi gesehen werden. Was ist das denn? Nüscht. Ich finde überhaupt dieses Promisein sehr fragwürdig. Ich komme vom Sport, und da habe ich eine Lebensleistung abgeliefert und dort fast ein Jahrzehnt die Weltspitze mitbestimmt. Das ist es, woran man sich erinnern soll.

Sie sind bekannt dafür, Ihr Privatleben sehr gut zu schützen. Kürzlich aber haben Sie doch eine sehr persönliche Geschichte erzählt. Für das Por­trätbuch „Ostfrauen verändern die Republik“ haben Sie geschildert, wie es Ihren Eltern nach der Wende gegangen ist.

Hören Sie auf, da fange ich gleich wieder an zu heulen.

Ihr Vater ist damals arbeitslos geworden, und Sie haben Ihre Eltern noch jahrelang unterstützt. Eine sehr ostdeutsche Erfahrung. Wie geht man als Kind damit um?

Ich war damals 23 Jahre alt. Meine Eltern, die heute über achtzig sind, waren damals also genauso alt wie ich heute. Die haben immer versucht, Probleme von uns Kindern fernzuhalten. Dieser Umbruch Anfang der Neunziger, der Schmerz, der damit einherging, die Verletzungen, das bricht ja jetzt erst auf. Unsere Eltern fangen jetzt erst an, offen zu reden, und das ist für uns, ihre Kinder, neu.

Wie war das damals in der Familie Witt?

Als die Mauer fiel, hatten meine Eltern schon ein langes Arbeitsleben hinter sich, die Kriegskindergeneration ist ja viel früher ins Berufsleben gestartet. Sie hatten erwachsene Kinder und die berechtigte Erwartung, jetzt ein Stück persönliche Freiheit gewinnen, die Früchte ihrer Arbeit ernten zu können. Also Anerkennung für ihre Arbeit, mehr persönliche Freiheiten, Erfahrungen weitergeben. Tatsächlich aber wurde ihnen gesagt: Wir haben eigentlich gar keinen Platz mehr für euch. Es ging da nicht nur um das Finanzielle, sondern auch um den verletzten Stolz, um diese Botschaft: Du bist überflüssig. Da wurde ihnen gesagt: Seid doch froh, ihr habt jetzt Freiheit, Demokratie. Aber was fängst du damit denn an, wenn gerade das gesamte Kartenhaus deines Lebens zusammenbricht und dich niemand an die Hand nimmt?

Was hätte denn damals geschehen müssen?

Es kam niemand und hat die Ostdeutschen an die Hand genommen. Unsere Kompetenzen waren nicht mehr gefragt. Die wenigsten waren ja Unternehmer, wir waren eher Macher, so haben wir das gelernt. Wir kamen aus einem Land, in dem – entschuldigen Sie den Ausdruck – aus Mist Bonbons gemacht wurde. Dinge wurden gelöst.

Aber 1990 kam dieses Prinzip an sein Ende.

Ja, so war das. Diese Generation musste nach dem Mauerfall um alles, alles kämpfen: ihre Rente, die Anerkennung der Abschlüsse und Studienzeiten, Frauenrechte, ihre Häuser und Wohnungen. Das ist das Problem heute: Diese Menschen fühlen sich zweitklassig behandelt. Sogar bei meiner Frau Müller habe ich das damals erlebt.

Was ist passiert?

Gala-Nacht des Sports 2013 Wien red carpet Hermann Kröll Theresa Breuer Katarina Witt.jpg

Man hat diese Weltklassetrainerin wirklich kaltgestellt. Die Rivalitäten zwischen dem ostdeutschen und dem westdeutschen Eislaufverband brachen voll auf. Wir waren nun mal die Erfolgreicheren in den zurückliegenden Jahren, wir hatten die Weltmeister, die Olympiasieger. Da hatte man schon dieses Gefühl: Ihr habt verloren, und wir sagen euch jetzt, wo’s langgeht. Selbst hier also, in diesem überschaubaren Bereich, hat man es nicht geschafft, die besten Erfahrungen aus beiden Systemen zusammenzuführen. Es gab eine große Arroganz, so eine herablassende Siegermentalität.

Haben Sie persönlich das auch zu spüren bekommen?

Quelle     :        TAZ          >>>>>         weiterlesen

———————————————————————

Grafikquellen       :

Oben        —        Katarina Witt, Jutta Müller ADN-ZB Thieme 11.9.1988 Karl-Marx-Stadt: Eiskunstlauf.- Die zweimalige Olympiasiegerin Katarina Witt wurde bei einem Schaulaufen in ihrer Heimatstadt Karl-Marx-Stadt vom Leistungssport verabschiedet. In der mit nahezu 5.000 Eissportfreunden ausverkauften Sporthalle „VIII. Parlament“ wurde die 22jährige Schauspiel-Studentin noch einmal begeistert gefeiert. Bewegende Augenblicke zum Abschluß einer glanzvollen Sportlerlaufbahn zwischen Trainerin Jutta Müller und Katarina Witt.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-1988-0911-030 / CC-BY-SA 3.0

——————————-

2. ) von Oben        —              Es folgt die historische Originalbeschreibung, die das Bundesarchiv aus dokumentarischen Gründen übernommen hat. Diese kann allerdings fehlerhaft, tendenziös, überholt oder politisch extrem sein. Berlin, Sportlerball im Palast der Republik ADN-ZB/Franke/31.8.84 Berlin: Sportlerball Beim Eintreffen zum Sportlerball im Palast der Republik: Erich Honecker, Generalsekretär des ZK der SED und Vorsitzender des Staatsrates der DDR; Dr. h.c. Margot Honecker, Minister für Volksbildung der DDR (2.v.l.); Willi Stoph, Mitglied des Poltibüros des ZK der SED und Vorsitzender des Ministerrates der DDR. L.: Bahn-Radsprinter Lutz Heßlich; 2.v.r.: Eiskunstlauf-Olympiasiegerin Katarina Witt. [Berlin.- Politiker und Sportler (u.a. Kati Witt) auf dem Weg zum Sportlerball im Palast der Republik, im Hintergrund Gebäude des Außenministeriums] Abgebildete Personen: Honecker, Erich: Staatsratsvorsitzender, Generalsekretär des ZK der SED, DDR (GND 118553399) Honecker, Margot: Ministerin für Volksbildung, SED, DDR (GND 122782933) Heßlich, Lutz: Radrennsportler, DDR Witt, Katarina: Eiskunstläuferin, SC Karl-Marx-Stadt, Olympiade 1984 und 1988, DDR (GND 11884508X) Stoph, Willi: Ministerpräsident, Staatsratsvorsitzender, Armeegeneral, SED, DDR

Abgelegt unter Feuilleton, Kultur, Mensch, Überregional | Keine Kommentare »

Koks für den Satan

Erstellt von DL-Redaktion am 3. November 2019

Die Hizbollah und der Kokainhandel

File:Erythroxylum coca 003.JPG

Von  Tal Leder

Der weltweite Drogenhandel ist für die libanesische Hizbollah eine wichtige Einnahmequelle. In Lateinamerika hat die schiitische Miliz Verbündete gefunden.

Die libanesische Terrororganisation Hizbollah ist tief in den internationalen Drogenhandel verstrickt und betreibt Geldwäsche in großem Stil. Ein komplexes System macht die Bekämpfung des sogenannten Drogen-Jihad schwierig. Im Zuge der Operation »Northern Shield« zerstörte die israelische Armee (IDF) zwischen Dezember 2018 und Mai 2019 sechs unterirdische Tunnel der Hizbollah. Die Tunnel reichten bis auf israelisches Territorium und sollten bei einem Kriegsausbruch Elitekämpfer und Waffen nach Israel bringen. Sie sollten der Organisation aber auch bei ihren Drogengeschäften nützen. Zwar wird die Miliz vom Iran militärisch, logistisch und finanziell unterstützt, doch ein Teil ihrer Einnahmen stammt aus dem Drogenhandel.

Die Hizbollah ist seit den achtziger Jahren in den Drogenhandel verwickelt, einer Zeit, als der Iran begann, sein ­geheimdienstliches Netz in Lateinamerika aufzubauen. Generell floriert im Nahen Osten der »Drogenterrorismus«, also die Finanzierung von Milizen durch Drogengeschäfte. Mittlerweile ist die Hizbollah selbst zu einem mächtigen Drogenkartell geworden. Nach Angaben der Vereinten Nationen ist der ­Libanon der drittgrößte Produzent von Cannabis-Harz (sechs Prozent der weltweiten Produktion), nach Marokko und Afghanistan. Roter Libanese, die gängigste Sorte Haschisch, wird im Irak, in Jordanien und in Dubai konsumiert. Beduinenstämme, die auf beiden Seiten der israelisch-ägyptischen Grenze leben, bringen Marihuana und Haschisch auch nach Israel. Manche dieser Ladungen werden auf Kamelen ohne menschliche Begleitung nach Israel geschickt und nach dem Überqueren der Grenze abgeholt.

Neben dem Verkauf von Cannabis ist insbesondere der Schmuggel und Verkauf von Kokain eine Geldquelle der Miliz. Nach Einschätzung der US-Behörden setzt sie dabei jeden Monat 200 Millionen US-Dollar um.

Die Aktivitäten der Hizbollah erstrecken sich nicht nur nach Europa, insbesondere nach Deutschland, Belgien und auf den Balkan, sondern auch nach Südamerika, dort besonders in die Dreiländerregion von Argentinien, Brasilien und Paraguay, wo es schon seit langem eine libanesische Diaspora gibt. Im 19. Jahrhundert wanderten dort die ersten Libanesen ein, viele weitere kamen in den achtziger Jahren während des libanesischen Bürgerkriegs; heutzutage leben über 50 000 Libanesinnen und Libanesen in dem Gebiet.

Auch in Lateinamerika ist die Hizbollah tätig, neben Venezuela auch in Mexiko. Durch die Allianz mit Drogenkartellen wie den mexikanischen ­Zetas kann die Terrormiliz enorme Gewinne aus dem illegalen Drogenhandel er­zielen und für die Bewaffnung, Ausrüstung und Ausbildung ihrer Mitglieder verwenden. Sie dient dort häufig als Kurierdienst für die Verteilung der von den Kartellen vertriebenen Drogen ­sowie für die Geldwäsche.

Ein internes Memo der Polizei von Tucson, Arizona, enthüllte bereits im Jahr 2010, dass die Hizbollah Verbindungen zu mexikanischen Drogenkartellen aufgebaut hatte, um ihnen zu helfen, Geld zu waschen und zugleich den Waffen- und Drogenhandel zu fördern. Die Polizei warnte davor, dass die Folgen der Zusammenarbeit zwischen der Hizbollah und den mexikanischen Drogenkartellen katastrophal sein könnten, da die Terrororganisation über fortschrittliche Waffen und Fachwissen verfüge, insbesondere über Kennt­nisse im Umgang mit improvisierten Sprengkörpern.

Der sogenannte Drogenterrorismus  gefährde mittlerweile die nationale ­Sicherheit vieler Nationen, sagt Rachel Ehrenfeld, Gründerin und Direktorin des in New York ansässigen American Center for Democracy sowie von dessen Economic Warfare Institute. »Der Zusammenhang zwischen transnationalen kriminellen Organisationen und terroristischen Gruppen endet nicht bei illegalem Drogenhandel. Ihre Partnerschaften sind komplex und verbinden Kriminalität mit Wirtschaft und Politik«, so Ehrenfeld. Ein Teil des Geldes werde verwendet, um politische Systeme zu destabilisieren. Der sogenannte Kokain-Jihad gehe auf eine iranische Fatwa zurück: »Wir stellen ­diese Drogen für den Satan Amerika und die Juden her. Wenn wir sie nicht mit Waffen töten können, dann mit Drogen.«

Quelle          :          Jungle-World          >>>>>         weiterlesen

———————————————————————-

Grafikquellen        :

Oben         —          Erythroxylum coca, Erythroxylaceae, Cocastrauch, Blüte. Das Alkaloid Kokain wird in der Homöopathie als Arzneimittel verwendet: Cocainum purum (Cocain-p.)

This file is licensed under the Creative CommonsAttribution-Share Alike 3.0 Unported license.

Author H. Zell       /       Source     –   Own work

——————-
Unten         —        Des combattants des Forces révolutionnaires internationales de guérilla, à Tabqa, le 12 juin 2017.

Abgelegt unter Asien, Kriminelles, Medien, Umwelt | Keine Kommentare »

UNO berät über Syrien

Erstellt von DL-Redaktion am 2. November 2019

Neustart der Syrienverhandlungen in Genf

Quelle       :         INFOsperber CH.

Von Andreas Zumach

In Genf nimmt der Ausschuss zur Erarbeitung einer neuen Verfassung für Syrien seine Arbeit auf.

Achteinhalb Jahre nach Beginn des syrischen Bürgerkrieges im März 2011 sind VertreterInnen der Regierung Assad und einer Koalition diverser Oppositionsgruppen und Rebellenmilizen am Mittwoch erstmals in einem Raum zusammengekommen: Mit einer Eröffnungszeremonie im historischen Ratssaal des Genfer UNO-Gebäudes nahm der Ausschuss zur Ausarbeitung einer neuen syrischen Verfassung seine Arbeit auf. Dem Ausschuss gehören je 50 VertreterInnen der Regierung, der Oppositionskoalition sowie der syrischen Zivilgesellschaft an. Der Ausschuss soll in den nächsten Tagen noch im Plenum tagen und dann in kleinerem Rahmen mit je 15 VertreterInnen der drei Gruppen die eigentlichen Verhandlungen beginnen. Beschlüsse sollen wenn möglich im Konsens getroffen werden, bedürfen aber mindestens der Zustimmung von 75 Prozent der Ausschussmitglieder. Damit hat jede der drei Gruppen eine Sperrminorität.

Die Einigung auf die 150 Namen und auf die Verfahrensregeln ist die erste Verständigung überhaupt, die die syrischen Konfliktparteien seit 2011 erzielt haben. Sie erfolgte in mühsamen Verhandlungen der letzten zwölf Monate unter Federführung des norwegischen Diplomaten Geir O. Pedersen. Pedersen, der bereits Anfang der 90er Jahre als Vermittler an den Verhandlungen über das Oslo-Abkommen zwischen Israel und den PalästinenserInnen beteiligt war, ist der inzwischen vierte Syrienbeauftragte der UNO seit 2012 nach Ex-Generalsekretär Kofi Annan, dem Algerier Lakmar Brahimi und dem Schweden Staffan di Mistura.

Ein säkulares, multiethnisches und demokratisches Syrien

Die Genfer UNO-Verhandlungen über eine Beendigung des Syrienkrieges und eine politische Konfliktlösung begannen bereits Ende Januar 2016. Basis ist die einstimmig verabschiedete Resolution 2254 des UNO-Sicherheitsrates vom Dezember 2015. Die Resolution proklamiert als Ziel ein säkulares, multiethnisches und demokratisches Syrien auf dem gesamten bisherigen Staatsgebiet und bestimmt als wichtigste Umsetzungsschritte einen landesweiten Waffenstillstand, die Bildung einer Übergangsregierung sowie die Ausarbeitung einer neuen Verfassung. Nach deren Annahme sollen in einer Volksabstimmung von der UNO überwachte Parlaments- und Präsidentschaftswahlen stattfinden. Doch alle neun Genfer Verhandlungsrunden bis September 2017 blieben ergebnislos. Die Delegation der Regierung Assad verweigerte bis zuletzt direkte Gespräche mit der Oppositionsdelegation oder auch nur den gemeinsamen Aufenthalt in einem Verhandlungssaal des Genfer UNO-Gebäudes. Eine zumindest teilweise sowie zeitliche befristete Waffenruhe wurde erst in Verhandlungen zwischen Russland, der Türkei und Iran in der kasachischen Hauptstadt Astana vereinbart. In der Provinz Idlib dauert der Krieg aber an. Die Bildung einer Übergangsregierung wurde von der Delegation der Regierung Assad strikt abgelehnt.

UNO-Vermittler Pedersen konnte durchsetzen, dass wenigstens knapp 30 Prozent der 150 Mitglieder des Verfassungsausschusses Frauen sind. Auch die syrischen Kurden sind vertreten. Die Türkei verhinderte mit ihrem Veto allerdings eine Beteiligung der Demokratischen Kräfte Syriens (SDF), zu denen die von Ankara als «Terroristen» eingestuften und militärisch bekämpften kurdischen Volksverteidigungseinheiten (YPG) gehören.

«Die Tatsache, dass Sie bereit sind, einen Dialog zu starten, ist ein starkes Signal der Hoffnung für Syrer überall», erklärte UNO-Vermittler Pedersen bei der Eröffnungssitzung am Mittwoch. Auch die beiden Co-Vorsitzenden des Verfassungsausschusses, Ahmad Kuzbari für die Regierung Assad und Hadi Albahra für die Opposition, gaben sich verhalten optimistisch, dass der neue Ausschuss einen Beitrag für einen politischen Neustart für Syrien leisten könne.

Themenbezogene Interessen (-bindung) der Autorin/des Autors

Keine.

FREIE NUTZUNGSRECHTE

© Das Weiterverbreiten sämtlicher auf dem gemeinnützigen Portal www.infosperber.ch enthaltenen Texte ist ohne Kostenfolge erlaubt, sofern die Texte integral ohne Kürzung und mit Quellenangaben (Autor und «Infosperber») verbreitet werden. Die SSUI kann das Abgelten eines Nutzungsrechts verlangen.

Bei einer Online-Nutzung ist die Quellenangabe mit einem Link auf infosperber.ch zu versehen. Für das Verbreiten von gekürzten Texten ist das schriftliche Einverständnis der AutorInnen erforderlich.

——————————————————————–

Grafikquelle       :      Das Palais des Nations ist Sitz der UNOG.

Abgelegt unter Europa, International, Mensch, Redaktion | Keine Kommentare »

10 Gebote via Klimasünden

Erstellt von DL-Redaktion am 1. November 2019

Was tun gegen die Erderwärmung

File:Cloudeffects.svg

Von Daphne Weber

Extinction Rebellion hat Recht: die Erderwärmung ist besorgniserregend, Endzeitstimmung ist angesagt. Aber wer ist der Adressat des Jüngsten Gerichts?

In wallende rote Gewänder gekleidet schreiten schweigende Gestalten durch die Straßen. Einige von ihnen tragen rote Fahnen, auf ihnen eine stilisierte Sanduhr. Hamburg: Über die neue Promenade ergießt sich rotes Kunstblut, inmitten der Lake ein weißer Sarg, ebenfalls mit einer Sanduhr versehen. Nein, wir sind nicht versehentlich in der Karwoche in Sevilla gelandet, bei der Hunderte in violetten Büßergewändern durch die Stadt prozessieren und um die Vergebung ihrer Sünden bitten. Es handelt sich um Protestformen der Gruppe Extinction Rebellion (XR), die unter anderem Anfang Oktober einige Straßenblockaden in Berlin organisiert hat, um auf das globale Artensterben aufmerksam zu machen.

Nichtsdestotrotz ist der Vergleich mit Büßerprozessionen nicht ganz weit hergeholt. XR bemüht die martialische Bildwelt gern, zum Beispiel, wenn Galgen aufgestellt werden, unter denen Demonstranten auf schmelzenden Eisblöcken stehen. So weit, so mittelalterlich. Mit dem Unterschied, dass das Ganze in High-Quality-Videoclips voller hoch emotionalisierter Affektbilder auf Instagram zu sehen ist. Der Social-Media-Auftritt? Maximal professionell. Die Bildsprache? Maximal messianisch-religiös. Die Inhalte? Ihr werdet alle sterben.

Es kann sein, dass vor Ort alles sehr nett ist, es kann sein, dass die Initiative noch jung ist und sich erst finden muss. Aber es darf gefragt werden, wohin sie steuert.

Bei XR kann jeder mitmachen, der sich einem Konsens von 10 Geboten verpflichtet, unter anderem dem Gebot der „Gewaltfreiheit“. Welchen Gewaltbegriff XR hat, bleibt dabei schleierhaft. Parolen wie „The day of reckoning will come“ oder „Stand with the earth“ erinnern an die biblische – sehr gewaltvolle – Apokalypse des Johannes. Wer nicht für mich ist, ist gegen mich, und der Tag des Jüngsten Gerichts wird kommen. Die Sanduhr läuft ab, und zwar zwingend. Damit inszenieren sich die Aktivisten als Propheten eines nahenden Endes der Welt. Die Natur ist Gott, und ihr muss man sich beugen.

Mutter-Erde-Metaphern

Die Rebellion gegen das Artensterben mag ehrenhaft sein. Sie gleitet allerdings mitunter ins Esoterische ab. Bei den Blockaden in Berlin gibt es die Möglichkeit, für die Erde zu meditieren. Alte Mutter-Erde-Metaphern treten an die Stelle eines kritischen Feminismus, der uns vor allem eines gelehrt hat: Was Natur ist, ist menschliche Kons­truk­tion. Welche Natur will XR schützen? Rebellion gegen das Artensterben um ihrer selbst willen? Oder Rebellion gegen das Artensterben, weil die Lebensgrundlage des Menschen vernichtet wird?

Dass der Mensch die Natur in Ansätzen beherrschen gelernt hat, ist ein Fortschritt, hinter den eine progressive Bewegung nicht zurückfallen sollte. Und ohne technischen Fortschritt ist die gerechte, klimafreundliche und ausbeutungsfreie Gesellschaft auch nicht zu denken. Wer das infrage stellt, sehnt einen Steinzeitkommunismus herbei, in dem wir uns wieder selbstversorgend vom Schweiß des Ackers ernähren und eine Lebenserwartung von knapp vierzig Jahren haben, Säuglingssterblichkeit inklusive. In manchen Teilen der Umweltbewegung wirkt es, als seien der technische Fortschritt und der Mensch an sich das Problem, da sie das Artensterben verursachen würden. Hier muss letztlich der emanzipierte Mensch unsichtbar werden, er muss verschwinden, so wie die sündigen Büßer unter ihren Gewändern.

Ja, die Erderwärmung ist besorgniserregend, Endzeitstimmung scheint angebracht. Aber wer ist der Adressat des Jüngsten Gerichts? Die Bilder, die die Anti-Kohlekraft-Bewegung Ende Gelände produziert, scheinen ebenfalls der Apokalypse zu entstammen: Aktivisten in weißen Anzügen schlittern durch sandige Wüsten, über ihnen bäumen sich gigantische Kohlebagger auf, umringt von Robotercops. Das ist die Realität 2019, auf die Ende Gelände den medialen Fokus richtet: Eine Marslandschaft, geopfert dem Konzernprofit. Ende Gelände legt den Finger in die Wunde und adressiert einen sorgfältig abgeschirmten konkreten Akteur der Klimakrise: RWE. Der Kampf um Klimaschutz ist kein individueller Ablasshandel. So erscheint er aber oft bei Gruppen wie XR.

Climate change protests, Melbourne.jpg

Der einzelne Mensch an sich ist nicht der Hauptverursacher der Klimakrise. Anders gefragt: Wo soll eine Hartz-IV-Mama den Gürtel noch enger schnallen? Wie soll der Pendler in die Stadt, um Lohn zu erarbeiten, wenn der ÖPNV so miserabel ist? Die Verzichtslogik bei Umweltgruppen wie XR kommt im Büßergewand daher, und das passt auch zur Inszenierung der Proteste.

„Sagt die Wahrheit“

Die Aktivisten weisen zwar darauf hin, dass der Kollaps von Ökosystemen auch das Aussterben des Menschen zur Folge haben wird. Die Klimakrise wird aber nicht gelöst werden, wenn man so tut, als seien alle Menschen in gleicher Weise „Klimasünder“ und müssten einfach nur Abbitte leisten. Die Klimakrise wird nicht überwunden werden, wenn Wirtschaft und Verteilung des Reichtums unangetastet bleiben. Das gehört zur Wahrheit, und „Sagt die Wahrheit“ ist schließlich eine der drei Kernforderungen von XR.

Quelle          :       TAZ           >>>>>          weiterlesen

————————————————————————-

Grafikquellen         :

Oben         —       Hohe Wolken sind oft dünn und nicht sehr reflektierend. Sie lassen einen Großteil der Sonnenwärme durch, und da sie in großen Höhen liegen, wo die Lufttemperatur sehr niedrig ist, strahlen diese Wolken nicht viel Wärme ab. Die Tendenz hoher Wolken ist, die Erde zu erwärmen. Niedrige Wolken sind oft dicht und reflektieren viel Sonnenlicht zurück in den Weltraum. Sie liegen dabei auch niedriger in der Atmosphäre, wo Temperaturen wärmer sind, und strahlen deshalb mehr Wärme ab. Die Tendenz niedriger Wolken ist, die Erde zu kühlen.

Author Christoph S.    /     Source    —    original image, freely redrawn with Inkscape by User:Gissi

I, the copyright holder of this work, release this work into the public domain. This applies worldwide.
In some countries this may not be legally possible; if so:

—————————-

Unten           —         Thousands of Cyclists in Melbourne for 350 Climate Protest

Abgelegt unter Bildung, International, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Sexismuskritik -+- Wedding:

Erstellt von DL-Redaktion am 1. November 2019

Das „viertcoolste“ Stadtviertel der Welt

File:Strassenschild luederitzstr berlin.JPG

Ist es nicht eine alte Tradition der Politiker – Innen, ehemalige Mörder und Verbrechen durch  Benennung von öffentlichen Plätzen und Straßen im Gedächnis  einzuzementieren.  Motto wir sind heute soooo viel besser !!

Quelle      :         Untergrund-blättle CH.

Von    lcm

Vor gut einem halben Jahr, es war die Nacht zum 8. März, zogen wir durch die menschenleeren Strassen im Wedding, um uns zur Feier des Tages einen Teil des öffentlichen Raums anzueignen.

Wir sind eine Gruppe organisierter Frauen aus dem Wedding, die anlässlich des Frauenstreiks verschiedene Aktionen in ihrem Kiez durchgeführt haben. Eine davon die Umbenennung von Strassennamen.

Es gibt knapp 10.000 Strassen in Berlin. 90 % der nach Personen benannten Strassen tragen männliche Namen. In anderen Städten sieht das Verhältnis genauso aus. Keiner dieser Namen ist zufällig gewählt, die Strassenbenennung ist eine Würdigung und ein unübersehbares Gedenken an diese Person. Gedacht wird allerdings fast ausschliesslich Männern, darunter auch so besondere Schätze wie Axel Holst, ein SS-Sturmführer oder Adolf Lüderitz, ein Kolonialherr. Gleichzeitig werden Frauen in der Geschichte und im öffentlichen Raum systematisch unsichtbar gemacht, obwohl es zahlreiche tatsächlich verdienstvolle Frauen gibt.

Anlässlich des Frauenstreiks in Berlin haben wir mehrere Strassen, die jeweils einen Mann würdigen, umbenannt. Wahlweise in Elise-Hampel-Strasse, Stephanie-Hüllenhagen-Weg oder auch Luise-Kraushaar-Allee. Sie alle waren NS-Widerstandskämpferinnen, die zum Teil auch im Wedding gelebt haben. An jedes Strassenschild befestigten wir ausserdem einen Steckbrief zur Person und der Erklärung, warum diese Strasse nun einen Frauennamen trägt. Die Müllerstrasse, die so etwas wie die Hauptstrasse im Wedding ist, benannten wir ausserdem in „Müllerinnenstrasse“ um.

Mit der einsetzenden Morgendämmerung fielen wir zufrieden in unsere Betten. Die Aktion war geglückt. Das böse Erwachen kam dann einige Monate später in Form eines Grossflächenplakats, prominent platziert auf dem Mittelstreifen der Müllerstrasse. Auf ca. 2×3 Metern war da ein Foto der von uns umbenannten „Müllerinnenstrasse“ zu sehen. Unsere Kritik war plötzlich Teil einer Kampagne der StandortGemeinschaft Müllerstrasse e.V., gefördert vom Bundesministerium des Innern, für Bau und Heimat sowie der Berliner Senatsverwaltung für Stadtentwicklung und Wohnen. Kannste dir nicht ausdenken.

Nun ist es sicherlich kein neues Phänomen, dass Systemkritik verwertbar u