KRITISCHE INTERNET-ZEITUNG


Archiv für die 'Nordrhein-Westfalen' Kategorie

Fußball in Corona-Krise

Erstellt von DL-Redaktion am 1. April 2020

Plötzlich egal

Von Andreas Rüttenauer

In Corona-Zeiten wird klar: Man kann auch ohne Fußball leben. Für die Bosse muss das eine harte Erkenntnis sein.

Keine Liebe mehr am Samstag, kein Hass mehr. Kein Daumendrücken, keine Schadenfreude. Keine Tränen, keine geballten Fäuste. Nicht freitags, nicht sonntags und auch unter der Woche nicht. Die Fußballbundesliga hat sich in die Coronapause verabschiedet, die Champions League ruht, und auch die Nationalmannschaften kicken nicht mehr. Die Fußballrepublik Deutschland, so möchte man meinen, muss in ein tiefes emotionales Loch gefallen sein. Kein Kampf um die Meisterschaft, kein Abstiegskampf. Keine Hass auf Dietmar Hopp und kein Entsetzen über den Videobeweis. Was macht das mit einer Fußballnation wie Deutschland? Die Antwort nach den ersten fußballfreien Wochen fällt für die Branche ernüchternd aus. Nichts. Der Fußball mag die erfolgreichste Nebensache der Welt sein. Die Krise zeigt, dass er nie eine echte Hauptsache sein wird.

Die Milliardenumsätze, an die man sich gewöhnt hat, die irrwitzigen Ablösesummen und auch die Millionengehälter der besten Profis, die nichts unversucht lassen, diese so anzulegen, dass Steuerbehörden keinen Zugriff darauf haben, können noch so groß sein, sie zeigen, dass der Fußball ein irres Geschäft ist. Und doch scheint er verzichtbar. So egal war der Fußball den Menschen selten. Und statt zu den Stadien zu pilgern und dort gegen den Stillstand des Spielbetriebs zu demonstrieren, haben die in den vorvergangenen Wochen so viel gescholtenen Ultras Transparente vor Krankenhäusern angebracht, auf denen sie ihre Dankbarkeit dem Pflegepersonal gegenüber zum Ausdruck gebracht haben. Man kann ganz gut mal ohne Fußball leben. Für die Macher des Fußballs, die Manager der Ligen und die Bosse der Klubs muss das eine harte Erkenntnis sein.

Ein Fifa-Präsident wird behandelt wie ein Staatsgast, wenn er Wladimir Putin oder die Herrscherfamilie von Katar besucht. In der Coronakrise merkt er, dass sein Reich nicht wirklich mächtig ist. Der Fußball ist als Unterhaltungsbusiness alles andere als systemrelevant. Der Welt geht es dreckig und der Fußball kann nicht viel mehr machen, als seine bekannten Gesichter nach vorne schicken und die Menschen zu einem gesunden Lebensstil aufzufordern. Auch das eine bittere Erkenntnis für eine Szene, die es gewohnt ist, angehimmelt zu werden.

File:Borussia Dortmund Squad (before a football match and greeted by BVB fans).jpg

Wird diese Erkenntnis den Fußball demütig machen? Wird anders gespielt, wenn der Ball endlich wieder rollt? Gibt es bald schon den Profifußball mit menschlichem Antlitz? Hört man den Protagonisten der Szene zu, muss man das fast glauben. Da nehmen Menschen das Wort Solidarität in den Mund, die bis dato nichts anderes kannten als den gnadenlosen Wettbewerb. Uli Hoeneß, der Ehrenpräsident des FC Bayern München mit Zuchthausvergangenheit, sagte in der Sportpostille Kicker: „Solidarität muss jetzt gelebt werden, nicht nur erzählt.“ Dann legen die vier Champions-League-Teilnehmer dieser Saison 20 Millionen Euro in einen Topf, um die kleineren Profivereine in der Ersten und Zweiten Liga vor dem Untergang zu retten.

Entgangene TV-Einnahmen

Fehlende Einnahmen aus dem nicht laufenden Geschäft haben die Profivereine dazu gezwungen, mit den Spielern über Gehaltseinbußen zu verhandeln. 750 Millionen Euro gehen der Liga allein an Einnahmen aus TV-Rechten verloren, sollte sich das Vorhaben der Liga nicht umsetzen lassen, die Meisterschaft zur Not ohne Publikum im Sommer zu Ende zu spielen. Es geht sogar echten Weltmeistern ans Geld. Manuel Neuer und seine Kollegen aus der Mannschaft des FC Bayern München verzichten auf 20 Prozent ihres Gehalts, damit die niederen Mitarbeiter des Klubs nicht in die Kurzarbeit geschickt werden müssen. Auch das wird als Geste der Solidarität verkauft. Wird der Fußball also wieder gut? Werden aus kickenden Geschäftsleuten wieder die viel besungenen elf Freunde?

Quelle     :      TAZ        >>>>>         weiterlesen


Grafikquellen       :

Oben      —       Innenansicht des Stadions während der Fußball-Weltmeisterschaft der Frauen 2011


Unten       —      Die Spieler des BVB betreten den Platz und bereiten sich auf das Spiel vor.

Source Flickr: BVB-im-HSK_2011-07-04 18-35-41
Author Axel Schwenke
(Reusing this file)
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.

Abgelegt unter Feuilleton, Gesundheitspolitik, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Heinsberg geht viral

Erstellt von DL-Redaktion am 30. März 2020

Der Landkreis, wo alles begann


86 Pfarrhaus, Dorfstraße 18 Uetterath.jpg

Von Bernd Müllender

Diskriminierung, Angst und Hilflosigkeit weichen Hoffnung: Im Heinsberg startete das Virus, dort zeichnet sich der Weg für uns alle ab.

Lange kannte man vom Kreis Heinsberg höchstens die Awacs-Airbase der Nato in Geilenkirchen-Teveren oder Orte wie Holzweiler und Kuckum, wo die Menschen dem Braunkohletagebau Garzweiler II zu trotzen versuchen. Vielleicht wussten manche noch vom Selfkant, Deutschlands westlichstem Zipfel an der niederländischen Grenze.

Doch dann, am 25. Februar, schaffte es der Weiler Gangelt-Langbroich-Harzelt, gleich bei dem 600 Einwohner zählenden Schierwaldenrath gelegen, zu maximaler Prominenz. Von hier stammte der erste Infizierte. In Gangelt steht, neben der Freiwilligen Feuerwehr, ein unscheinbarer Flachbau, rotbraun geklinkert: die Bürgerhalle. Sie bietet gut 300 Leuten Platz, jedenfalls dann, wenn man die Menschen eng zusammensetzt.

So war es auch bei der karnevalistischen Kappensitzung am Abend des 15. Februar. Begeistert schrieb die Lokalzeitung von „unglaublichen Szenen“ der bierseligen Feier: „… die Quetschbüllsänger aus Hastenrath legten stimmungsmäßig weiter drauf, die Bürgerhalle tobte regelrecht, Langbroich war nicht mehr zu bremsen.“ Leider galt das auch für die vielen ungeladenen Gäste namens Sars-CoV-2.

Auf der Bühne hatte auch Immobilienmakler Bernd B. (47) aus Gangelt-Birgden mit seinem Männerballett getanzt. Er war ahnungslos coronainfiziert. Ungezählte steckten sich an und gaben das Virus flugs weiter: Da nahm die Epidemie mit den Menschheitsfeinden von 0,000001 Millimetern Durchmesser in Deutschland ihren Anfang, tagelang unbemerkt.

Und dann: Der „große Schreck“

Auch bei Irene Nobis, 57, systemische Therapeutin aus dem 3.000-Seelen-Dorf Birgden, war das Virus ganz schnell ganz nah, bevor sie oder sonst wer auch immer nur etwas davon ahnen konnte. Eine Woche nach der Kappensitzung waren drei Dutzend Leute bei ihr zu Gast: Geburtstagsfeier der Tochter, die über die tollen Tage aus Norddeutschland zu Besuch gekommen war. Dann kamen die ersten Coronameldungen über Bernd B., der, vorbelastet nach einem Krebsleiden, mit schweren Symptomen auf die Intensivstation gekommen war und sofort ins künstliche Koma versetzt werden musste.

Irene Nobis erinnert sich an ihren „großen Schreck“: „Den kenne ich, sein Büro ist hundert Meter weiter.“ Ihr Schwiegersohn war auch auf der Kappensitzung, danach beim Karnevalsumzug, dann bei ihr. „Ich bin sofort in freiwillige Isolation gegangen.“

Größte Sorge: Ihre Mutter nebenan war an Bronchitis erkrankt. Lange Ungewissheit. Dann endlich die Tests. Die Ergebnisse: Mutter negativ, sie auch, anders die Tochter. „Die war sogar quasi berühmt, kam als erst dritter Fall in Schleswig-Holstein ins Fernsehen.“ Aha, Heinsberg, hieß es. Insgesamt wurden sechs Personen von Nobis’ Feier positiv getestet.

Die Heinsberger Gegend – halb Mittelrhein, halb Niederrhein – ist nicht gerade menschenleer, es gibt ein paar Städte wie Heinsberg selbst, Erkelenz, Geilenkirchen, Wegberg, ansonsten aber viel Platz zwischen den Dörfchen, besonders im Selfkant. Hier franst Deutschland aus. Die Flüsslein heißen Rur und Wurm.

Es ist so flach, dass man morgens schon sehen kann, wer nachmittags zu Besuch kommt.

Man wundert sich, dass der Kreis dennoch auf 250.000 EinwohnerInnen kommt. Als vor ein paar Jahren tatsächlich ein Fremdenverkehrsbüro aufmachte, fragten sich die arroganten Nachbarn in Aachen, Mönchengladbach oder Köln naserümpfend: Wozu? Fährt da wer freiwillig hin? Doch, zum Beispiel zu Radtouren in den lauschigen Naturpark Schwalm-Nette. Oder zu Wanderungen in die zauberhaften Heidelandschaften.

Ackerbau dominiert, Getreide, Spargel, im Norden vor allem der Zuckerrübenanbau. Dessen Ernte 2019 ist besser gewesen als 2018. Das ist wichtig hier. Es ist so flach, dass man, um mit dem großen Niederrheiner Hanns-Dieter Hüsch zu sprechen, morgens schon sehen kann, wer nachmittags zu Besuch kommt. Wahrscheinlich gibt es auch eine höchste Erhebung, man weiß nur nicht, welcher der Kirchtürme im Kreis das wohl ist. Die katholische Konfession dominiert. Weniger als 50 Prozent bei Wahlen wären für die CDU ein Debakel.

Vielleicht sind aber auch die Abraumhalden bei Hückelhoven die mächtigsten Erhebungen. Hier wurde bis 1997 nach Steinkohle gegraben. Heute schrumpft der Kreis Heinsberg: die Braunkohlebagger von RWE graben bei Immerath Dorf um Dorf weg. Immerhin hat man durch das Braunkohleloch den tiefsten Punkt Deutschlands aufzuweisen: etwa minus 300 Meter.


Da hat das Virus aber einen langen Weg hinter sich bringen müssen, bevor es auf einen Gastgeber traft.

Kurz: Das vermeintlich rückständige Heinsberg war immer schon, besonders im Karneval, Objekt des Spotts. Seit Ende Februar aber müssen sich HeinsbergerInnen wie Kriminelle fühlen. Nebenan in Holland, jenseits der letzten offenen Grenze Deutschlands, werden Halter mit dem Autokennzeichen „HS“ als „Coronaschleudern“ beschimpft oder die Autotüren werden zugehalten, damit die Insassen nicht aussteigen können. Andere erzählen, man habe sie in den Cafés, solange diese noch geöffnet waren, nicht bedient.

Selbst Gefangene sollen im Kreis bleiben

Ansässige Firmen, etwa im Industriebau, verlieren Aufträge: bloß kein Produkt aus Heinsberg, igitt. Die Leiterin der JVA Heinsberg berichtet, andere Anstalten weigerten sich, Gefangene zu übernehmen: „Wir sind verpönt, weil wir angeblich die Wurzel allen Übels sind.“ Sternekoch Alexander Wulf aus Randerath schimpft sarkastisch: „Man muss sich ja schon schämen, wenn man sagt, man sei aus Heinsberg.“

Beim Missionskreis Osteuropa in Süsterseel warteten neulich 2.500 Bananenkisten voll mit Hilfsgütern auf den Lastwagenfahrer aus Rumänien. Der sonst so zuverlässige Mann kam einfach nicht. Heinsberg?, nein, sagte er am Telefon, da müsse er sonst daheim zwei Wochen in Quarantäne, direkt an der Grenze. Auf Facebook erschien derweil eine Ortsschild-Fotomontage „Heinsberg – Partnerstadt von Wuhan“. Angstprojektion, hilflose Abgrenzungsversuche.

Quelle      :         TAZ        >>>>>        weiterlesen


Ketten wollen keine Mieten mehr zahlen:

Kampf der Großkonzerne

Maischberger - 2019-03-06-6426.jpg

Kommentar von Ulrike Herrmann

Adidas, H&M und Co wollen vorerst keine Miete mehr zahlen. Klassenkampf? Es geht darum, wer die Zinsen zahlt.

Die Politik ist empört: Handelsketten wie Adidas, H&M oder die Schuhkette Deichmann wollen vorerst keine Miete mehr für ihre Läden zahlen, die im Zuge der Corona-Epidemie geschlossen wurden. Dies sei „unanständig“ und „nicht akzeptabel“, wetterte SPD-Justizministerin Christine Lambrecht. Und Bundesverkehrsminister Andreas Scheuer (CSU) ließ wissen, er sei „sehr enttäuscht“. Denn Mieten sollen nur gestundet werden, wenn sich die Mieter durch die Coronakrise in existenziellen Nöten befinden. Adidas hingegen verbuchte im vergangenen Jahr einen Milliardengewinn.

Das Verhalten der Premiummieter sieht zunächst wie ein Klassenkampf von oben aus, es wirkt, als bereicherten sich Großkonzerne erneut skrupellos. Doch so einfach ist es nicht. Zunächst einmal: Die Vermieter von Gewerbeimmobilien sind meist ebenfalls Großkonzerne. Dazu gehören Lebensversicherungen, Banken, Fonds und börsennotierte Immobilienkonzerne. Sie alle haben großflächig in Einkaufszentren und Ladenzeilen investiert. Etwas überspitzt formuliert: Adidas kämpft jetzt gegen die Allianz, wenn es um die Mietzahlungen geht.

Zudem sehen die Corona-Hilfsmaßnahmen vor, dass Mieten nur gestundet und später nachgezahlt werden. Adidas spart also gar kein Geld, sondern verschiebt seine Ausgaben nur in die Zukunft. Am Ende hat niemand einen Schaden.

Quelle       :       TAZ       >>>>>         weiterlesen



Oben      —      Pfarrhaus, Denkmal Nr. 86 in Uetterath-Heinsberg


Unten     —   Landschafts-Motive aus dem Heinsberger Land: Grüne Grenze zwischen Deutschland und den Niederlanden bei Wassenberg


Unten      —          MAISCHBERGER am 6. März 2019 in Köln. Produziert vom WDR. Thema der Sendung: „Attacke auf die Reichen: Beschimpfen, besteuern, enteignen?“ Foto: Ulrike Herrmann, Journalistin

Abgelegt unter Gesundheitspolitik, Innere Sicherheit, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Politik in der Pandemie

Erstellt von DL-Redaktion am 22. März 2020

Ausgangssperre? Keine gute Idee!

Kathrin Vogler 3.jpg

Quelle       :       Scharf  —  Links

Von Kathrin Vogler

Eine Woche nach Beginn der massivsten Einschränkungen des öffentlichen Lebens in der Geschichte der Bundesrepublik Deutschland soll nun morgen in einer Telefonschalte der Bundes- und Landesregierungen über eine flächendeckende Ausgangssperre beraten werden. Würde man mich fragen, würde ich davon abraten.

Vorab sei gesagt, dass ich die Corona-Pandemie für eine große Gefahr für die öffentliche Gesundheit halte und die bisherigen Maßnahmen wie die weitgehenden Versammlungs- und Veranstaltungsverbote, die Schließung von Kneipen, Restaurants, Cafés und Bars, Schulen und Kindergärten, die Besuchsverbote in Pflegeeinrichtungen und die Verlagerung von Millionen Jobs ins heimische Wohnzimmer für sinnvoll halte, um die schnelle Verbreitung des Virus einzudämmen und eine Überforderung des Gesundheitswesens zu verhindern. Auch die Aufforderung an die Menschen, zuhause zu bleiben, finde ich richtig und habe sie ebenfalls geteilt. Wer es aushalten kann, für den ist das eine perfekte Möglichkeit, sich selbst, seine Kontaktpersonen und vor allem besonders gefährdete Menschen vor einer Ansteckung zu schützen.

Aber es gibt wichtige Argumente gegen weitergehende Beschränkungen der persönlichen Freiheit: soziale, gesundheitliche und menschenrechtliche.

Fangen wir mit den Menschenrechten an. Beschränkungen der Freizügigkeit müssen verhältnismäßig sein. Es gibt keinen vernünftigen Grund anzunehmen, dass Menschen, die sich allein oder in der Familie draußen bewegen, einen erheblichen Beitrag zur Verbreitung von SARS-CoV2, dem neuen Coronavirus, leisten. Die bisherigen Hauptherde der Verbreitung waren stets Menschen, die sich bei Veranstaltungen in Innenräumen, wo viele Personen auf engstem Raum zusammenkommen, infiziert haben, ob in der Karnevalsfeier im Kreis Heinsberg oder beim Après Ski in Ischgl. Deswegen halte ich eine umfassende Ausgangsbeschränkung in der Freizeit, die Menschen etwa vom Spazierengehen oder Joggen abhält, nicht für angemessen.
Nach den ersten Tagen lässt sich übrigens bereits beobachten, wie hier an einem Werktag um 16 Uhr in Emsdetten, dass sich die allermeisten Menschen verantwortungsbewusst und vernünftig verhalten. Sie alle für das Verhalten Weniger in Haftung zu nehmen, halte ich auch nicht für verhältnismäßig.

Eine solche Beschränkung würde zudem die erhebliche soziale Ungleichheit in unserem Land verstärken. Während jemand, der in einer Villa mit Garten am Chiemsee lebt, sicher ein paar Wochen aushalten kann, ohne vom Grundstück zu gehen, braucht eine Hartz-IV-Empfängerin in einer Einzimmerwohnung im Münchener Hasenbergl die Möglichkeit, ihr tristes Appartement zu verlassen, nicht nur um einzukaufen, sondern einfach um frische Luft zu schnappen und etwas mehr als ihre vier Wände zu sehen. Wenn sie dann auch noch wegen „unerlaubtem Verlassen der Wohnung“ ein Bußgeld auferlegt bekäme, hätte das auch gesundheitliche Folgen. Die ohnehin prekäre Ernährung der ärmeren Schichten ist schon jetzt im Zuge der Coronakrise noch weiter beeinträchtigt, sowohl durch die Hamsterkäufe vor allem von billigen Lebensmitteln als auch durch die Schließung der Tafeln und Suppenküchen. Eine gesunde und ausgewogene Ernährung ist bereits mit dem vollen Hartz-VI-Regelsatz nicht möglich, auch deswegen nutzen viele Menschen die Tafeln und ähnliche Angebote. All diese Angebote stehen nun nicht mehr zur Verfügung.

Wenn nur noch Arbeiten und Einkaufen erlaubte Gründe sind, die Wohnung zu verlassen, werden die Menschen dann eben nur noch wenige Teile auf einmal besorgen und somit öfter als nötig in die Supermärkte gehen, wo die Ansteckungsgefahr deutlich höher ist als beim Gang „um den Block“. Mäßige Bewegung an der frischen Luft ist zudem, wie Studien belegt haben, ein wirksames Antidepressivum. Eingesperrt sein in der eigenen Wohnung erhöht die Gefahr von psychischen Erkrankungen. Wenig Bewegung verstärkt zum Beispiel Erkrankungen des Herz-Kreislaufsystems und des Bewegungsapparats, aber auch Diabetes und andere chronische Erkrankungen. Wir erkaufen also eine scheinbare Sicherheit vor COVID 19 mit anderen gesundheitlichen Beeinträchtigungen.

In gewalttätigen Beziehungen und Familien ist die Möglichkeit rauszugehen, vielleicht die Freundin zu besuchen und dort auch zu übernachten, ein einfaches Mittel, um Aggressionen ins Leere laufen zu lassen. Gerade für Kinder, die ja auch gerade nicht zur Schule dürfen, hätte das Eingesperrtsein mit den Eltern auf engstem Raum schlimme Auswirkungen, die möglicherweise noch Folgen hat, wenn die Virus-Pandemie längst überwunden ist. Man stelle sich nur vor, zwei Erwachsene und zwei pubertierende Jugendliche, die 7 Tage in der Woche 24 Stunden lang auf engstem Raum aufeinander hocken. Wollen wir das den Menschen wirklich zumuten?

Coronavirus an déi Jonk.jpg

Noch ein Gedanke zum Schluss: Die Verteidigungsministerin hat bereits angekündigt, dass sich die Bundeswehr an der „Aufrechterhaltung von Sicherheit und Ordnung“ beteiligen könnte. Dieses Ansinnen kann man nur schärfstens zurückweisen. Militär, Polizei und Ordnungsbehörden sind aus guten Gründen in Deutschland strengstens getrennt. Die Bundeswehr hat hier nicht nur keine Aufgabe, sie wird auch nicht benötigt. Stattdessen sollte die Bundesregierung lieber schleunigst ihre Aufrüstungspläne korrigieren und das Geld stattdessen in den Ausbau des Gesundheitswesens, in die Stärkung des öffentlichen Gesundheitsdienstes, des Rettungswesens und der zivilen Institutionen des Katastrophenschutzes investieren.

Die Coronakrise zeigt uns nicht nur, welche Jobs wirklich systemrelevant sind, sondern legt auch einen anderen Sicherheitsbegriff nahe. Was die Menschen brauchen, ist eine umfassende, gute Daseinsvorsorge und ein soziales Netz, das auch in Krisen auffängt.

Katrin Vogler auf FB

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen      :

Oben      —        Kathrin Vogler. Foto: Niels Holger Schmidt


Unten          —              Comic telling the youth in Luxembourgish to prevent the COVID-19 from spreading by washing their hands on a regular basis.

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Sozialpolitik, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 15. März 2020

und sonstige Verbeugungen vor dem politischen Gegner

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–016.jpg

Quelle :         AKL

Dieser Kommentar von Thies Gleiss, Mitglied im Parteivorstand von DIE LINKE und im Bundessprecher*innenrat der AKL, wurde von der Tageszeitung Junge Welt aufgegriffen. Wir haben diesen Artikel hier dokumentiert.

Seit zehn Jahren sind die addierten Umfragewerte für SPD, GRÜNE und LINKE erstmals wieder im Bereich einer parlamentarischen Mehrheit, und schon werden alle Seiten nervös: Die bürgerlichen Leitmedien malen ein Schreckensbild der LINKEN, die erschießen und ins Arbeitslager stecken würde, ohne auch nur ein Anstandsminimum an Wahrhaftigkeit zu wahren. Auf der anderen Seite beeilen sich die in parlamentarischer Einsamkeit und Verblödung erstarrten Spitzenparlamentarier der LINKEN sich für alles und jeden zu „entschuldigen“.

Diese Entschuldigungs- und Distanzierungsorgie durch prominente LINKE ist völlig ohne Sinn und Begründung von statten gegangen und ist allein dem Wunsch entsprungen, sich noch einmal mehr den herrschenden Verhältnissen anzupassen und unterzuordnen.

Die irrste Entschuldigung ist, sich für die Mauertoten in der DDR zu entschuldigen, wie es die Parteivorsitzende Katja Kipping getan hat.

Die DDR hat ja nun wirklich nicht 1 Prozent der Reichen und Unternehmer erschossen, sondern das Feuer auf einfache Bürgerinnen und Bürger des Landes eröffnet, die die Frechheit besaßen, die Landesgrenze überschreiten zu wollen.

Diese Hinrichtungen waren schwerste Verbrechen. Sie reihen sich aber in unendlich viel mehr und schlimmere Mordtaten des kapitalistischen Systems überall in der Welt ein.

Ein Sonderfall ist dabei noch der beim Marsch durch die Institutionen am Ziel angelangte Ministerpräsident von Thüringen Bodo Ramelow. Ihn holt sein selbst erzeugtes Getue als Staatsmann und über allen Parteien stehender Landesvater zurzeit selbst ein. Zum Schrecken der gesamten Partei verhilft er der AfD zu einem Vize-Landtagspräsidentenamt und verschiebt das Parité-Gesetz zur Quotierung der Parteilisten aus Furcht, die AfD könne erfolgreich dagegen klagen.

Selbstmord aus Angst vor dem Tod – wie schon häufig in der Geschichte der LINKEN, hier aber ziemlich derbe.

akl - Antikapitalistische Linke

Grafikquelle       :       Bundesparteitag Die Linke 2018 in Leipzig

Abgelegt unter Berlin, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Linker Kampagnen Streit

Erstellt von DL-Redaktion am 14. März 2020

Auf Zuruf gesprungen


Quelle       :     AKL

von Kristian Stemmler,

dieser Text ist in der Jungen Welt erschienen und wird hier dokumentiert.

Linke streitet über Reaktion auf Kampagne nach Strategiekonferenz. Kritik an Thüringer Ministerpräsidenten Ramelow wegen Wahl von AfD-Landtagsvize.

Die Strategiekonferenz der Partei Die Linke am vorletzten Wochenende hat tatsächlich eine innerparteiliche Debatte ausgelöst – nur etwas anders als geplant. Eine von rechten Medien losgetretene und von der FDP in der Form einer Aktuellen Stunde in den Bundestag getragene Kampagne nach dem verunglückten Redebeitrag einer Teilnehmerin der Strategiekonferenz (jW berichtete) wird, das zeigte sich in den vergangenen Tagen, genutzt, um Koparteichef Bernd Riexinger anzuzählen.

Auch in der Bundestagsfraktion der Partei wird darüber seit Ende vergangener Woche intern gestritten. Das legt eine fraktionsinterne Mail vom Donnerstag abend nahe, die jW vorliegt. Darin übt die Bundestagsabgeordnete Sabine Leidig scharfe Kritik am Verhalten der Fraktionsführung. Diese sei »unverzüglich über das Stöckchen gesprungen, das die Rechten hinhalten«, und habe dabei »die Gelegenheit genutzt, innerparteiliche Konkurrenzen auszuleben und dem ungeliebten Parteivorsitzenden noch eins mitzugeben«. Leidig sandte die Mail an alle Angehörigen der Fraktion und adressierte sie namentlich an die Fraktionschefs Amira Mohamed Ali und Dietmar Bartsch, Fraktionsvize Sevim Dagdelen und den parlamentarischen Geschäftsführer Jan Korte.


Hintergrund der Kritik ist die Auseinandersetzung um die Bemerkung einer Teilnehmerin der Konferenz in Kassel, die in offensichtlich ironisch gemeintem Tonfall davon gesprochen hatte, dass bei einer Revolution »Reiche« erschossen würden. Riexinger, der auf dem Podium saß, hatte versucht, den geschmacklosen Witz mit der Entgegnung einzufangen: »Wir erschießen sie nicht, wir setzen sie schon für nützliche Arbeit ein.« Mohamed Ali und Bartsch hatten in einer gemeinsamen Erklärung in der Welt formuliert, diese Äußerung hätte »nicht lächelnd übergangen werden dürfen«. Wer Menschen erschießen wolle oder »Späße über Zwangsarbeit« mache, verlasse den »gemeinsamen Wertekanon«.

Mit diesem Statement hätten Bartsch und Mohamed Ali »die Empörungswelle bedient«, schreibt Leidig in ihrer Mail. Sie verweist darauf, dass ein Videoschnipsel des Redebeitrags zuerst in einem rechten Internetportal veröffentlicht worden sei. Etwas später folgte »die Springer-Presse mitsamt Bild-Aufmacher«. Statt diese Kampagne zurückzuweisen, wie es etwa die innenpolitische Sprecherin der Fraktion, Ulla Jelpke, getan habe, hätten führende Genossen »nachgetreten«, so Leidig weiter. »Demonstrativer konnten Entsolidarisierung unter Linken und Anpassung kaum zum Ausdruck gebracht werden«, schreibt die Abgeordnete. Das Verhalten der Fraktionsspitze stoße sie ab, »und da bin ich nicht die einzige«.

Thies Gleiss, Mitglied im Bundesvorstand der Partei und Sprecher der Parteiströmung Antikapitalistische Linke, kritisierte den Vorgang ebenfalls scharf. Er sprach am Montag gegenüber jW von »in parlamentarischer Einsamkeit und Verblödung erstarrten Spitzenpalamentariern« und von einer »Entschuldigungs- und Distanzierungsorgie« prominenter Parteivertreter, die einmal mehr dem Wunsch entsprungen sei, »sich den herrschenden Verhältnissen anzupassen«. Gleiss stellte eine Verbindung zum demoskopischen Höhenflug des »rot-rot-grünen Lagers« her. Seit zehn Jahren lägen die addierten Werte von Die Linke, SPD und Bündnis 90/Die Grünen erstmals wieder knapp im Bereich einer parlamentarischen Mehrheit – »und schon werden alle nervös«.

»Am irrsten« sei es, sich angesichts dieser Kampagne auch gleich wieder unaufgefordert für die »Mauertoten« zu entschuldigen, sagte Gleiss. Damit bezog er sich auf den Redebeitrag von Parteichefin Katja Kipping am Freitag im Bundestag. Die Linke-Politikerin erklärte, die »Mauertoten und das SED-Unrecht« seien »unsere historische Bürde«. Dann nahm sie Haltung an und sagte: »Deshalb bitte ich heute erneut im Namen der Linken alle, die unter der Mauer gelitten haben, um Entschuldigung.«

Referenzrahmen Bild

Über die Abläufe in der Politik zu lachen wäre einfacher !  Nur Idioten glauben sie wären wichtig.

Es blieb erstaunlicherweise dem SPD-Abgeordneten Helge Lindh überlassen, in der Aktuellen Stunde ein wenig von dem zu sagen, was von der Linksfraktion hätte kommen können. Auch er bezeichnete die Äußerungen in Kassel als inakzeptabel. »Noch unerträglicher« sei es aber, »daraus eine politische Inszenierung zu machen«. Damit werde »die Bild-Zeitung zu unserem Referenzrahmen und der AfD-Kosmos zu unserem Resonanzraum«. Wenn etwas in den Tagen nach den rassistischen Morden in Hanau Thema einer Aktuellen Stunde hätte sein müssen, so Lindh, dann seien das unter anderem die Morde des »NSU«. Im »AfD-Kosmos« drehte am Freitag der eine oder andere frei. Der AfD-Abgeordnete Stephan Brandner kassierte einen Ordnungsruf für die Bemerkung, auf der Linken des Bundestags säßen »die einzigen Nazis in diesem Haus«.

Um so peinlicher wirkt es, dass der Thüringer Ministerpräsident Bodo Ramelow (Die Linke) kurz zuvor im Landtag in Erfurt einen AfD-Kandidaten zum Landtagsvizepräsidenten wählte – als einziger in seiner Fraktion. Dafür gab es am Wochenende und am Montag Kritik aus der gesamten Partei. Ellen Brombacher von der Kommunistischen Plattform (KPF) bezeichnete Ramelows Verhalten in einer vom Bundeskoordinierungsrat der KPF gebilligten Mail an die Thüringer Landeschefin der Linkspartei, Susanne Hennig-Wellsow, als »einfach nur schäbig«: »Und der regt sich über Bernd Riexinger auf, der einen taktischen Fehler gemacht hat. Die Bigotterie ist unerträglich.« Die Antikapitalistische Linke Nordrhein-Westfalen bezeichnete Ramelows Verhalten als »Schlag ins Gesicht« für alle, die gegen die Wahl von Thomas Kemmerich (FDP) mit AfD-Stimmen demonstriert haben. Der geschäftsführende Bundesvorstand der Linkspartei kritisierte Ramelow in einer Erklärung vom Samstag ebenfalls, allerdings wesentlich milder. Man halte sein Verhalten für »falsch«, hieß es lapidar.

akl - Antikapitalistische Linke


Grafikquelle      :

Oben     —    Sabine Leidig of the german leftist party


Unten      —          DL/Redaktion/UP – Wikimedia Commons, CC-BY-SA 3.0

Abgelegt unter Nordrhein-Westfalen, Opposition, P. DIE LINKE, Überregional | 1 Kommentar »

EU verrät Menschenwürde

Erstellt von DL-Redaktion am 4. März 2020

Inhumane, unsolidarische
Schlussfolgerung: „2015 darf sich nicht wiederholen.“


Was die Richter begriffen, scheint in der Politik noch unverständlich zu sein!

Quelle      :         Scharf   —    Links

Kommentar von Edith Bartelmus-Scholich

Die Bundestagsabgeordnete Sevim Dagdelen (Die Linke) hat heute in einem NTV-Gespräch ihre Einschätzung zur Lage in Syrien und der Rolle der Türkei in dem Konflikt dargelegt. Sie hat dabei eine außenpolitische Analyse geliefert, die Zustimmung verdient. Richtig ist, dass Erdogans Angriffskrieg und seine erpresserischen Bemühungen um  weiter gehende Unterstützung der EU von uns zurückgewiesen werden müssen. Der Konflikt in Syrien muss dringend befriedet werden und der betroffenen Bevölkerung muss ohne Vorbehalte humanitäre Hilfe zuteilwerden.

Dann jedoch hat Sevim Dagdelen den Geflüchteten, die in vielen Fällen mit ihren Kindern an der griechischen Grenze gestrandet sind eine kaltherzige Abfuhr erteilt. Auf diese Menschen angesprochen empfiehlt sie ausdrücklich, Deutschland solle sie nicht aufnehmen. Wörtlich sagt sie: „2015 darf sich nicht wiederholen.“ (1) Ihre Empfehlungen zum Umgang mit dem Flüchtlingselend an der griechischen Grenze decken sich in diesem Punkt mit den Vorstellungen aller bürgerlichen Parteien.

Sie rät lediglich ganz pauschal Fluchtursachen zu bekämpfen und humanitäre Hilfe zu leisten, obwohl offensichtlich ist, dass diese Empfehlungen den Menschen an der griechischen Grenze überhaupt nicht helfen. Offenbar ist sie bereit deren Elend in Kauf zu nehmen um ein politisches Ziel zu erreichen, nämlich Erdogans Erpressung abzuwehren.

Gleichzeitig zeigt sie, dass sie zur politischen Bekämpfung der rechten und faschistischen Kräfte nicht die passenden Mittel findet. Die Rechte wird sicher gestärkt, wenn selbst eine linke Politikerin die Forderungen der AfD übernimmt und sich somit dem rechtspopulistischen Diskurs unterordnet.

In ihrer Partei reißt Sevim Dagdelen mit diesem Interview alte Gräben, die nach dem Streit mit Sahra Wagenknecht zur Flüchtlingspolitik mühsam mit Formelkompromissen zugeschüttet wurden, wieder auf.

Erst am Sonntag trafen sich 400 führende Mitglieder der Partei DIE LINKE. in Kassel zu einer Strategiekonferenz. Zur aktuellen Lage an der griechischen Grenze brachte Melanie Schmidt-Krobok aus NRW einen Antrag ein, der mit großer Zustimmung von den Anwesenden per Akklamation angenommen wurde:

„Die türkische Regierung versucht den Druck auf die europäischen NATO-Partner zu erhöhen um militärische Unterstützung im Syrien-Krieg zu erzwingen, indem sie die Grenzen zu Griechenland öffnet. Die Situation von Menschen auf der Flucht wird für machtpolitische Zwecke missbraucht. An der Landgrenze stecken Flüchtende im Niemandsland fest und werden mit Tränengas und Gewalt an der Einreise nach Griechenland gehindert. Die Ägäis wird ein rechtsfreier Raum, in dem das Recht auf Leben zur Verhandlungsmasse verkommt. Der EU-Deal mit Erdogan war ein Fehler, denn Menschenleben sind kein Deal. Wir fordern das Öffnen der Grenze nach Griechenland und die Aufnahme der Menschen in Deutschland. Wir brauchen ein solidarisches Europa anstelle einer militaristischen Festung.“

Sevim Dagdelen ist damit sehr weit von der Position der Partei DIE LINKE. entfernt. Das irritierende Moment, dass ihre abweichende Position mediale Verbreitung erfährt, erfordert eine öffentliche Stellungnahme und Richtigstellung von Parteiführung und Fraktionsspitze. DIE LINKE. muss auch zukünftig in der Öffentlichkeit als Streiterin für unteilbare Solidarität wahrgenommen werden.

Edith Bartelmus-Scholich, 2.3.2020


Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen      :

Oben        —       Art. 1, Satz 1, des Grundgesetzes der Bundesrepublik Deutschland, am Landgericht in Ffm.

Author Dontworry

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.


Unten       —     Wandgemälde im Frankfurter Osthafen nach Vorbild des veröffentlichten Bildmaterials (2016)

Abgelegt unter Kommentar, Kultur, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Hanau und die Verursacher

Erstellt von DL-Redaktion am 22. Februar 2020

„Die Stichwortgeber für das Massaker von Hanau sitzen auch in den Parlamenten“


Ganz richtig – aber aus allen Parteien und werden von diesen entsprechend auf Listen platziert !

Quellen     :       AKL

Von Ulla Jelpke

„Das faschistische Massaker in Hanau erfüllt mich mit Trauer und Wut. Den Angehörigen und Freunden der Opfer gilt mein tiefempfundenes Beileid. Die Stichwortgeber für solche rassistisch motivierten Terroranschläge sitzen auch in den Parlamenten. Es sind diejenigen Politiker der AfD, die beständig von der angeblichen ‚Islamisierung Deutschlands‘, von ‚Überfremdung‘, vom ‚großen Austausch‘ schwadronieren. Es sind diejenigen Politiker, die ganze migrantische Bevölkerungsgruppen und Treffunkte wie Shisha-Bars stigmatisieren“, erklärt die innenpolitische Sprecherin der Fraktion DIE LINKE Ulla Jelpke zu den tödlichen Schüssen auf Besucher zweier Shisha-Bars in Hanau. Die Abgeordnete weiter:

„Knapp eine Woche nachdem eine faschistische Terrorzelle ausgehoben wurde, die mit Anschlägen auf Moscheen einen Bürgerkrieg provozieren wollte, massakriert ein Neofaschist in Hanau zehn Menschen. Das sind die Konsequenzen von jahrzehntelang ignorierten, verharmlosten oder sogar von staatlichen Stellen gedeckten und geförderten faschistischen Strukturen. Gerade Hessen weist hier eine unheilvolle Linie vom NSU-Mord an Halit Yozgat und der fragwürdigen Rolle eines Verfassungsschutzagenten über Nazizellen in der Polizei, rassistischen Drohbriefen eines NSU 2.0 bis zum Nazi-Mord am CDU-Politiker Walter Lübcke und den jüngsten Anschlägen auf. Jetzt muss endlich Schluss sein mit dem weiteren Verharmlosen, Vertuschen und dem Gerede von Einzelfällen. Faschistische Strukturen in Gesellschaft und Staat müssen restlos aufgedeckt und zerschlagen werden.“

Veröffentlicht zuerst auf am

akl - Antikapitalistische Linke


Grafikquelle      :      Ulla Jelpke, GAL, Bürgerschaftsabgeordnete, auf Friedensdemonstration in Hamburg 1983

Abgelegt unter Berlin, Bundestag, Nordrhein-Westfalen, P. DIE LINKE | Keine Kommentare »

Der Primat von Colonia

Erstellt von DL-Redaktion am 20. Februar 2020

–  schwebt auf der aller höchsten Wolke

Zeigung des Treueeides.jpg

Spätesten dann  – wenn es ums Geld geht – wird Religion politisch.

Quelle       :      Scharf  —  Links

Ein Kommentar von Georg Korfmacher, München

Nach der Ankündigung, für das Amt des Vorsitzes der deutschen Bischofskonferenz nicht mehr zu kandidieren, hat der Primat von der Isar – warum auch immer – ein Vakuum erzeugt. Nach der Ankündigung tauchen tiefe Risse mehr den je auf, und mögliche Anhänger marx’scher Gesinnung werden sich tunlichst zurückhalten, und am „synodalen Weg“ wird wohl bald ein Schild hängen: Durchgang verboten. Alldieweil schwebt der Primat von Colonia nun auf der allerhöchsten Wolke. Es war schon immer gegen die marx’schen Ideen und Initiativen, ohne zu realisieren, auf welch kleinem Wölkchen er da eigentlich unterwegs ist, während die Gläubigen zuhauf davonlaufen.

Heute schauen viele mit Erstaunen, Unwillen oder Empörung auf das total autoritäre System in China und sehen nicht, dass die Catholica seit 2000 Jahren noch autoritärer ihre Gläubigen (ebenso wie die Nichtgläubigen) zu beherrschen sucht. Nihil nec bene über den Papst als Vertreter des dreifachen Gottes der Catholica auf Erden, kein Kommentar, wenn ein Priester (in den USA) Gläubigen, die für eine Anerkennung der Homosexualität sind, die Sakramente verweigert und gleichzeitig die Meinung vertritt, dass sexueller Missbrauch von Minderjährigen durch Kleriker ja nicht tödlich sei, also quantité négligeable ist.

Keine Demokratie (wird vom Vatikan strikt abgelehnt), keine Frauenrechte (die Frau sei dem Manne untertan), ja gar keine Menschenrechte (die Menschenrechts-Konvention von 1948 ist bis heute vom Vatikan nicht ratifiziert), keine Gewaltenteilung (alle Macht ist in der Hand des unfehlbaren Vertreters Gottes auf Erden), ja nicht einmal Respekt vor dem geltenden Recht und Gesetz, das laut GG für alle gilt (siehe die Handhabung der Missbrauchsfälle durch die Catholica). In einer normalen Gesellschaft heute würde man solche Zustände als chaotisch bezeichnen bzw. als untragbar und unhaltbar.

Warum, fragt man sich, regen sich da Säkulare und Humanisten auf. Glaube ist schließlich Privatsache. Sehr wohl, aber eben nur solange er Rechte anderer nicht schädigt. Und da gibt es einen massiven Grund für Verärgerung. Der ganze Hokuspokus der Catholica wird nämlich weitgehend aus öffentlichen Steuermitteln finanziert. Und dies nicht aufgrund eines demokratischen Konsenses unserer heutigen Republik nach dem Dritten Reich, sondern auf Grundlage des Konkordats zwischen Hitler und der Catholica von 1933. Honi soir qui mal y pense! Pfui Daifi, würde da ein Bayer schimpfen. Und doch ist es unglaubliche Wahrheit in unserer Demokratie. Die Catholica liefert täglich Argumente, warum und dass dieser Zustand endlich bereinigt werden muss. Packen wir’s an, wir schaffen das!

Bei dieser Wetterlage sollte sich also der Primat von Colonia auf seinem Wölkchen nicht so sicher fühlen. Irgendwann platzt auch den geduldigsten Bundesbürger*innen der Kragen ob solcher Widrigkeiten. Nach einem klärenden Gewitter scheint dann hoffentlich bald die Sonne für alle. Geistig frei, selbstverantwortlich und in Harmonie mit den Menschenrechten, weltweit.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle        :        Besuch anlässlich der Abnahme des Treueeides von Rainer Maria Kardinal Woelki als neuer Erzbischof von Köln und Eintrag in das Gästebuch der Landesregierung in der Staatskanzlei NRW

Abgelegt unter Bayern, Köln, Religionen, Überregional | Keine Kommentare »

Ein Evangelikaler Prediger:

Erstellt von DL-Redaktion am 16. Februar 2020

Kölle, wie es hasst und bebt

Billy Graham.JPG

Wie der Vater – so der Sohn

Von Eliane Morand

m 20. Juni 2020 soll in Köln das „Festival of Hope“ in einer großen Mehrzweckhalle stattfinden. Das Festival wird von der Billy Graham Evangelistic Association organisiert. Das Ziel ist: „den Menschen die Liebe Gottes zu verkünden, die Jesus Christus brauchen“. So steht es auf der Website. Der Hauptredner ist Franklin Graham, Präsident der Evangelistic Association und ein umstrittener Prediger aus den USA.

In der Vergangenheit geriet Franklin Graham, Sohn des Predigers Billy Graham, oft in die Kritik wegen rassistischer, queer- und islamfeindlicher sowie homophober Aussagen. Über den Präsidentschaftskandidaten der US-Demokraten, Pete Buttigieg, der in einer gleichgeschlechtlichen Ehe lebt, schrieb er vergangenes Jahr auf Twitter: „Als Christ glaube ich der Bibel, die Homosexualität als Sünde definiert, als etwas, das man bereuen muss, und nicht als etwas, das man zur Schau stellt, lobt oder politisiert.“

In Großbritannien wurden nach Protesten von LGBTQ+-Aktivist*innen alle öffentlichen Auftritte des Predigers abgesagt. In einem Interview mit dem Guardian äußerte sich Graham erbost: „Wir werden wegen unserer religiösen Überzeugungen und unseres Glaubens verleugnet.“

Nun fordert auch „Die Urbane“ den Veranstalter Lanxess-Arena auf, den Kölner Auftritt des Predigers abzusagen. Die Partei mit Sitz in Berlin engagiert sich für Menschen, die „keine Repräsentanz erfahren“, erklärt Generalsekretär Fabian Blume. Seine Kollegin Niki Drakos, Bundesvorsitzende der Partei, hat deshalb eine Petition erstellt. Dass man so eine Veranstaltung zulasse, greife die Grund- und Menschenrechte an, findet sie.

-USAxAUS (48775143398).jpg

Die taz hat den Veranstalter mit der Kritik konfrontiert. Ein Sprecher antwortet per Mail: Das „Festival of Hope“ sei als christliches Format gebucht worden, damit gehe ein offener Umgang mit christlichen Werten und dem hohen Gut der Glaubens- und Religionsfreiheit einher. „Uns ist bewusst, dass dieses Veranstaltungsformat auch kritisch gesehen wird“, schreibt er. Zur Petition selbst will der Veranstalter sich nicht äußern.

Die taz fragte auch bei den Festival-Organi­sa­tor*in­nen nach und bekam eine Stellungnahme von Graham selbst zurück: „Ich predige nie über Politik – ich bringe eine Botschaft über Gottes Liebe aus der Bibel.“

Quelle       :      TAZ         >>>>>          weiterlesen


Grafikquellen        :

Oben          —       Franklin and Billy Graham, in Cleveland Stadium, in Cleveland Ohio, in June 1994

Abgelegt unter Amerika, Köln, Religionen, Überregional | Keine Kommentare »

„Recht auf Leben bedroht“

Erstellt von DL-Redaktion am 14. Februar 2020

„Erste Maßstäbe für Klimaflüchtlinge“

File:Street Children & Dog - Kolkata 2012-01-28 00988.jpg 

Ein Interview von Christian Rath mit Andreas Zimmermann

Abschiebungen in Klimawandelländer sind wie Abschiebungen in Bürgerkriegsländer. Das sagt Andreas Zimmermann vom UN-Menschenrechtsausschuss.

taz: Herr Zimmermann, der UN-Menschenrechtsausschuss hat sich vor Kurzem mit dem Schutz von Klimaflüchtlingen beschäftigt. Sie sind Mitglied in diesem Ausschuss. Was wurde beschlossen?

Andreas Zimmermann: Wir haben festgestellt, dass Staaten niemanden in Gebiete abschieben dürfen, in denen der Klimawandel das Recht auf Leben bedroht.

Was war das für ein Fall?

Ioane Teitiota vom Inselstaat Kiribati reiste 2007 mit seiner Frau nach Neuseeland ein. 2010 endete sein Aufenthaltsrecht. Anschließend beantragte er in Neuseeland Asyl wegen der Folgen des Klimawandels für die Pazifikinsel, die teilweise nur zwei Meter über dem Meeresspiegel liegt. Die neuseeländischen Behörden und Gerichte lehnten den Asylantrag ab. 2015 wurde Teitiota nach Kiribati abgeschoben.

Sah der Ausschuss die Rechte von Herrn Teitiota verletzt?

Nein, im konkreten Fall haben wir keine Verletzung des Rechts auf Leben festgestellt. Der UN-Menschenrechtsausschuss hat festgestellt, dass die neuseeländischen Stellen sein Anliegen ausreichend gründlich und sorgfältig untersucht haben.

Der Ausschuss prüfte also nur, ob Behörden und Gerichte in Neuseeland sich ausreichend mit der Situation in Kiribati auseinandergesetzt haben?

Ja, wir prüfen, ob die Entscheidung eines Staates willkürlich ist oder eine Rechtsverweigerung darstellt. Das war hier nicht der Fall.

Der UN-Menschenrechtsausschuss bezeichnete seine Entscheidung in einer eigenen Pressemitteilung als „historisch“. Warum?

Weil sich der Ausschuss erstmals mit dem Fall eines Klimaflüchtlings beschäftigte und dabei Maßstäbe aufgestellt hat, die in künftigen Fällen auch zu anderen Ergebnissen führen können. Relevant ist für unsere Prüfung immer der Zeitpunkt der letzten nationalen Entscheidung, hier also das Jahr 2015. In einigen Jahren kann die Situation in Kiribati und ähnlichen Staaten anders aussehen.

Kommt es darauf an, dass Kiribati bereits unter Wasser steht?

Nein, auch das ist ein wichtiger Aspekt unserer Entscheidung. Das Recht auf Leben kann bereits verletzt sein, bevor sich die Risiken des Klimawandels realisiert haben. Eine Abschiebung ist nicht erst dann ausgeschlossen, wenn der Bevölkerung im Zielland das Wasser bis zum Hals steht.

Wie weit im Vorfeld der Katastrophe beginnt der völkerrechtliche Schutz? Gibt es eine Faustformel?

Nein. Dazu ist die Bedrohung zu komplex. Es geht ja nicht nur um das Ansteigen des Meeresspiegels. Der Klimawandel führt auch zur Zunahme extremer Wetterereignisse wie Stürmen, Tsunamis und Dürren. Herr Teitiota hat zudem geltend gemacht, dass in Kiribati die Fläche des bebaubaren Lands abnimmt und sich deshalb blutige Landkonflikte häufen. Auch solche sozialen Verwerfungen sind zu berücksichtigen.

Auf der anderen Seite hat die Regierung von Kiribati bereits Land auf einer Nachbarinsel gekauft, die zu den Fidschis gehört. Dorthin könnten Teile der rund 100.000 Kiribater notfalls umgesiedelt werden.

Auch Schutzmaßnahmen der Regierungen sind zu berücksichtigen, etwa eine Erhöhung der Deiche oder Umsiedlungen. Gerade weil die Lage so komplex ist, können wir nur kontrollieren, ob sich die nationalen Stellen seriös mit den drohenden Risiken bei einer Abschiebung auseinandergesetzt haben.

Quelle     :         TAZ          >>>>>          weiterlesen

Wir retten die Welt

Mutti Erde und drei Ökoschweinchen

Catrinas - Day of the Dead Ladies.jpg

Von Bernhard Pötter

Sabine war eine deutliche Warnung: Das Sturmtief verhinderte am Montag, dass Armin Laschet nach Berlin zur CDU-Sitzung kam. Da rächte sich der Wind an dem Landesvater, der in NRW die Windkraft abgewürgt und die Braunkohle gepäppelt hat. „Der nicht!“, war der klare Appell der Natur. Friedrich Merz hat den Investmentriesen Blackrock gerade verlassen, als dieser sich zum Umweltinvestor erklärte. Auch ihn wird Mutti Erde nicht als CDU-Chef zulassen, sondern im Privatflugzeug per Wirbelsturm zur Landung zwingen. Und sollte Jens Spahn, mehr so der heimliche Umweltfreak, Oberchristdemokrat werden, werden wohl gewaltige Waldbrände Westfalen verwüsten.

Keiner der drei hat erkennen lassen, wie er die „Menschheitsherausforderung Klimawandel“ (A. Merkel) meistern will. Da kann sich die Partei im Vormerz eine so lasche Packung auch gleich spahn. Schließlich gibt es selbst unter CDUlern Menschen, die bei „Klima“ nicht zuerst an die Sitzheizung im BMW X7 denken. Die also viel eher Parteichef und KanzlerIn werden sollten als das Trio Ignorale aus dem Kohleland.

Da ist Daniel Günther, der sein Nordland schon jetzt mit 70 Prozent Ökostrom befeuert; da ist Tobias Hans, der im Saarland die charmante Lüge auftischt, dass die „Bewahrung der Schöpfung zur DNA der CDU gehört“. Da sind Peter Altmaier und Norbert Röttgen, die als Ex-Umweltminister immerhin den Schuss gehört haben. Und da ist der leider kaltgestellte Umweltfachmann Andreas Jung, dessen Heimatstadt Konstanz beim Klimanotstand ganz vorn dabei ist. Oder Ursula Heinen-Esser, Umweltministerin von (tja) NRW-Laschet, eine Fachfrau und Brückenbauerin, nicht nur über den Rhein. Und natürlich ist da the Godfather of the Green Blacks himself, Klaus Töpfer, der seiner Christen­union die Lebensstil-Leviten um die Ohren haut wie sonst nur Papst Franziskus.

Quelle       :          TAZ           >>>>>         weiterlesen


Grafikquellen       :

Oben        —           Photographed at the footpath of Chowringhee road near Exide crossing, Kolkata.

Author Biswarup Ganguly
This file is licensed under the Creative Commons Attribution 3.0 Unported license.


2.) von Oben       —    Jesidische Flüchtlinge erhalten in einem Lager Unterstützung vom International Rescue Committee


Unten      —         Catrinas – Day of the Dead Ladies

Abgelegt unter Flucht und Zuwanderung, Nordrhein-Westfalen, P.CDU / CSU, Regierungs - Werte | Keine Kommentare »

Letzte Ausfahrt vor Polen

Erstellt von DL-Redaktion am 9. Februar 2020

Penkun – eine Kleinstadt in Mecklenburg-Vorpommern 

Penkun - OE SW.jpg

Aus Penkun Gesa Steeger

– kämpft um ihre Schule und um ihr Bestehen. Soll man Orte wie Penkun fördern oder aufgeben? Während darüber noch gestritten wird, machen die Penkuner einfach weiter.

In der Stadt Penkun ist es so: Es sind nicht mehr so viele da, aber weitergehen muss es trotzdem. Das Schloss braucht einen neuen Investor, die Alten den kleinen Laden am Marktplatz, den sie hier immer noch Konsum nennen. Und was wäre eine Stadt ohne Schule?

Nix. Ohne Schule wär der Ort tot, sagt Bernd Netzel. Schließe die Schule, dann gehe „der Rest auch hopp“. Zuerst die Familien, dann der Konsum, der Bäcker und schließlich die Vereine. Netzel schaut aus dem Fenster seines Büros. Drüben steht ein brauner Klotz, mit grauem Dach und ein paar Bäumchen im Hof. Das ist die Regionalschule, 5. bis 10. Klasse. Netzels Sorgenkind.

29 Jahre war Bernd Netzel Bürgermeister (FDP) von Penkun, ehrenamtlich, seit der Wende bis hinein in den letzten Sommer. Jahre, in denen Netzels Bürstenhaarschnitt grau wurde und die Stadt sich leerte. In denen er sich für den Erhalt der Schule abmühte. Vielleicht vergeblich.

Rund 100 Schüler besuchen die sieben Klassen der Regionalschule, eigentlich zu wenig. Seit Jahren erteilt das Land immer wieder Ausnahmeregelungen, damit hier der Unterricht stattfinden kann. Das Dach ist undicht, die Fenster ebenso. Die Klassenzimmer tragen die Patina der 1960er Jahre. Es riecht nach alten Gardinen. Neu sind hier nur die neonfarbenen Turnschuhe der Kinder.

Eine Sanierung würde mehrere Millionen Euro kosten. Geld, das die Stadt nicht hat. Geld, das vom Land und vom Bund kommen müsste. Mehrere Millio­nen für die Rettung einer Schule und einer Stadt im Nirgendwo. Lohnt das?

Die letzte Ausfahrt vor Polen, das ist Penkun. Aus der Ferne erinnert die Stadt an eine einsame Insel, die es irgendwie in den äußersten Osten Mecklenburg-Vorpommerns verschlagen hat. Drei Seen, in der Mitte eine Kleinstadt. Rund 1.700 Menschen leben hier, zählt man die vier nahen Dörfer dazu; früher waren es mal fast doppelt so viele. Vor der Wende. In 30 Minuten ist man mit dem Auto in Stettin. Nach Schwerin, der Landeshauptstadt, sind es knapp drei Stunden. Der nächste Bahnhof ist zehn Kilometer entfernt. Alles scheint hier weit weg zu sein, versteckt hinter braunen Winterfeldern und Nadelwald.

In Studien zur ländlichen Raumentwicklung tauchen Orte wie Penkun oft dort auf, wo es um abgehängte Regionen geht. Meist liegen diese im Osten von Deutschland, irgendwo abseits der Autobahn. Gemeinsam ist ihnen nicht nur die Örtlichkeit, sondern auch die Umgebung. Plattes Land, viel Platz. Und die Gesamtlage: Strukturschwach ist ein Wort, das diesen Regionen anheftet wie ein unliebsames Etikett, das man auch nach viel Rubbeln nicht loswird.

Das Berlin-Institut für Bevölkerung und Entwicklung hat berechnet, dass bis 2035 vermutlich nur noch 1,4 Millionen Menschen in Mecklenburg-Vorpommern leben werden. Rund 500.000 weniger als zu Wendezeiten.

Penkun Werner-von-der-Schulenburg-Str.JPG

Eine weitere Studie der Forscher zeigt: Wo Menschen verschwinden, da gerät die Grundversorgung ins Rutschen. Wo niemand lebt, investiert auch keiner. Zurück bleibt die Randlage. Schon heute sind die Menschen in diesen Regionen rund drei Jahre älter als in den Städten. Die Einkommen niedriger, die Busse fahren seltener bis gar nicht. Die Schulwege sind weiter und die Menschen öfter ohne Job. Was also tun mit diesen Orten?

Unwirtschaftliche Regionen müsse man finanziell aufgeben, riet jüngst eine Studie des Leibniz-Instituts für Wirtschaftsforschung Halle, und dort investieren, wo es sich lohnt: in den Zentren, den Städten. Schwerin, nicht Penkun.

„Die Politik und die Öffentlichkeit müssen akzeptieren, dass es gerade die Städte in Ostdeutschland sind, die die wirtschaftliche Konvergenz Ostdeutschlands voranbringen können“, schreiben die Forscher.

Die Bundesregierung hält dagegen. „Unser Ziel sind gleichwertige Lebensverhältnisse im urbanen und ländlichen Raum in ganz Deutschland.“ So steht es im Koalitionsvertrag von CDU/CSU und SPD. Bis 2021 sollen 12 Milliarden Euro fließen. Geplant ist der Ausbau von Breitband und die Schließung von Funklöchern mit 5G. Mehr Busse und Bahnen, auch abseits der Zentren, und die Förderung von Bildung, Tourismus, Wirtschaft und Ehrenamt.

Heimatminister Horst Seehofer tourte im letzten Jahr durch Deutschland. „Ich möchte nicht nur mit Geld, sondern auch mit Strukturen unterstützen, um die Regionen Deutschlands noch stärker zusammenbringen. Deshalb bin ich auf Deutschlandreise.“ So steht es auf der Seite des Ministeriums. Im Januar initiierte die Landwirtschaftsministerin Julia Klöckner eine neue Kampagne für ein besseres Leben auf dem Land. Der Titel: #Dorfkinder. Mittelpunkt sind Fotos von Kindern, die in blühenden Getreidefeldern stehen. Sie lächeln. Von abgehängten Regionen ist wenig zu sehen.

Was also tun mit diesen Orten? Aufgeben oder fördern? Was braucht ein Ort zum Überleben? 5G, eine Bushaltestelle oder mehr Touristen? Oder, wie in Penkun: einfach eine Schule?

Fragt man Bernd Netzel nach seinem Lieblingsort in Penkun, sagt er: „Irgendwo draußen, mit dem Hund.“ Nach Feierabend geht er oft ein Ründchen um den See. Das passt irgendwie. Netzel ist keiner, der gerne die Füße stillhält.

An diesem Januarmorgen sitzt er in seinem Büro, im zweiten Stock eines neuen Klinkerbaus. Die Straße runter geht es zur Kirche und zum Markt, auf dem ein paar alte Linden dem Winter trotzen. Viele Fassaden sind hier bunt, mehrere Läden stehen leer. Die ehemalige Fleischerei, ein Blumenladen. Nur die Apotheke ist voll. Der durchschnittliche Penkuner ist zwischen 55 und 65 Jahre alt.

Netzel hat keinen Kaffee mehr und bringt stattdessen Früchtetee. Das Büro hat der 63-Jährige noch aus Zeiten seines Amtes. Früher lenkte er hier die Geschicke der Stadt. In einer hellen Holzvitrine, im unteren Fach, liegt noch der Schlüssel der Stadt Penkun. Ein goldenes Unding, so lang wie ein Unterarm.

Heute leitet Netzel hier einen Fahrservice mit 14 Autos, die in Penkun den öffentlichen Nahverkehr ersetzen. Die Stadt ist nicht gerade ein Verkehrsknoten. Der Bus kommt etwa einmal die Stunde. Wer zwischendurch zum Arzt muss, der ruft bei Bernd Netzel an. „Netzel“, meldet er sich knapp zur Begrüßung und schiebt ein „Das kriegen wir hin“ hinterher. 29 Jahre als Bürgermeister sind nicht einfach vorbei, die klingen nach.

Schaut man sich Netzels Bilanz an, dann könnte man sagen, er war ganz erfolgreich in den letzten Jahrzehnten. Er hielt Büttenreden im Karnevalsverein und überreichte Blumen zum runden Geburtstag. Ließ eine Kanalisation bauen, eine neue Grundschule und ein Gewerbegebiet. Er öffnete die Stadt für junge Familien aus dem nahen Polen und feierte Erfolge mit dem Penkuner Fußballverein. Landesliga, 2003.

Kurz, er hielt Penkun fern vom Niedergang, trotz ständiger Löcher im Haushalt, der Jungen, die es in die Städte zog, und der Randlage. „Mir ging es immer um die Stadt, um die Menschen“, sagt Bernd Netzel jetzt. „Auch wenn es nicht immer einfach war.“

Er weiß: Stadtentwicklung ist auch der Kampf um Standortvorteile, um Zuzügler und Steuereinnahmen, um eine belebte Stadt. Und den droht Penkun gerade zu verlieren. Die Stadt hat rund 4 Millionen Euro Schulden. In den letzten fünf Jahren wachte ein Sparbeauftragter des Landes über den Haushalt. Der setzte ein Ultimatum: Entweder man spare Gelder ein, oder die Regionalschule müsse schließen. „Eine Katastrophe“, sagt Netzel. Denn ohne diese Schule, sagt Netzel, könne der Ort einpacken.

Die Grundschule von Penkun geht nur bis zur 4. Klasse, danach ist Schluss. Netzel befürchtet, dass Eltern woanders hinziehen, wenn die weiterführende Schule dichtmacht.

Das Problem mit der Regionalschule ist nicht neu. Bereits seit 2002 läuft die Schule nur noch mit Ausnahmegenehmigung. In den letzten 20 Jahren hat sich die Zahl der Kinder hier halbiert. Die Klassen sind eigentlich zu klein, um die Kosten für Lehrer, Strom und Wasser zu rechtfertigen. Trotzdem gelang es Netzel immer wieder, den Betrieb aufrechtzuerhalten. Es gab Zeiten, da klapperte er mit einem Kleinbus die benachbarten Dörfer im nahen Brandenburg ab, um die Schüler zum Unterricht zu bringen. „Wenn dir keiner hilft, hilf dir selbst“, sagt Netzel. Es klingt nicht trotzig, wie er das sagt, eher stolz. Das könnte jetzt nicht mehr reichen.

Denn wer schickt sein Kind schon auf Dauer auf eine Schule, in die es hineinregnet?

Von außen ist der Verfall nicht zu sehen. Groß und grau steht die Schule da, auf dem Hof stehen Jugendliche zusammen. Manche sprechen polnisch. Erst wenn man richtig hinschaut, sieht man den „Sanierungsstau“, wie Netzel es ausdrückt. Löcher in den Fenstern, eine Aula, die noch Original 1950er Jahre ist, und ein undichtes Dach.

Um die Schule zu retten, hat die Stadt einen Plan gefasst: die Zusammenlegung von Grund- und Regionalschule. 100.000 Euro für Strom und Unterhalt sollen so jährlich eingespart werden. Das Problem ist, eine Zusammenlegung würde 7 bis 9 Millionen Euro kosten, das hat eine Machbarkeitsstudie ergeben. Geld, das Penkun nicht hat, aber irgendwie aufbringen muss. Geld, das nur fließt, wenn sichergestellt ist, dass die Schule auch in ein paar Jahren noch besteht. Nur: diese Bestandsgarantie gibt es nicht.

Bis 2022 sei die Schule gesichert, danach werde erneut geprüft, heißt es aus dem Bildungsministerium Mecklenburg-Vorpommern. Der ernüchternde Zwischenstand: Weder ist klar, ob die Schule nach 2022 weiterbestehen wird, noch, wer den gewünschten Umbau finanzieren soll.

Dazu kommt: Die Regionalschule in Penkun ist nicht nur schlecht ausgelastet und hat ein undichtes Dach, sie hat Konkurrenz bekommen.

Rund 30 Kilometer nördlich von Penkun, in der Stadt Löcknitz, 3.300 Einwohner, entsteht in diesen Tagen ein neuer Schulcampus. In den nächsten Jahren sollen 17 Millionen Euro in das Projekt fließen. Das Geld kommt aus Töpfen von Land, Bund und EU. Eine neue Schule für 1.000 Kinder. Löcknitz wächst, vor allem durch den Zuzug von polnischen Familien, die vor den hohen Mietpreisen in Stettin in deutsches Randgebiet flüchten.

Schloss in Penkun (Uckermark) - - 9857.jpg

Warum also in Penkun investieren? In eine Schule für 122 Kinder, deren Schülerzahlen seit Jahren stagnieren? In eine Stadt, die noch nicht mal eine Eisdiele hat?

Erklären will das Eckart Rothe, Penkuner, Tischlermeister und seit elf Jahren Mitglied im Stadtrat. Er ist neben Bernd Netzel einer der größten Unterstützer der Regionalschule in Penkun. Am Telefon schlägt er vor, sich auf einen Kaffee am Marktplatz zu treffen. Das Café ist nicht zu verfehlen, es ist das einzige in der Stadt. Zwei ältere Damen servieren in weißen Kittelschürzen Mittagstisch und warme Getränke. „Kremtorte und Kaffe“ drei Euro.

Quelle           :          TAZ           >>>>>        weiterlesen


Grafikquellen     :

Oben      —         Südwestlicher Ortseingang


2.)  von Oben         —           Penkun, Werner-von-der-Schulenburg-Straße

Abgelegt unter Kommunalpolitik, Kultur, Meck - Pommern, Überregional | Keine Kommentare »

Das Virus der Panikmache

Erstellt von DL-Redaktion am 4. Februar 2020

– gegen die Volksrepublik China

夕阳下下的桦甸街头-菜市口 - panoramio.jpg

Quelle     :     Scharf  —  Links

Bericht von der unsichtbaren Front  – von Jürgen Heiducoff,

seit 25.01.2020 Gast bei einer durchschnittlichen chinesischen Familie in Huadian (Provinz Jilin, China)

Die Berichterstattung über die Ausbreitung des Coronavirus in unseren deutschen Medien ist verständlich. Es besteht ein Informationsbedarf der Menschen, auch wenn sie sich Tausende von Kilometern vom Infektionsherd entfernt befinden. Das Virus ist hoch ansteckend und in der globalen hoch mobilen Welt schnell von Kontinent zu Kontinent übertragbar.

Angeblich ist seine Entstehung unbekannt, obwohl es bereits in der vorigen Woche australischen Forschern gelungen sein soll, es nach zu züchten. Da die Heilung sehr schwierig ist und noch keine Gegenmittel verfügbar sind, stellt sich natürlich eine gewisse Hilflosigkeit ein.

Die Aktivitäten vor Ort beim Kampf gegen den unsichtbaren Feind scheinen sich zu überschlagen. Auch hier im Nordosten Chinas, weit entfernt vom Infektionsherd im Zentrum des Landes, bestimmen präventive antiepidemische Maßnahmen den Alltag der Menschen. Über Fernsehen und Rundfunk wird ausführlich über den Verlauf, die Opfer und den Kampf gegen die Epidemie informiert. Auch in der Stadt Huadian sind Lautsprecherwagen unterwegs, die örtliche Maßnahmen koordinieren helfen und individuelle Empfehlungen erteilen. An den Hauseingängen sind seit Tagen entsprechende Bekanntmachungen veröffentlicht. Die Schulen, Kindergärten, öffentlichen Sporteinrichtungen und Bäder sind geschlossen. Der regionale Busverkehr ist weitgehend eingeschränkt. Geschäfte und Restaurants sind mit Ausnahme großer Supermärkte ebenfalls geschlossen. Die Versorgung der Menschen ist aber gewährleistet, auch wenn die Preise für bestimmte Lebensmittel steigen. Die Einwohner werden aufgerufen weitgehend die Wohnung nicht zu verlassen. Desinfektionstrupps besprühen unentwegt Müllplätze, Hauseingänge und andere frequentierte Bereiche. Sanitäter und Ärzteteams kontrollieren den Gesundheitszustand von Passanten an Mautstationen und zentralen Plätzen der Stadt.

Und wie widerspiegelt sich diese Lage in den deutschen Medien? Statt den von der Epidemie und den daraus resultierenden Maßnahmen betroffenen Menschen Respekt und Achtung entgegen zu bringen werden abwertende Bewertungen und Panikmache produziert. Auch ist eine gewisse Schadenfreude kaum noch zu verbergen. Das soll die Gemüter anheizen. Das ist etwas, was den fleißigen, aber auch zum Teil hilflosen Menschen nicht weiter hilft.

Die DWN (Deutsche Wirtschaftsnachrichten, eine Publikation der Verlagsgruppe Bonnier) veröffentlichten am 02.02.2020 eine Kolumne von Ronald Barazon unter dem Titel

„Corona-Virus ist ein Weckruf: Nur Widerstandsfähige sind Viren gewachsen“

Darin ist zu lesen:

„Der Ausbruch und die rasche Verbreitung des Corona-Virus rufen eine meist nicht beachtete Tatsache in Erinnerung: Die Entstehung der Viren ist unbekannt, die Heilung der von Viren ausgelösten Krankheiten schwierig bis unmöglich. Eine Virus-Infektion kann jede und jeden treffen. Um die Krankheit gut überstehen zu können, muss der oder die Betroffene widerstandsfähig sein. Das ist bei einem Großteil der Weltbevölkerung nicht der Fall und so steht der Gesundheitszustand von Milliarden auf dem Prüfstand.“

Ronald Barazon ist kein Virologe, sondern ein österreichischer Wirtschaftsjournalist, der Einkünfte aus seinen Veröffentlichungen und Vorträgen erzielt.

Der Erlanger Virologe Prof. Armin Ensser stellt dem entgegen und ist sich sicher: In Franken würde es schon bald zu ersten Corona-Fällen kommen. In Panik verfallen sollte deshalb aber keiner.

Dieser Spezialist relativiert die Panikmache und sagt: „Ich hätte jetzt mehr Angst vor einer Grippe, als vor dem Coronavirus“1)

Auszug aus einem Interview mit ihm: „Was sollten diejenigen tun, die sich mit dem Coronavirus infiziert haben? Wenn es zu keiner schweren Erkrankung kommt, wird man die Krankheit am besten zu Hause auskurieren, wie man das bei einer normalen Atemwegserkrankung auch macht. Anders sieht das bei einem schwereren Verlauf der Krankheit, zum Beispiel in Form einer Lungenentzündung, aus. Da führt dann kein Weg an einem Krankenhausaufenthalt vorbei.“

Bemerkenswert ist auch, dass der Virologe Clemens Wendtner gegenüber focus online am 28.01.2020 sagte: „Es gebe in Deutschland Viruserkrankungen, die sehr viel ansteckender und gefährlicher sind als das Coronavirus.“ In unserem Land stürben 20.000 bis 25.000 Menschen pro Jahr an den Folgen einer Influenza.

Nur selten finden sich in den Medien solcher Art von Veröffentlichungen erfahrener Spezialisten. Vielmehr kommen Gerüchtemacher, die sich gegenseitig zu übertreffen versuchen, zu Wort.

Statt objektiver Berichterstattung tauchen am „grünen Tisch“ ausgebrütete Beiträge auf. Schlagzeilen, das Coronavirus bringe Chinas Machtsystem ins Wanken bilden dabei den Gipfel der Geschmacklosigkeit. Da ist wohl mehr der Wunsch der Vater der Gedanken. Behauptungen aus fernen Redaktionsstuben, das Coronavirus würde das Vertrauen der Menschen gegenüber der Kommunistischen Partei und dem Staat untergraben stelle ich meine persönlichen Beobachtungen vor Ort entgegen. Ich kann das nicht bestätigen. Im Gegenteil. Mehr als sonst sehe ich Flaggen mit Hammer und Sichel an privaten Fahrzeugen und an den Fenstern der Privatwohnungen. Auch im Kreise meiner befreundeten Familie und deren Bekannten gibt es keinerlei kritische Bemerkungen gegenüber der Partei und dem Staat. In einigen deutschen Medien hat sich das Virus der Desinformation und Fehlbewertung ausgebreitet. Es geht schon nicht mehr nur gegen das politische System in der Volksrepublik, sondern gegen die „Chinesen“ an sich.

Deutsche Medien disqualifizieren sich erneut zum Sprachrohr eines primitiven Rassismus.

In der „Welt“ wird zufällig in der letzten  Woche auf die „gelbe Gefahr“ hingewiesen. Man fühlt sich an die Hunnenrede Kaiser Wilhelms erinnert.

Wahr ist – wie auch der Klimawandel ist die Virenkrise ein globales Problem. Es kann nicht einzelnen Staaten zugeordnet werden.

 1)        01.02.2020

 Der Autor Jürgen Heiducoff

ist ein deutscher Rentner aus Übach-Palenberg, der sich regelmäßig privat bei Freunden in der Volksrepublik China aufhält

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen         :

Oben       —            夕阳下下的桦甸街头-菜市口


Unten         —         夕阳下的桦甸街

Abgelegt unter Asien, Mensch, Nordrhein-Westfalen, Positionen | Keine Kommentare »

Die Deutsche Welle

Erstellt von DL-Redaktion am 29. Januar 2020

Deutschen Welle Macht und Missbrauch

Bonn DeutscheWelle Posttower.jpg

Von Peter Weissenburger

Mit­ar­bei­te­r*in­nen der Deutschen Welle haben sich an die taz gewandt. Sie sagen, das Arbeitsklima sei von Drohungen und Machtmissbrauch geprägt.

Wenn in es in einem Unternehmen zu Vorwürfen sexueller Gewalt kommt, dann gibt es immer zwei Geschichten. Zum einen die des konkreten Falls: der mutmaßliche Täter, das mutmaßliche Opfer, die Ermittlungen. Und zum anderen die Geschichte der Unternehmenskultur. Die beginnt schon lange vor dem Ereignis und dauert darüber hinaus. Das Betriebsklima ist entscheidend, wenn es darum geht, ob Betroffene sich melden – und ob Täter mit Konsequenzen rechnen müssen.

In den vergangenen Monaten sind Mitarbeitende der Deutschen Welle (DW) auf die taz zugekommen, weil sie, wie sie sagen, seit Jahren unter dem Betriebsklima im Auslandssender leiden. Auch ein Artikel im britischen Guardian hat sich diese Woche mit internen Beschwerden über die Deutsche Welle auseinandergesetzt. Das Arbeitsklima beim Sender wird darin als vergiftet beschrieben, eine anonyme Mit­ar­bei­te­r*in wird mit den Worten zitiert „Die DW ist ein Sumpf.“ Es ist die Rede von Rassismus, Mobbing und systematischer Unterdrückung von Kritik. Das ist besonders brisant, weil es bei der DW einen noch nicht geklärten #MeToo-Fall gibt.

Die Vorwürfe wiegen so schwer, dass über 80 Mitarbeitende aus verschiedenen DW-Redaktionen (diese Zahl nennt jedenfalls der Sender) am Mittwoch eine Gegendarstellung als offenen Brief an den Guardian verfasst haben. Zwar seien die beschriebenen Vorgänge inakzeptabel und müssten aufgeklärt werden. „Aber das Arbeitsumfeld, welches Sie in Ihrem Artikel beschreiben, hat keine Ähnlichkeit mit dem Newsroom, in dem wir heute arbeiten.“ Dieser sei „eine hochprofessionelle, freundliche und positive Arbeitsumgebung“.

Worum geht es also? Die taz hat in den vergangenen vier Monaten mit ehemaligen und gegenwärtigen Mit­ar­bei­te­r*in­nen der DW gesprochen, darunter ein Mitglied des Personalrats. Es geht um mehrere Gemengelagen, die der Text im Guardian zum Teil vermischt. Einige sind längst bearbeitet, andere bleiben offen – und sorgen in der Belegschaft für Frust.

Vorfälle und Beschwerden

Zum einen ist da der #MeToo-Fall, bekannt seit August 2019 durch einen Bericht der Zeit. Ein DW-Moderator soll 2016 in Berlin zwei Mitarbeiterinnen sexuell belästigt und eine weitere auch vergewaltigt haben. Der Beschuldigte, der alles bestreitet, hat den Sender im August 2018 verlassen, die Ermittlungen laufen noch.

Bis heute warten die Mitarbeitenden auf eine Klärung der Vorfälle. Sein Weggang wurde gegenüber der Belegschaft mit „Erschöpfung“ begründet, was Kol­le­g*in­nen irritierte. „Wir wussten alle, dass er zu Übergriffen neigt“, sagt ein Redaktionsmitglied. „Aber er hatte Macht, weil er ein Star war und weil er ein gutes Verhältnis zum Redaktionsleiter und zum Intendanten hatte.“

Zweitens ist da der Fall eines Teamleiters in der Sportredaktion, der durch rassistische und antisemitische Aussagen und durch Mobbing aufgefallen war. Dieser Fall wird im Guar­dian hervorgehoben, obwohl man ihn als abgeschlossen betrachten könnte. Denn aus Gesprächen mit Mit­ar­bei­te­r*in­nen wird klar, dass der Mann seit Anfang 2018 nicht mehr beim Sender arbeitet. Aus einer internen Beschwerdemail von November 2017 an die damalige Chefredakteurin Ines Pohl wird aber auch klar, dass der Fall zuvor ein Jahr lang verschleppt und Hinweise nicht mit der nötigen Entschlossenheit verfolgt wurden.

2013-08-10 07-14-28 Ballonfahrt über Köln EH 0603.jpg

Die dritte Gemengelage hat mit einem Beschwerdeschreiben einer Gruppe von Mitarbeitenden zu tun und mit der Art, wie die Senderleitung darauf reagierte. Der Brief wird im Oktober 2018 von 16 Mitgliedern der Sprachredaktion Arabisch am Standort Berlin verfasst. „Wir, Mitarbeiterinnen und Mitarbeiter der arabischen Redaktion und von der Produktion, sind zutiefst besorgt“, beginnt das Schreiben. Anlass ist damals, dass in der Redaktion ein Mann einer Kollegin gedroht hat, „ihr den Finger zu brechen“. (Der Mann hat in der Zwischenzeit „arbeitsrechtliche Konsequenzen“ erfahren, teilt die DW auf Anfrage mit).

Die Ver­fas­se­r*in­nen des Briefs allerdings wollen „darauf aufmerksam machen, dass der Vorfall keineswegs isoliert zu betrachten ist“. Man habe „leider den Eindruck, dass die Führungskultur in der arabischen Redaktion zu einem Großteil auf Demütigungen, Einschüchterungen und Manipulation“ basiere. Der Brief kritisiert aber auch die Leitung des Senders. „Viele von uns haben in den vergangenen Jahren Rat und Hilfe innerhalb der Deutschen Welle gesucht. Uns wurde signalisiert, dass diese Missstände bereits bekannt seien. Eine konkrete Aussicht auf Verbesserung wurde uns aber nicht in Aussicht gestellt.“

Die Welle weltweit

Die arabische Redaktion ist eine von 30 Sprachredaktionen des Auslandssenders Deutsche Welle, der, anders als andere öffentlich-rechtliche Sender, nicht aus Rundfunkbeiträgen, sondern aus Steuermitteln finanziert wird. Von ihren Standorten in Bonn und Berlin und mit etwa 3.000 Mit­ar­bei­te­r*in­nen sendet die DW täglich Nachrichten- und Magazinsendungen in die ganze Welt.

Quelle         :           TAZ         >>>>>         weiterlesen


Grafikquellen       :

Oben       —         Deutsche Welle headquarters in the Schürmann building in Bonn. In the background, the Post Tower, HQ of Deutsche Post can be seen.

Abgelegt unter International, Kultur, Medien, Nordrhein-Westfalen | Keine Kommentare »

Kein Datteln 4 !

Erstellt von DL-Redaktion am 27. Januar 2020

Datteln. Am Freitag, 24. Januar 2020

Baustelle des Kraftwerksneubau Datteln IV.jpg

Quelle      :       Scharf  —  Links

Von Jimmy Bulanik

Datteln. Am Freitag, 24. Januar 2020 kamen überregional in über vierhundert Menschen mit Materialien zur Außendarstellung wie Banner, Fahnen, Plakate um 12 Uhr am Neumarkt an zusammen um für den Schutz der Natur den Raum öffentlich in Anspruch zu nehmen. Die Demonstrationsroute verlief über die Castroper Straße, die Autobahn B235 bis zum Steinkohlekraftwerk am Dortmund – Ems – Kanal. Die Demonstration verlief friedlich. Aufgerufen haben dazu die Organisationen BUND und FFF. Begleitet wurde die Demonstration von vielen Journalistinnen und Journalisten.

Die demonstrierenden Menschen sind in ernsthafter Sorge um die bevorstehende Umweltverschmutzung wie mittels den hohen Werte von toxischem Quecksilber und der Feinstaubbelastung der Luft durch die Inbetriebnahme des Kohlekraftwerk Datteln 4. Der Betreiber des Datteln 4 sind die Uniper Kraftwerke GmbH. Darüber hinaus ist es den jungen Menschen ein Anliegen auf Menschenrechtsverletzungen in den Kohleabbaugebieten in Russland und Kolumbien zu verweisen.

Dem ging Protest der Zivilgesellschaft, Gerichtsverfahren, Baustopp voraus.

Die Energiegewinnung durch Steinkohle ist zeitlich als auch technisch überholt. Daher der grundsätzlich geplante Ausstieg aus der Steinkohle. Die Kontamination der örtlichen Natur führt zwangsläufig zu kranken Menschen in dem Lebensraum. Insbesondere für jene mit einem schwachem Immunsystem wie Kinder, kranke, ältere Menschen.

Das Ruhrgebiet ist bereits seit vielen Jahren laut den jährlichen Studien des paritätischen Wohlfahrtsverband in der Bundesrepublik Deutschland die größte Armutsregion. Eine vergiftete Umwelt darin stellt für die Menschen und Tiere obendrein eine multiple Deprivation ihrer Lebensqualität dar. Abstrahiert von der Gier nach monetärem Profit kann dies niemand mit einem gesundem Menschenverstand wollen.

In diesem jungen 21. Jahrhundert gilt es die Gewinnung des zertifizierten, regenerativen Strom und dessen Anlagen international auszubauen. Dadurch besteht für herkömmliche Stromanbieter weniger die Notwendigkeit im Ausland wie Norwegen Zertifikate zu kaufen, dessen Ökostrom in Norwegen ökologisch zertifiziert aus Wasserkraft gewonnen worden ist. Diese herkömmlichen Energiegesellschaften betreiben mittels dem Handel von Ökostrom Zertifikaten ohne selber Ökostrom herzustellen, eine Form von Greenwashing. Dies kann und darf als eine Modalität der Täuschung der Ökostrom Kundschaft betrachtet werden.

Als positives Beispiel ist Greenpeace Energy zu benennen. Diese bauen, betrieben eigene Anlagen um zertifizierten Ökostrom zu gewinnen. Damit werden in der Bundesrepublik Deutschland durch Greenpeace Energy bundesweit private Haushalte, Unternehmungen mit selbst produzierten, zertifizierten Ökostrom versorgt.

Dies gilt es zu unterstützen. Eine Staatsräson herzustellen. Dazu bedarf es eine aktive Zivilgesellschaft welche offline ihre Nachhaltigkeit öffentlich unter Beweis stellt. Mit dem Mitteln des Internet können zu diversen Anliegen eine digitale Petition hergestellt werden. Damit Öffentlichkeit und Willensbildung schaffen. Die Ergebnisse einer Petition dem zuständigen Landtag, bzw. Bundestag einreichen.

Mont Cenis Kaiser-Wilhelm-Turm 7.jpg

Die öffentliche Sichtbarkeit im Rahmen des Versammlungsrechtes ist unverzichtbar. Insbesondere für das Bundesland Nordrhein-Westfalen berechtigte Anliegen der Ökologie, soziale Gerechtigkeit. Es kostet kein Geld bei dem Polizeipräsidium in Düsseldorf unter den Faxnummern: 02118704404, 02118704405, via Email: Demonstrationen anzumelden, um wöchentlich an einem Freitag über Stunden hinweg in der Innenstadt von Düsseldorf wie der Königsallee Öffentlichkeit herzustellen. Die Flugblätter mit Text, Links im Internet persönlich an Passanten zu überreichen, geduldig in zwischenmenschliche Gespräche für das jeweilige Anliegen zu werben.

Am 13. September 2020 hat das Bundesland Nordrhein-Westfalen seine Kommunalwahlen. Dies ist für den Souverän gegenüber der Parteienlandschaft und Betrieben in Nordrhein-Westfalen und auf der Bundesebene eine Gelegenheit mit dem Wahlergebnis ein entsprechend deutliches Signal vor der nächsten Bundestagswahl zu senden. Deshalb sollte dabei die demokratische Wahlbeteiligung der erste Gewinner dieser Wahl sein.


Fridays for Future


Greenpeace Energy

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen         :

Oben         —        Baustelle des Kraftwerksneubau Datteln IV.

Abgelegt unter Deutschland, Nordrhein-Westfalen, Positionen, Umwelt | 1 Kommentar »

Datteln 4 – Kohlekraftwerk

Erstellt von DL-Redaktion am 26. Januar 2020

Datteln, der neue Hambi?

Coal power plant Datteln 2 Crop1.png

Von Andreas Wyputta und Malte Kreutzfeldt

Trotz des Kohleausstiegs soll mit Datteln 4 ein neues Kohlekraftwerk ans Netz. Wird die Gemeinde zum Protestort?

So viele Menschen sind in Datteln selten auf der Straße: Rund 500 Menschen ziehen am Freitagmittag mit bunten Plakaten und Transparenten durch die 35.000-Einwohner-Stadt im nördlichen Ruhrgebiet. „Kohle stoppen, Klima retten“ steht darauf. „Datteln 4 – nicht mit mir“, skandieren sie. „Lasst uns der Kohlelobby widerstehen“, ruft Dario-Roman Otte von Fridays for Future ins Mikrofon. „Es ist unsere Zukunft.“ Auch für die nordrhein-westfälische Grünen-Vorsitzende Mona Neubaur steht fest: „Datteln 4 darf nicht ans Netz.“

Junge Klimaschützer*innen von Fridays for Future, aber auch von Extinction Rebellion, Ortsgruppen von Grünen und Linken und der Umweltverband BUND haben für die Demo geworben. Von dem, was in den nächsten Monaten auf Datteln zukommen dürfte, davon vermittelt dieser Freitagmittag trotzdem nur einen Vorgeschmack.

Dass Datteln so viel Aufmerksamkeit bekommt, ist neu. In den letzten Jahren war das Steinkohlekraftwerk, das dort gebaut wurde, eher von lokalem Interesse. Doch nun wird das Großkraftwerk in der Kleinstadt zu einem bundesweiten oder sogar internationalen Symbol für eine verfehlte Klimapolitik. Und damit zu einem möglichen Kristallisationspunkt für Proteste, ähnlich wie Brokdorf und Gorleben für die alte Anti-Atom-Szene oder der Hambacher Forst für die junge Klimabewegung.

„Für uns wird Datteln der neue Hambacher Wald“

Dieser Wald am Rande des Braunkohletagebaus Hambach ist nach hartnäckigem Widerstand – in Baumhäusern, vor Gericht und auf der Straße – schließlich davor gerettet worden, vom Energiekon­zern RWE abgebaggert zu werden. An diesen Erfolg wollen die Um­welt­schützer*innen jetzt anknüpfen. Für Greenpeace-Geschäftsführer Martin Kaiser steht fest: „Für uns wird Datteln der neue Hambacher Wald.“ Und auch Kathrin Henneberger, Sprecherin des Protestbündnisses „Ende Gelände“, das in den vergangenen Jahren mit Massenaktionen zivilen Ungehorsams vor allem Braunkohle-Tagebaue blockiert hat, sagt: „Datteln 4 kann durchaus ein zweiter Hambi werden, was die Größe des Protests angeht.“

Der Soziologe Simon Teune forscht an der Technischen Universität Berlin zu sozialen Bewegungen. Mit Blick auf Datteln 4 sagt er: „Es ist ein Exempel, an dem man die falsche Energiepolitik deutlich machen kann. Wenn da wieder lokale und überregionale Akteure zusammenkommen und viel Energie reinstecken, kann das durchaus groß werden.“

Neben Demos von Fridays for Future und Umweltverbänden wie an diesem Freitag sind auch Aktionen zivilen Ungehorsams geplant. Mitstreiter*innen von Ende Gelände diskutieren bereits intensiv über eine Blockade des neuen Kraftwerks. Im Hambacher Wald denken einige Bewohner*innen der dortigen Baumhäuser darüber nach, Flöße zu bauen, um den Kanal zu blockieren, auf dem die Steinkohle nach Datteln geschafft werden soll. Der ist schließlich nicht mal 100 Kilometer entfernt.

FFF Berlin 2019-03-29 171.jpg

Auslöser für die neuen Proteste ist die Entscheidung der Bundesregierung, dass Datteln 4 trotz des beschlossenen Kohleausstiegs in Kürze in Betrieb gehen darf. Die Kohlekommission, die vor fast genau einem Jahr ihr Konzept zum Ausstieg aus der Kohlenutzung in Deutschland vorstellte, empfahl zwar das Gegenteil. Doch auch um mögliche Schadenersatzforderungen von rund 1 Milliarde Euro zu vermeiden, setzte sich die Große Koalition darüber hinweg. Im Sommer soll der Regelbetrieb beginnen.

Danach hat es lange nicht ausgesehen. Das neue Kraftwerk in Datteln mit seinem 180 Meter hohen Kühlturm überragt die Landschaft, selbst aus dem rund 20 Kilometer entfernten Bochum ist es zu erkennen. Doch viele Jahre lang stieg daraus kein Dampf auf.

Gestritten wird um Datteln 4 seit mehr als 15 Jahren. 2005 klagten der Umweltverband BUND und ein Landwirt, dessen Hof in Sichtweite des Kohleblocks liegt, gegen den geplanten Neubau. Eon, der Vorgänger des jetzigen Betreibers Uniper, schuf derweil Fakten – und ließ das Kraftwerk ab 2007 für 1,5 Milliarden Euro hochziehen.

Zwei Jahre später folgte eine Entscheidung des Oberverwaltungsgerichts Münster: Datteln 4 stehe am falschen Platz, urteilten die Richter, es verstoße damit gegen den Landesentwicklungsplan. Der sah einen etwa 5 Kilometer entfernten Standort vor, doch Eon hatte stattdessen neben seinen alten – heute teilweise abgerissenen – Steinkohleblöcken 1 bis 3 gebaut. Denn die liegen direkt am Dortmund-Ems-Kanal, über den auch die Kohle für den neuen Block 4 angeliefert werden soll.

Eine „Kraftwerkserweiterung oder ein Ersatzkraftwerk für das bereits bestehende Kraftwerk mit 300 Megawatt“ sei der neue Block 4 mit seinen 1.052 Megawatt trotzdem nicht, urteilte das Oberverwaltungsgericht Münster. Erstmals verknüpften die Richter zudem eine Kraftwerks-Baugenehmigung mit dem Klimaschutz. Kraftwerksplanungen könnten „nur realisiert werden, wenn damit in der CO2-Bilanz und bei anderen klimarelevanten Stoffen ein Fortschritt erreicht wird“, heißt es in dem Urteil von 2009.

Einen „Schwarzbau“ nennt der BUND Datteln 4 seitdem. Widerwillig verhängte die zuständige Bezirksregierung Münster nach dem Urteil einen Baustopp. Die Anwohner*innen hofften, dieser Zustand könnte von Dauer sein – schließlich hatte das Gericht zusätzlich gerügt, die von der traditionell kohlefreundlichen SPD geführte Dattelner Stadtverwaltung habe „das Gefährdungspotenzial des Kraftwerks und den Schutz der Bevölkerung“ nicht ausreichend berücksichtigt.

480 Meter weiter steht das Kraftwerk

Aus dem Küchenfenster von Rainer Köster ist der riesige Kühlturm gut zu sehen. Er wohnt in der Dattelner Meistersiedlung des schon 1972 stillgelegten Bergwerks Emscher-Lippe. Der ehemalige Polizist klagt selbst gegen Datteln 4, er ist auch Sprecher der Interessengemeinschaft, mit der sich die Bewohner*innen der Zechen­häuser wehren. Zwischen der Meistersiedlung und dem Kraftwerk liegen nur 480 Meter – das ist weniger als halb so viel wie der Abstand, den die Bundesregierung künftig zwischen Wohnhäusern und Windrädern vorschreiben will.

Schon heute verdunkeln Dampfwolken den Himmel über dem Kraftwerk, das sich hinter Kösters Garten erhebt. Denn trotz der Klagen und gewonnenen Gerichtsverfahren läuft Datteln 4 seit einigen Wochen in einer Art Testbetrieb. Laut Angaben der Strombörse EEX darf das Kraftwerk vom 21. Januar bis zum 12. Februar mit halber Leistung arbeiten.

Kraftwerk Datteln IV Neubau mit Binnenschiff.JPG

„Die Politik hat uns verarscht“, sagt Köster. Nach dem wegweisenden Urteil aus Münster habe die schwarz-gelbe Regierung des damaligen Ministerpräsidenten Jürgen Rüttgers (CDU) den Landesentwicklungsplan einfach im Sinne von Eon und Uniper geändert. Das rot-grüne Kabinett von Nordrhein-Westfalens Regierungschefin Hannelore Kraft (SPD) habe das zwar wieder zurückgedreht – den Weiterbau von Datteln 4 dann aber durch eine Ausnahmegenehmigung doch legalisiert, sagt Köster. Ihn ärgert das, er ist seit 1969 selbst Sozialdemokrat.

„Unsere Klagen gegen Datteln 4 ruhen, bis ein als Musterprozess geltendes Verfahren in Lünen abgeschlossen ist“, erklärt der 72-Jährige. Denn Datteln ist nur einer der vielen Steinkohleblöcke, die im nördlichen Ruhrgebiet aufgereiht sind: Wer auf der Autobahn 2 von Ost nach West fährt, kann die Kühltürme und Schornsteine der Kraftwerke etwa in Hamm-Uentrop, Bergkamen, Herne, Gelsenkirchen-Scholven oder Duisburg-Walsum nicht übersehen.

Queelle           :       TAZ        >>>>>           weiterlesen


Grafikquellen          :

Oben       —        Coal power plant in Datteln (Germany) at the Dortmund-Ems-Kanal

Abgelegt unter Deutschland, Nordrhein-Westfalen, Positionen, Umwelt | Keine Kommentare »

Climate Crimes

Erstellt von DL-Redaktion am 25. Januar 2020

Verbrechen an der Menschheit

Schaufelradbagger Hambacher Forst.jpg

Quelle          :           unterhrund-blättle CH.

Von    ab

Es gibt sie immer noch, die von der Industrie finanzierten wissenschaftlichen Klimaleugner*innen. Aber heute reden in der BRD fast alle vom Klimawandel.

Manche reden von der Klimakrise oder der Klimakatastrophe. Wir nutzen Climate Crimes oder auch Klimakriege. Klima-Verbrechen und -Kriege sind legal, denn auf ihnen beruht das ‚warenproduzierende Patriarchat‘ (ein Begriff der marxistischen Wertkritikerin Roswitha Scholz). Das macht grosse Unterschiede, denn dieser Prozess ist nicht einfach menschengemacht. Er ist, so unsere These, die logische und auch rassistisch wirkende Konsequenz aus den Systemen Staat und Kapitalismus und ihrer patriarchalen Basis. Der IPCC-Bericht von 2018 versammelt das aktuelle Wissen der weltweiten Klimaforschung. Er ist ein Bericht an die Staaten und stellt eine Vielzahl von Handlungsstrategien (genannt: Pfade) vor. Seine Aussagen zeigen deutlich auf, dass die Erwartungen, wieviel Zeit zum Handeln noch bleibt, sich von einem Bericht zum anderen erheblich verkürzt.

Der IPCC-Bericht von 2018 prognostiziert bei einem sofortigen vollständigen Stopp des Ausstosses von Klimagasen als Ergebnis das Erreichen der Erwärmung um 1,5 °C gegenüber dem vorindustriellen Stand in 30 – 100 Jahren. Das ist für keine* Politiker*in und auch für die Wissenschaftler*innen keine Option. Der Bericht fasst 90 Pfade zusammen, die alle davon ausgehen, dass weltweit nochmal die CO2-Menge der letzten 10 Jahre ausgestossen wird. ‚Wir‘ haben dann mit den 90 Pfaden je eine Wahrscheinlichkeit von 67 %, die Erderhitzung auf 1,5 °C zu beschränken, wenn bestimmte Massnahmenbündel getroffen werden.

Die Pfade, die nicht auf den massiven Einsatz destruktiver Grosstechnologien setzen, erfordern es, sofort zu beginnen, weltweit bis 2030 den Ausstoss von CO2 auf weniger als die Hälfte, bis 2040 auf weniger eines Viertels und bis 2050 auf Null zu reduzieren. Zusätzlich ist danach eine negative CO2-Bilanz erforderlich, da CO2 in der Atmosphäre über Jahrzehnte aktiv bleibt. Nach Ende der Freisetzungen von klimaaktiven Gasen würden die 1,5 °C sonst deutlich überschritten.

Die Grenzen des IPCC-Berichts liegen in der Logik der Systeme Staat und Kapitalismus. Die radikalen, destruktiven Konsequenzen fast aller Pfade werden erst bei kritischer Betrachtung deutlich.

Von den 90 Pfad-Modellen, die 1,5 °C anstreben, setzen nur neun nicht auf den massiven Einsatz der CDR- und CCS-Technologien. CDR bedeutet Kohlen-Dioxid-Reduzierung und meint Technologien, die der Atmosphäre CO2 entziehen. Ausser der Anlage von Wäldern und der Renaturierung von Wäldern (Moore werden seltsamerweise, obwohl weit effektiver, im IPCC-Bericht nicht diskutiert) handelt es sich um äusserst Energie- und Ressourcen-aufwändige Grosstechnologien. Diese funktionieren heute nur im Modellversuch, sind aber fest eingeplant. CCS, Carbon Capture and Storage (also CO2-Auffangen und Speichern) schien nach dem Scheitern des Greenwashing von Kohlekraftwerken mittels dieser Technologie gescheitert.

Jetzt soll es in weit grösserem Masse zurückkommen. Alle Studien dazu sagen, dass die unterirdischen Speicher nicht dicht sind, und dass sie regelmässigen Austritt von CO2 an die Erdoberfläche erwarten. Leider ist CO2 schwerer als Luft, sammelt sich bei Austritt also bodennah. Bei einem grösseren Leck bedeutet das das Ende für alles Leben in der Umgebung der Austrittsstelle. Auch verstecken die Pfade undiskutiert eine massive Ausweitung der Energie aus Atomkraftwerken (für 2050 durchschnittlich 2,5 mal höher als heute, maximal 11 mal höher, minimal auf 1/3 reduziert).

Zusätzlich werden noch viele Geo-Engineering Ansätze vorgeschlagen und eingeplant. Das ist nichts anderes als die Vorbereitung eines neuen technologischen Angriffs im Namen des Klimaschutzes. Auf dem Klimagipfel COP 21 in Paris haben sich die Staaten in einer Sonntagsrede – also ohne jegliche Verpflichtung für die einzelnen Staaten – darauf geeinigt, die Aufheizung der Erde auf 1,5 oC begrenzen zu wollen. Die Pläne der einzelnen Staaten und Staatengemeinschaften verfehlen die Anforderungen aber total, die ihnen die eigenen Wissenschaftler*innen stellen.

Wir sehen darin das notwendige Scheitern der kapitalistischen Staaten, angemessene Konsequenzen zu ziehen. Gerade hat das EU-Parlament den Klima-Notstand erklärt. Ist das ebenso nur eine Sonntagsrede, oder wird es Konsequenzen haben? Und wenn ja, werden die sich mehr gegen die Menschen als gegen Industrie und Staat wenden?

Merkel hat für 2050 Klimaneutralität angekündigt und will damit ihren Ruf als Klimakanzlerin reaktivieren. Klimaneutralität ist aber etwas völlig anderes als das vom IPCC geforderte Ziel, den Ausstoss klimaaktiver Gase bis 2050 auf Null zu reduzieren. Klimaneutralität ermöglicht ein weiter so. Mit Hilfe von z.B. REDD-Pro jekten (ein fataler, kapitalfreundlicher Mechanismus des Kyoto-Protokolls. Dieses machte die Luftverschmutzung zur Ware) können im Globalen Süden Kompensationen für hier verursachten CO2-Ausstoss gekauft werden. REDD bewirkt praktisch immer wieder Repression gegen Indigene und Kleinbäuer*innen, die z.B. den Regenwald nutzen, nie aber gegen Grosskonzerne und Grossgrundbesitzer*innen, die diesen platt machen.

Und auch die Erdaufheizung um 1,5 °C ist laut IPCC bereits sehr bedrohlich für die Meeresflora und -fauna, gerade in den tropischen Küstenbereichen. 70 – 90 % aller Korallenriffe werden bereits bei plus 1,5 °C absterben. Es wird eine Verschlechterung der menschlichen Gesundheit erwartet. Krankheiten wie Malaria und das Dengue-Fieber werden sich mit hoher Wahrscheinlichkeit stark ausbreiten. Aber auch die Ernährung wird massiv betroffen sein.

Es wird erwartet, dass der Klimawandel direkte Effekte auf die Qualität und Quantität der Ernteerträge hat. In der Sahelzone und Westafrika reichen bereits plus 1,5 °C, um die Ernteerträge drastisch zu senken, bei Mais z.B. um 40 %. Noch stärker sind die Auswirkungen auf die Ernährungslage der Menschen in den Savannen und Trockengebieten des südlichen Afrikas. Aber auch Südostasien wird massiv betroffen sein. Eine so fortgesetzte Klimapolitik ist damit als ein neokolonialer Krieg gegen die Menschen im Globalen Süden zu betrachten.

Die Verbrechen an der Menschheit und dem Leben auf der Erde werden bewusst in Kauf genommen. Die Überwindung der Klima-Verbrechen widerspricht der Logik des Profits (die heute nur noch auf die nächsten Quartalszahlen schaut) sowie der der Politik (die nicht über die nächste Wahlperiode und die Erhaltung der Welt der Waren hinausschauen kann). Das gleiche gilt für andere Angriffe auf die Grundlagen des Lebens auf der Erde. Eine Lösungsperspektive sehen wir in einem radikalen, gesellschaftlichen Bruch mit Herrschaftssystemen wie Staat und Kapitalismus.

Surface Mining Hambach 200800806.jpg

Mit der Entwicklung eines Guten Lebens für alle weltweit gilt es, die Bedürfnisse der Menschen von den Warenverhältnissen zu lösen. Dass bedeutet auch gesellschaftlich die für den Kapitalismus grundlegende patriarchale Abspaltung der Reproduktion des Care-Berichs zu überwinden, gesellschaftlich die Re_Produktion zu organisieren. Die Erfahrungen der Menschen aus den massiven Kämpfen im Globalen Süden und die dezentral-praktischen Ansätze im Sinne des Anarcho-Kommunismus und des Anarcha-Feminismus, Ansätze zur Befreiung vom Geld und Eigentum, Commonismus, sowie die Radikale Ökologie scheinen uns hilfreich, eine Welt jenseits der Warenlogik zu entfalten, in der viele Welten Platz haben (wie die Zapatistas aus Chiapas, Südmexiko sagen).

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikquellen          :

Oben           —         Schaufelradbagger in der Grube beim Hambacher Forst. Links zu sehen ist ein Demo-Transparent. Aufgenommen während der Anti-Kohle-Demo vom 06.10.2018.

Abgelegt unter APO, Kriminelles, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

Vorlage für Parteivorstand

Erstellt von DL-Redaktion am 19. Januar 2020

Anmerkungen zur Vorlage für Parteivorstand
Das LINKE Konzept für einen demokratischen Sozialstaat

Flag of Die Linke

Quelle          :         AKL

von Thies Gleiss

Die LINKE hat auf einer Gremiensitzung am 11. Januar einen Text mit dem Titel „Das LINKE Konzept für einen demokratischen Sozialstaat der Zukunft“ angenommen. Der Wortlaut findet sich hier:

Lucy Redler und ich haben diesen Text abgelehnt. Thies Gleiss hatte zur Sitzung einen schriftlichen Beitrag zur Kritik vorgelegt.

Auf vielfachen Wunsch soll er hier veröffentlicht werden.

Ich lehne diesen Text ab. Das wurde bei der ersten Debatte im Parteivorstand über die Rudimente eines solchen Textes ja schon deutlich. Wir haben im Erfurter Programm und in diversen Wahlprogrammen mehrfach unseren Katalog von sozialpolitischen Forderungen vorgetragen. Niemand identifiziert die LINKE mit anderen sozialpolitischen Inhalten.

Was in der steten öffentlichen Debatte ist, sind nicht diese Forderungen, die nicht schöner oder unansehnlicher werden, wenn sie um weitere ergänzt oder um einige gekürzt werden, sondern wie das Grundkonzept, das hinter solchen Forderungen steht, politisch durchgesetzt werden kann und welches gesellschaftliches Prinzip das bestehende ablösen soll.

Wir sollten deshalb unter dem Titel „Konzept…“ eine solche strategische Positionsbestimmung vornehmen. Das wäre gleichermaßen Bestätigung und Ergänzung unserer bisherigen Forderungen und Positionen.

Der Begriff „Sozialstaat“ ist kein linker Begriff, sondern ein sozialdemokratischer und auf Klassenzusammenarbeit ausgerichteter Begriff, wenngleich die einzelnen konkreten Inhalte einer staatlichen Sozialpolitik von den Linken natürlich aufgegriffen, verteidigt und erweitert werden. Die sozialen Bewegungen, wenn sie nicht nur sozialdemokratische Ideologie reproduzieren, benutzen „Sozialstaat“ auch nur als Anklage an diejenigen, die mit Spar- und Anti-Reformpolitik soziale Rechte und Errungenschaften beschneiden wollen und in der Regel gegen ihre eigenen moralischen Bekundungen verstoßen.

Ein linker Begriff wäre – wenn nicht das bewährte Wort „Sozialismus“ benutzt werden soll oder kann – die Idee einer „Solidarischen Gesellschaft“ als Alternative zu der unsolidarischen Klassengesellschaft des Kapitalismus. Diesen Begriff zu verwenden wurde auf der PV-Sitzung ja auch vorgeschlagen, von mir und auch von Daniela Trochowski.

Ein weiterer linker Begriff wäre ein Kanon von sozialen Rechten, für deren weltweite Einlösung gesellschaftliche Kämpfe und Bewegungen erforderlich sind.

Der Text eiert in dieser Frage gleich zu Beginn los, um dann auf Seite 2 in den Zeilen 26-27 vollends von einem „neutralen Staat“ auszugehen, der von links zu gestalten und zu benutzen sei. Dieses uralte Bild von Staat als Fahrrad, mit dem in beliebige Richtungen gefahren werden kann, ist ja auch von Harald Wolf schon mal kritisiert worden, vor ihm und ebenfalls auf dem Hintergrund realer Regierungserfahrung durch die linken GRÜNEN.

Das taucht dann immer wieder auf: Zeile 60ff; Zeile 80ff, Zeile 89ff;

Das Konzept einer Solidarischen Gesellschaft muss von uns im Gegensatz zu dieser etatistischen Orientierung als ein Projekt der Selbstermächtigung und der Wiederaneignung erklärt werden. Wir wollen die Warenproduktion und die Regulierung über den Markt immer weiter zurückdrängen zugunsten einer demokratisch geplanten Gebrauchswerteproduktion. Deshalb ist für uns der Privatbesitz an Produktionsmitteln als dominierendes gesellschaftliches Prinzip nicht hinnehmbar. Wir wollen Markt und Privatbesitz in allen das Leben der Menschen und die Natur maßgeblich beeinflussenden Sektoren immer mehr abschaffen. Das wird nicht ohne Konflikte und Kämpfe gehen, für die wir die Stärkung der politischen Rechte und Kampfmöglichkeiten der Arbeiter*innenklasse und ihrer Organisationen systematisch ausbauen wollen. Wir kämpfen für Wiederaneignung von Würde, Zeit, Zukunft und Wohlstand für die Menschen, denen all das vom Kapitalismus genommen wird – nicht als Unfall oder Krise, sondern als Normalzustand dieser Wirtschaftsordnung.

Gerade die drohende Klimakatastrophe zeigt, dass dabei sehr schnell und sehr radikal in die herrschende Eigentumsordnung eingegriffen werden muss. Es ist Tagespolitik und nicht ein von den kleinen Reformen getrenntes, weit entferntes Endziel.

Eine solche solidarische Gesellschaft kann sicher nicht durch die bestehenden nationalstaatlichen Grenzen beschränkt werden. Sie ist konkret, internationalistisch und nicht auf Versöhnung mit den bestehenden Verhältnissen, sondern auf deren weltweite Überwindung orientiert.

Zu den vielen konkreten Forderungen in dem Papier ist nicht viel zu sagen, außer, dass sie nicht entsprechend einer solchen Kampforientierung geordnet werden.

– Wir wollen die Lohnquote erhöhen. Das ist der zentrale Inhalt unserer Forderungen nach besseren Löhnen, Transferzahlungen und Renten. Das ist die zentrale Achse der Wiederaneignung von Einkommen.

– Wir wollen die Zeit, in der das Kapital die Arbeitskraft ausbeuten kann, reduzieren. Wir sind deshalb für radikale Arbeitszeitverkürzungen für alle und zwar täglich, wöchentlich, jährlich und bei der Lebensarbeitszeit. Das ist für uns die zentrale Achse der Wiederaneignung von Zeit, die wir für Sorgearbeit, Bildung und gesellschaftspolitische und kulturelle Teilhabe zur Verfügung haben wollen.

– Wir wollen umfängliche demokratische Rechte, insbesondere ohne Überwachung und für politische und gewerkschaftliche Selbstbestimmung, Das ist für uns die zentrale Achse der Wiederaneignung von Würde.

– Wir wollen eine weltweite solidarische und gewaltfreie Politik, ohne Rüstung, Armeen und Kriege. Das ist für uns die zentrale Achse der Wiederaneignung von Zukunft für uns und unsere Kinder.

Der bestehende Staat, selbst wenn er wieder sozialer werden würde, was aus guten Gründen der realen kapitalistischen Entwicklungsgeschichte nicht freiwillig geschehen wird, ist ein Klassenstaat. Wir wollen ihn überwinden zugunsten einer sich selbst organisierenden und demokratischen Gesellschaft.

Das müsste als Essenz eines Papiers zur Zukunft des Sozialstaats erkennbar sein. Der vorliegende Entwurf bemüht sich noch nicht einmal darum, sondern erzeugt Illusionen.

Der reale Stand der Klassenkämpfe und der Zeitpunkt des Jahreswechsels wären ein guter Rahmen für eine dementsprechende Weiterentwicklung der Positionen der LINKEN.

01.01.2020  Thies Gleiss

akl - Antikapitalistische Linke


Grafikquelle       :            Flag of Die Linke

  • Public DomainThis image contains content which may be subject to trademark laws.view terms
  • File:Flag of Die Linke.svg
  • Created: ‎04‎ ‎July‎ ‎2018   


Abgelegt unter Berlin, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Der Brand im Krefelder Zoo

Erstellt von DL-Redaktion am 16. Januar 2020

Brand im Krefelder Affentropenhaus:
Weshalb die Lüge in der Pressekonferenz?

Krefelder Zoo Eingang.jpg

Quelle       :      Scharf        —     Links

Von Edith Bartelmus-Scholich

Am vergangenen Sonntag konnte ich mich persönlich davon überzeugen, wie die Leitung des Krefelder Zoos mit kritischen Fragen zu dem verheerenden Brand in der Silvesternacht umgeht. Ein Grüppchen Linker unter ihnen der  Vorsitzende der Linksfraktion im Krefelder Rat, Basri Cakir, verteilte an Passanten vor dem Zoo ein Flugblatt mit Fragen zum Brandgeschehen.  Es ging dabei u.a. um die fehlenden Brandmelde- und Brandschutzeinrichtungen und darum, ob andere Tiere im Krefelder Zoo ausreichend gegen einen Brand geschützt seien. Auch wurde auf die Möglichkeit als Bürgerin oder Bürger im Stadtrat Fragen dazu an die Verwaltung zu stellen, aufmerksam gemacht.

Kurz nach Beginn des Verteilens gesellte sich die Polizei zu den Linken.  Beschäftigte des Zoos hatten sie gerufen und wünschten sich, dass die Verteilaktion unterbunden werden sollte. Da es dafür aber keine rechtliche Handhabe gab, sprachen die Polizeibeamten keinen Platzverweis aus und untersagten auch nicht die Verteilung des Flugblatts, sondern beließen es bei der Aufnahme der Personalien und einer freundlichen Mahnung nicht aufdringlich zu verteilen.

Kritische Fragen gefallen der  Zooleitung offenbar nicht

Das muss wohl auch schon auf der Pressekonferenz von Zooleitung, Stadt, Feuerwehr und Polizei nach dem durch eine Himmelslaterne verursachten Brand im Affentropenhaus des Krefelder Zoos am 1.1. um 12.00 Uhr so gewesen sein. Auf die konkrete Frage eines Journalisten, ob denn Tiere hätten erlöst werden müssen, antwortete der Zoodirektor, dass dies nicht der Fall gewesen war. (1) Alle anderen Vertreter im Podium der Pressekonferenz  wussten wohl was wirklich der Fall  war, sahen aber keinen Anlass ihrerseits  die Wahrheit zu sagen.

Heute wurde die Zooleitung von dieser Unwahrheit eingeholt. Die Polizei erstattete gestern ihrem Dienstherrn, dem Innenminister des Landes NRW, wahrheitsgemäß Bericht: Etwa zwei Stunden nach dem die Feuerwehr den Brand um 4.40 Uhr für gelöscht erklärt hatte, habe eine Tierärztin zwei schwerverletzte Menschenaffen, je einen weiblichen Gorilla und Orang-Utan einschläfern müssen. Bei einem männlichen Gorilla, dem Silberrücken Massa, habe das Medikament nicht gewirkt und daraufhin sei der Gorilla von einem Polizisten mit mehreren Schüssen aus einer Maschinenpistole getötet worden.

Ein genauer Blick in die Live-Aufzeichnung der Pressekonferenz am 1.1. um 12.00 Uhr wirft noch weitere Fragen auf (1). Die Feuerwehrleitung erklärt sehr beflissen in Richtung Zooleitung, dass die fehlenden Brandmelder dieser nicht angelastet werden können, weil sie im Baujahr 1975 nicht vorgeschrieben waren. Außerdem seien Brandmeldeeinrichtungen in einem Affentropenhaus aufgrund des hohen Staubaufkommens nicht praktikabel wurde sinngemäß erklärt. Irritierend ist hier allerdings, dass es solche Anlagen in anderen Zoos in Deutschland durchaus gibt.

Im Nachhinein gewinne ich den Eindruck als ob schon im Rahmen der Pressekonferenz ein Mitverantwortlicher für die Katastrophe von einem anderen Mitverantwortlichen entlastet werden sollte – und das gegenseitig.

Auch die Feuerwehr muss sich einigen Fragen stellen

Zunächst ist zu klären, ob der Feuerwehr Pläne des Affentropenhauses vorlagen. Diese hätten nämlich Aufschluss darüber gegeben, dass das Gebäude zu großen Teilen aus einem massiven, mehrgeschossigen Betonkern bestand, der durch Versorgungsgänge zugänglich gewesen wäre. Der sogenannte Vollbrand konnte so gar nicht das ganze Haus erfassen, was bereits dadurch bewiesen ist, dass zwei Schimpansen das Feuer leicht verletzt in einem Gang des Betonkerns überlebt haben.

Wie vollkommen falsch die Feuerwehr das Gebäude eingeschätzt hatte, zeigt sich schon daran, dass sie rasch erklärte, in dem Haus hätte kein Tier überlebt. Entgegen dieser Einschätzung wurden am nächsten Morgen nicht nur zunächst die drei schwerverletzten, sondern gegen 8.00 Uhr auch zwei leicht verletzte Tiere gefunden.  Es bleibt deshalb zu klären, ob, falls Menschen in Schutzkleidung das Haus über die Versorgungsgänge im Betonkern betreten hätten um auch von innen zu löschen, nicht mehr Affen hätten gerettet werden können. Die Entscheidungen der Feuerwehr nur von außen zu löschen, aber mit Schusswaffen bewaffnete Polizisten zum Schutz vor eventuell ausbrechenden Tieren anzufordern, erfordert dringend eine detaillierte Untersuchung. Wissen wollen nicht nur Tierschützer, ob die Feuerwehr einen Brand in einem Gebäude in dem sich „nur“ Affen aufhalten etwa grundsätzlich von außen löscht.

Die Stadt als Mitverantwortliche

74,9% der Anteile des Zoos sind in städtischer Hand, 25,1%  halten die Zoofreunde. OB Meyer war damit nicht nur auf der Pressekonferenz um als Stadtoberhaupt sein Mitgefühl auszusprechen. Fragen, welche Mitverantwortung denn die Stadt trägt ob als Hauptanteilseigner oder über ihre Ämter auch als Aufsichtsbehörde, zum Beispiel bei der fatalen Entscheidung das durch Hagelschlag beschädigte Glasdach durch ein leicht entflammbares Kunststoffdach zu ersetzen, werden noch kaum diskutiert. Auch gibt es keine Debatte darüber, ob denn die Finanzausstattung des Zoos durch die Stadt vielleicht unzureichend war und so Missstände befördert hat. Weiter sollte endlich die städtische Entscheidung gegen Feuerwerksverbotszonen revidiert werden. Diese Debatten und die passenden Schlussfolgerungen sind nötig, wenn Katastrophen wie der Brand des Affenhauses sich nicht wiederholen sollen.

Noch bevor diese Sachverhalte aber bewertet werden, sollte OB Meyer den Krefelderinnen und Krefeldern erklären, wieso er es zugelassen hat, dass in seiner Gegenwart, die Öffentlichkeit in der genannten Pressekonferenz durch eine bewusste Lüge getäuscht wurde. Fake News von offizieller Seite untergraben das Vertrauen der Bürgerinnen und Bürger in ihre Institutionen.


Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen         :

Oben          —       Bildbeschreibung: Eingang Zoo, Krefeld Quelle: selbst fotografiert Datum: 18.06.2006 Fotograf/Zeichner: DER UNFASSBARE


2.) von Oben      —       Das Gehege der Schimpansen im Krefelder Affentropenhaus (2010)


Unten        —            Scharf –  Links   —   Bildmontage  HF

Abgelegt unter Innere Sicherheit, Nordrhein-Westfalen, Positionen, Überregional | Keine Kommentare »

Urteile – Hambacher Forst

Erstellt von DL-Redaktion am 14. Januar 2020

Sechs Monate zu Unrecht im Knast

Ende Gelände Nord-Süd-Bahn blockade 23-06-2019 39.jpg

Die Chorsänger des Knabenchor

Aus Aachen von Bernd Müllender

Die juristische Aufarbeitung der Hambach-Besetzung dauert an. Harte Urteile der ersten Instanz werden vom Landgericht kassiert.

Die Angeklagte kommt ganz in Schwarz. Toni H., 20, ist von ihrem Wohnort Rostock zum Amtsgericht Aachen angereist, wo gegen sie verhandelt wird. Im September 2018 hatte sie die Menschen am besetzten Hambacher Wald in ihrem Wohnwagen mit Essen versorgt. „Solidarisches Kochen“ hieß das. Bei einer Polizeikontrolle gab H. ihre Personalien an, durchaus korrekt, aber ohne einen Ausweis vorlegen zu können. Deshalb musste sie ins Polizeipräsidium Aachen, zur ID-Feststellung.

Dort versuchte H. zu verhindern, dass ihre Fingerabdrücke genommen wurden. Dabei soll sie versucht haben, einen Polizisten ins Bein zu beißen. Der junge Staatsanwalt spricht bei der Verhandlung von „körperlicher Misshandlung“ und „tätlichem Angriff auf einen Amtsträger“.

Das Verfahren ist eines von etlichen, die seit der rabiaten Waldräumung mit Tausenden Einsatzkräften im September 2018 gegen Protestierende im und rund um den Hambacher Forst laufen. Immer wieder landeten Aktivistinnen und Aktivisten in U-Haft, teils lange. Meist lauten die Vorwürfe: Widerstand gegen die Staatsgewalt oder Körperverletzung.

Am Freitag sind die beiden als Zeugen geladenen Polizeibeamten der Wahrheitsfindung vor Gericht wenig dienlich. Der eine kann sich nicht erinnern, ob er wirklich dabei war („da waren so viele …“), der andere nur an das Gefühl von H.s Mund an seinem linken Oberschenkel, als sie neben ihm hockte. Wunde? Gebissabdruck? Nein. Hose kaputt? Auch nicht. Der Staatsanwalt wiegelt ab: Normal sei eine „Nulltoleranzstrategie bei Angriffen auf Vertreter des Staates“, aber in diesem „absoluten Ausnahmefall“ könne man es auch beim Tatbestand der einfachen Widerstandshandlung belassen. Der Richter nickt: „Fünf Sozialstunden?“ – „Na, zehn sollten es schon sein.“ Urteil: Zehn Sozialstunden. Nach 45 Minuten ist der Spuk vorbei.

Eine unbekannte Zahl an Verfahren

Selten gehen Verfahren um den Hambacher Wald, der dem Braunkohle-Abbau im Tagebau Hambach im Weg steht, so glimpflich aus. Wie viele es genau gibt, weiß niemand, auch weil sie nach Jugendstrafrecht oft am Wohnsitzort stattfinden, nicht am Tatort. Viele der vorläufig Festgenommenen waren noch keine 21 Jahre.

Eine der bekanntesten Gefangenen, die sich „Eule“ nennt, war wegen versuchten Tretens nach einer Polizeibeamtin von Richter Peter Königsfeld zunächst zu neun Monaten Haft ohne Bewährung verurteilt worden. Königsfeld diagnostizierte „erhebliche schädliche Neigungen“ – ein Begriff aus lange vergangenen Zeiten.

Eule saß inklusive U-Haft über ein halbes Jahr ein. Das Landgericht Köln kassierte erst die Haft und im Mai das Urteil. Stattdessen verfügte das Gericht drei Wochen Jugendarrest, die durch die Haft abgegolten waren. Zudem habe Eule binnen sechs Monaten 40 Sozialstunden abzuleisten, möglichst im Bereich Umwelt- und Naturschutz.

Bei der jungen Frau soll es sich, so hatte das Landgericht per Fotoabgleich mit dem Berliner Einwohnermeldeamt herausgefunden, um die 19 Jahre alte Paula W. handeln. Die Gutachterin in Kerpen hatte sie nach umfänglichen Untersuchungen zu 79,8 Prozent Wahrscheinlichkeit als 21 oder älter geschätzt. Die 20,2-Prozent-Jugendliche äußerte sich nicht zur Identität. Dadurch entging ihr Haftentschädigung. Auch sonst war sie wenig kooperativ: Ein langes taz-Interview im Mai gab sie nicht frei, weil ihr einzelne Passagen nicht passten.

Wo steckt „Eule“?

Was aus Eule wurde, weiß weder die Gefangenenbetreuungsorganisation Anarchist Black Cross Rhineland noch ihr Anwalt Christian Mertens: „Nach Rechtskraft eines Urteils bin ich rechtlich raus.“ Weder das Landgericht, die Staatsanwaltschaft Köln noch das Amtsgericht Kerpen konnten oder wollten auf taz-Anfrage Auskunft geben, was aus den Sozialstunden geworden ist.

Baumhaus,Hambacher Forst,NRW.jpg

Dem Hambacher Wald geht es derweil nach zwei Sommern extremer Trockenheit nicht gut. Bagger des Energiekonzerns RWE haben ihre Schneisen bis auf 50 Meter an das Gehölz herangetrieben und verharren als ständige Drohung in der Nähe. Die Räumung diente, wie anhand von Regierungsdokumenten längst belegt ist, nicht dem vorgeschobenen Brandschutz der Baumhäuser, sondern allein, um Platz für die Kettensägen zu machen.

Quelle        :         TAZ         >>>>>          weiterlesen


Grafikquellen         :

Oben         —           Blockade der Nord-Süd-Bahn durch Ende Gelände am Kraftwerk Neurath am 23. Juni 2019.


Unten        —              Baumhaus der Widerstandskämpfer, die sich gegen die Zerstörung des Hambacher Forsts einsetzen

Abgelegt unter APO, Köln, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

CDU Politiker schießt scharf

Erstellt von DL-Redaktion am 10. Januar 2020

Mann in Köln von Politiker angeschossen

Von Andreas Wyputta

In Köln schießt ein Lokalpolitiker einen 20-Jährigen an – und legt sein Mandat erst nach tagelangen Protesten nieder.

Der Kölner CDU-Lokalpolitiker, der Ende Dezember einen 20-Jährigen mit einem Schuss aus einem Revolver verletzt hat, lässt jetzt immerhin sein Mandat in der Bezirksvertretung ruhen. Das erklärte der Stadtverband der Christdemokraten in einer Mitteilung.

Kölns CDU-Parteichef Bernd Petelkau, der auch Vorsitzender der Stadtratsfraktion und Abgeordneter im nordrhein-westfälischen Landtag ist, betonte darin aber, es gelte „für die Beteiligten die Unschuldsvermutung“. Er hoffe auf schnelle Ermittlungsergebnisse, „damit rasch Klarheit entsteht, was sich tatsächlich zugetragen hat“.

Dem Lokalpolitiker, der für die Christdemokraten bisher in der Bezirksvertretung des Stadtteils Porz saß, wird vorgeworfen, einem 20-Jährigen in der Nacht vom 29. auf den 30. Dezember in die Schulter geschossen zu haben. Der 72-jährige Schütze soll dabei alkoholisiert gewesen sein. Auslöser der Schießerei am Porzer Rheinufer könnte ein banaler Streit über Lärm gewesen sein – um kurz nach Mitternacht soll sich der Christdemokrat von dem Opfer und dessen 21, 22 und 23 Jahre alten Begleitern gestört gefühlt haben.

In Onlinenetzwerken wird spekuliert, die Schüsse könnten auch einen rassistischen Hintergrund gehabt haben. Das Opfer habe einen osteuropäischen Migrationshintergrund, heißt es dort. Außerdem soll der Schütze auf Facebook regelmäßig rechtspopulistische, an das Umfeld der AfD erinnernde Beiträge geteilt haben.

Stadtbild Köln (50MP).jpg

Fünf scharfe Waffen

Im Haus des CDU-Senioren fand die Polizei fünf scharfe Schusswaffen. Der Mann, der vorübergehend festgenommen wurde, ist auch Sportschütze. Die Staatsanwaltschaft, die zunächst eine Mordkommission gegründet hatte, ermittelt mittlerweile nur noch wegen des Verdachts auf gefährliche Körperverletzung.

Quelle            :          TAZ          >>>>>          weiterlesen


Grafikquellen           :

Oben         —        Köln  –  Porzer Innenstadt

Autor      Arminia

  • CC BY-SA 3.0Hinweise zur Weiternutzung
  • File:Innenstadt-Köln-Porz.JPG
  • Erstellt: ‎9‎. ‎Oktober‎ ‎2004



 Unten             —     City center of Cologne, Germany.

 © Thomas Wolf, (CC BY-SA 3.0 DE)

Created: ‎28‎ ‎August‎ ‎2017

Abgelegt unter Innere Sicherheit, Köln, P.CDU / CSU, Regierungs - Werte, Überregional | Keine Kommentare »

Die Macht ist männlich

Erstellt von DL-Redaktion am 10. Januar 2020

„Nicht die Genossinnen müssen sich ändern, sondern die Spielregeln….“

Youth 2030 - The Image of the Future panel session2.jpg

Quelle        :         Scharf   —   Links

Ein Beitrag vom Sprecherinnenrat LISA NRW

2020 sind in NRW Kommunalwahlen. Hier lohnt sich ein Blick auf die bisherigen Strukturen:

  • Beim Frauenanteil an den Mandaten der Kreistage und der Gemeinderäte in NRW zeigen sich große Unterschiede: Während der Kreistag von Höxter mit 14 % den geringsten Frauenanteil hat, sind in Dortmund 39 % der Mandatsträger*innen weiblich. Insgesamt ergibt sich ein Schnitt von 30 % Frauenanteil in den Kommunalparlamenten in NRW. Die Höhe des Frauenanteils hängt übrigens nicht unbedingt davon ab, wie städtisch die Region ist. So weist Borken einen Frauenanteil von 38 % aus, in der kreisfreien Stadt Solingen lassen sich die Bürger*innen nur von 27 % Frauenanteil im Gemeinderat vertreten lassen.
  • In NRW regieren in 396 Kommunen Ober- oder Bürgermeister*innen und in 31 Landkreisen Landrätinnen und Landräte. In Zahlen: 45 der 373 Bürgermeister*innen sind weiblich. Unter den 23 Oberbürgermeister*innen gibt es nur eine Frau, in Köln. Die 31 Landkreise werden ebenfalls bis auf eine Ausnahme (Soest) von Männern regiert.

So überrascht es nicht, dass auf der ver.di-Landesbezirksfrauenkonferenz NRW folgender Antrag zur Abstimmung kam und angenommen wurde:

„Die Hälfte der Erde, die Hälfte des Himmels, die Hälfte der Macht – Parität auch im Parlament!

ver.di setzt sich für ein Paritäts-Gesetz mit verbindlichen Frauenquoten bei der Aufstellung von Wahllisten ein. Ein Paritäts-Gesetz soll alle Parteien verpflichten:

  • ihre Wahllisten abwechselnd mit einer Frau und einem Mann zu besetzen
  • weitergehend in ihren Statuten einen verbindlichen Frauenanteil von 50 Prozent für alle parteilichen Funktionen und Mandate aufzunehmen
  • bei den Direktkandidaturen im Wahlkreis/Stimmkreis Frauen und Männer in gleicher Zahl aufzustellen und auf chancenreiche Listenplätze zu setzen
  • eine innerparteiliche Kultur z.B. hinsichtlich Kommunikation, Sitzungsabläufen und Führungsverhalten zu fördern,  die es Frauen erleichtert und ermöglicht, Funktionen und Mandate zu übernehmen“

Wir beziehen uns auf die letzte Forderung des Beschlusses und überlegen, was das für uns als Partei bedeutet.

Frauen sind in der Politik unterrepräsentiert, sind weniger in Parteien aktiv bzw. erscheint ihnen politische Arbeit nicht attraktiv. Anders sieht es im Ehrenamt aus: Vor allem Frauen mit Kindern im Haushalt sind freiwillig engagiert. 54 % der Frauen zwischen 25 und 54 Jahren mit Kindern arbeiten ehrenamtlich – vor allem in Schule, KiTa, Religion und Kirche sowie im gesundheitlichen und sozialen Bereich. Bei den gleichaltrigen Männern sind es 52,2 %, auch mit Kindern im Haushalt. Hier sind es eher die Bereiche Sport, Politik, Unfall- und Rettungsdienst und bei der Freiwilligen Feuerwehr.

Ist also das Interesse von Frauen an Politik weniger ausgeprägt als bei Männern? Ein Blick auf die Wahlbeteiligung zeigt, dass diese These wenig aussagekräftig ist. Bei Kommunal-, Landtags- und Bundestagswahlen gibt es in der Wahlbeteiligung von Männern und Frauen keine großen Unterschiede.

Die Linke – eine feministische Partei?

Die Linke versteht sich als sozialistische und feministische Partei, die patriarchale und kapitalistische Verhältnisse überwinden will. So steht es im Programm. Wir Linke haben eine Vision einer gerechten Gesellschaft, die sich von allen anderen Parteien abhebt. Das gilt auch für unsere Vision der Gleichstellung von Frauen und Männern. Das heißt nicht, dass Frauen am herrschenden Männerbild gemessen werden, sondern Gleichstellung für alle und alles: Wir wollen Lebenszeit, Lohn- und Sorgearbeit, Zeit für Politik, Freund*innen, Bekannte, Familie und die eigene Weiterentwicklung gerecht zwischen den Geschlechtern verteilen. Dazu fordern wir eine radikale Verkürzung der Arbeitszeit für ein gutes Leben für alle.

Inhaltlich lässt das Programm also viel Raum für feministische Interventionen und politische Einmischung von Frauen: Aber: der Frauenanteil am 31.12.2018 beträgt 36 %, entspricht also nicht dem Anteil von Frauen an der Bevölkerung, der ca. 51 % beträgt. In NRW haben wir einen Frauenanteil von nur 29 %. Warum ist das so? Warum sind in der Linken weniger Frauen organisiert als Männer, warum wählen weniger Frauen die Linke?

Einschub: das gilt nicht für die Gewerkschaftsmitglieder: Hoffnungsvoll macht, dass bei den Bundestagswahlen 2017 10 % der männlichen Gewerkschaftsmitglieder die Linke gewählt haben und bei den weiblichen Gewerkschaftsmitgliedern 13 %. Das ist auch ein Ergebnis unserer Politik der vergangenen Jahre, bei der wir in Arbeitskämpfen präsent waren, wie etwa an Kliniken, bei denen wir mit für eine bessere Personalausstattung in Krankenhäusern gekämpft haben.

Um dem Anspruch gerecht zu werden eine feministische Partei zu sein, hat die Linke Instrumente entwickelt. Wir haben Doppelspitzen aus Frauen und Männern in der Bundestagsfraktion und in der Partei auf Bundesebene und in fast allen Ländern. Alle Gremien sind nach Geschlecht quotiert, wir führen quotierte Redelisten. Bei jedem Parteitag findet ein Frauenplenum der weiblichen Delegierten statt, bei der sich die Genossinnen über wichtige Punkte verständigen. Außerdem haben wir in fast allen Landesverbänden eine eigene feministische Struktur. Bei uns in NRW ist es LISA. In diesen feministischen Strukturen können sich Frauen vernetzen, kreativ sein, Spaß an der Politik haben und gemeinsam Projekte entwickeln.

Das alleine reicht allerdings nicht aus. Zwar werden Kreisvorstände quotiert gewählt – zur Not bleiben die sogenannten Frauenplätze frei – über Jahre. Hier gibt es Lücken, die zu schließen sind. Wir haben eine Satzung, die fortzuentwickeln ist. Nicht nur die Parteistruktur auch die Parteikultur muss feminisiert werden.

Was muss passieren, damit sich mehr Frauen in und für die Linke engagieren?

In NRW haben wir dazu Veranstaltungen gemacht und die Genossinnen folgendes gefragt:

  1. „In unserer Partei gibt es genügend Situationen, in denen Politik Spaß macht. Ich habe ausreichend Gelegenheit, mich konstruktiv einzubringen.“ Hier konnte gepunktet werden auf einer Skala von 1 bis 10. Die Punkte waren gleichmäßig verteilt zwischen 2 und 9 Punkten, also durchweg gemischt.
  2. „Politische Termine (Gremiensitzungen u.a.) sind so organisiert, dass ich sie gut und gerne wahrnehmen kann. Ich kann politisches Engagement gut in Balance bringen mit meinem Alltag und anderen mit wichtigen Themen.“ Hier wurde fast nur zwischen 0 (keine Zustimmung) und 5 gepunktet. Nur ein Punkt fand seinen Platz bei 8.
  3. „Ich finde die Regeln zur Gleichstellung wie Quotierung der Funktionen, quotierte Redeliste, offiziellen Sprachgebrauch sinnvoll und gut.“ Hier gab es nur Punktevergaben zwischen 8 und 10 (volle Zustimmung)
  4. „In der LINKEN erlebe ich eine feministische Kultur über die Formalien hinaus. Die Genossen verhalten sich meist emanzipiert. Ich erlebe wenig tradierte Verhaltensweisen wie männliche Dominanz (Gesprächsanteile, Mansplaining usw.). Die meisten Frauen bringen sich aktiv ein. Insgesamt erlebe ich die Gesprächs-/Debattenkultur als wertschätzend, partizipativ und solidarisch.“ Hier wurden alle Punkte gleichermaßen von 0 (keine Zustimmung) bis 5 gepunktet.

Was können Ansätze sein?

Wir wollen eine andere Sitzungskultur entwickeln. Wir brauchen eine Sitzungskultur, an der auch Frauen, die ja meistens zu Hause die Sorgearbeit erledigen, teilnehmen können. Da gibt es ganz profane Dinge wie eine Kinderbetreuung, die vorhanden sein muss. Und zwar eine gute Kinderbetreuung mit ausgebildetem Personal, vernünftigen Räumen und einem Spielplatz in der Nähe. Und die Genossen können an sich und der Debattenkultur arbeiten. Männer haben ja – nicht nur bei uns – auch die Angewohnheit, das zu widerholen, was die Vorrednerinnen gesagt haben oder sich nur auf Männer zu beziehen. Viele Genossinnen haben sich angewöhnt, dies auf den Sitzungen zu thematisieren. Es gilt, eine andere Sicht auf unsere Sitzungen und Veranstaltungen zu entwickeln. Noch immer gibt es Veranstaltungen, die nicht quotiert besetzt sind und bei denen dann eine Genossin als Moderatorin als Alibi genutzt wird. Dass muss aufhören. Wir haben genug fähige Genossinnen, die zu allen Themen Stellung nehmen können. Und Befähigung muss nicht an eine formale im Bildungssystem erworbene Qualifikation gebunden sein.

Wir schlagen vor, gemeinsam Methoden zu finden, die nicht mehr auf Konkurrenz  untereinander und Personalisierung von Erfolgen ausgerichtet sind, sondern auf Kooperation und Versachlichung. Dazu müssen wir gemeinsam neue Praxen entwickeln, die es Mitgliedern leicht machen gleichberechtigt mitzuarbeiten, sich dabei politisch zu entwickeln und nicht zuletzt auch Spaß an der politischen Arbeit zu haben. Hilfreich könnte dabei eine Enthierarchisierung der Arbeitsweise in der Partei wirken: Arbeitsgruppen statt aufgeblähter Vorstände, Mitglieder ermächtigen sich selbst für ein politisches Projekt….Die sozialen Bewegungen zeigen uns schon lange, wie so etwas geht.

Also: auch bei uns müssen die von Genossen über Jahrzehnte geprägten Strukturen verändert werden. Dazu gehören andere Sitzungszeiten, Angebote für Kinderbetreuung, ein Verzicht auf Hinterzimmerpolitik und eine kooperative Arbeitsweise. Nicht nur die Genossinnen, auch die Genossen können davon profitieren.

Und, was hat das alles mit unserer Strategie zu tun? Wir meinen sehr viel: Eine Partei, die ihre politischen Grundsätze nach innen umsetzt wirkt glaubwürdig, zieht Frauen (und Männer) an und verändert die Lebensrealität schon Stück für Stück durch ihre tägliche Praxis.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle           :       19th World Festival of Youth and Students. Youth 2030: The Image of the Future panel session

Abgelegt unter Linksjugend, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Stadthespräch aus Berlin

Erstellt von DL-Redaktion am 10. Januar 2020

Auf ein kurzes Gedächtnis setzen

Carsten Linnemann CDU Parteitag 2014 by Olaf Kosinsky-1.jpg

Wenn denn noch eines vorhanden ist – bei einen solchen Luftblasenwerfer.

Von Malte Kreutzfeldt

Einen „Dieselskandal“ habe es nie gegeben, meint Unions-Fraktionsvize Carsten Linnemann. Realitätsverweigerung hebt er auf eine neue Stufe.

Dass Carsten Linnemann der deutschen Umwelt- und Klimapolitik eher ablehnend gegenübersteht, ist kein großes Geheimnis. Regelmäßig schimpft der Vorsitzende der CDU-Mittelstandsvereinigung und Vizechef der Unionsfraktion im Bundestag gegen das, was er als „klimapolitischen Aktionismus“ empfindet: Die CO2-Abgabe lehnte er mit Verweis auf die Wirtschaft ab, bei der Windenergie gilt er als entschiedener Verfechter einer umstrittenen Abstandsregelung, die den Ausbau noch weiter einbrechen lassen würde.

Mit der Wirklichkeit haben die Äußerungen des 42-jährigen Westfalen häufig nichts zu tun – etwa wenn er zum Klimaschutz erklärt: „Es bringt nicht viel, wenn wir alleine als Vorreiter vorangehen“, und ignoriert, dass Deutschland in der EU längst nicht mehr zu den klimapolitischen Vorreitern gehört.

Mit einem aktuellen Zitat zur Verkehrspolitik hebt Linnemann die Realitätsverweigerung jetzt aber auf eine ganz neue Stufe. Gegenüber der Deutschen Presse-Agentur gab er der SPD-Umweltministerin Svenja Schulze eine Mitschuld daran, dass der CO2-Ausstoß im Verkehr nicht gesunken ist. „Das Bundesumweltministerium hat die Deutsche Umwelthilfe bei ihrem Kampf gegen den Diesel unterstützt und so aus einem Betrugsskandal einen angeblichen Dieselskandal gemacht“, behauptet der Mittelstandschef. Und: „Auch weil die klimaschonende Dieseltechnologie unter Generalverdacht gestellt wurde, steigen die CO2-Emissionen im Verkehrssektor an.“

Die Aussage, dass Diesel klimafreundlicher als Benziner seien, ist im Grundsatz zwar nicht verkehrt. Doch gerade bei modernen Fahrzeugen ist ihr Vorteil hinsichtlich des CO2-Ausstoßes auf wenige Prozente geschrumpft. Der geringe Vorsprung wird auch leicht dadurch zunichtegemacht, dass Diesel oft stärker motorisiert sind.

Kurzes Gedächtnis

Hart aber fair 2018-10-08-8565.jpg

Vollständig absurd ist aber der erste Teil des Zitats. Denn der unterstellt nicht nur der Deutschen Umwelthilfe, die mit zahlreichen eigenen Tests eine entscheidende Rolle in der Aufdeckung der weit überhöhten Stickstoffwerte vieler Dieselfahrzeuge gespielt hat, einen „Kampf gegen den Diesel“. Sondern Linnemann spricht allen Ernstes von einem „angeblichen Dieselskandal“, der in Wahrheit nur ein „Betrugsskandal“ gewesen sei.

Quelle         :        TAZ          >>>>>         weiterlesen


Grafikquellen        :

Oben      —       Carsten Linnemann auf dem CDU Bundesparteitag Dezember 2014 in Köln

Abgelegt unter Bundestag, Nordrhein-Westfalen, P.CDU / CSU, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Auf Sraßen und in Betriebe

Erstellt von DL-Redaktion am 9. Januar 2020

Das Konkrete und die Utopie verbinden

Quelle      :     Scharf  —   Links  

Autor*innenkollektiv: Edith Bartelmus-Scholich, Iris Bernert-Leushacke, Helmut Born, Nina Eumann , Sylvia Gabelmann, Michaele Gincel-Rheinhardt, Inge Höger, Ulla Jelpke, Daniel Kerekes, Alexandra Mehdi, Sonja Neuhaus, Jasper Prigge, Bastian Reichardt, Kathrin Vogler, Sascha H. Wagner, Marion Wegscheider, Hubertus Zdebel, Wolfgang Zimmermann

Unsere Vision ist eine Gesellschaft, in der Menschen gut und gerne leben und in der sie die Möglichkeit haben, an Entscheidungsprozessen teilzuhaben und Veränderungen mitzugestalten. DIE LINKE muss Motor dieser Veränderung und eines gesellschaftlichen Umbruchs sein. Das funktioniert nur dann, wenn wir unsere Politik gemeinsam mit denen, die unzufrieden mit dem Status Quo sind, entwickeln und nach außen tragen. Denn dort liegen unsere Wurzeln, unsere politische Verankerung. DIE LINKE muss sich auf diese Wurzeln rückbesinnen und (wieder) Marke für soziale Gerechtigkeit sein. Unsere Forderungen und Konzepte sind gut, aber nützen niemanden, der sie nicht kennt. Das heißt: Auf die Straße, in die Betriebe, in die Stadtteile  – für eine LINKE, an der man nicht vorbeikommt und eine Welt, die wir uns selbst erschaffen!

Die Arbeiter*innenbewegung war lange Motor des Fortschritts: in ihr drückten sich Hoffnungen und Zuversicht auf eine bessere Zukunft durch gesellschaftlichen Fortschritt aus. Diese Hoffnung ist Teilen der Arbeiter*innenbewegung im 20. Jahrhundert abhandengekommen und wir müssen die Lust auf Zukunft wieder entdecken: Im Kapitalismus bedeutet  technologischer Fortschritt Ersetzung von menschlicher Arbeit durch Maschinen, heute durch Roboter, Computer oder andere Systeme der Digitalisierung. Wir wollen die Technik nutzen, damit die Menschen sich von entfremdeter Arbeit befreien können. Als ersten Schritt dorthin setzen wir uns für eine Verkürzung der Arbeitszeit, die jede Form von Arbeit auf Alle verteilt, ein. Das ist momentan die Forderung nach der 30 Stunden Woche bei vollem Lohn- und Personalausgleich, die wir verbinden mit der Forderung nach Kontrolle der Produktion und Dienstleitungen durch die Beschäftigten. Dies ist der erste Schritt für die Übernahme der Betriebe durch die Beschäftigten.  Wir müssen Ängste vor Erwerbslosigkeit ernst nehmen, aber wir müssen zeigen, wie Digitalisierung und/oder Maschinen die gesamtgesellschaftliche Arbeitszeit reduzieren und somit die Grundlage einer Arbeitszeitverkürzung bei vollem Lohnausgleich für alle legen.

Die Krisenhaftigkeit des Kapitalismus spitzt sich zu. Ausbeutung von Menschen und Natur, Kriege und Umweltzerstörung bedrohen die Zukunft des Planeten. Als Folge erleben wir eine Erosion des etablierten Parteiensystems, sowohl in Deutschland als auch überall in Europa. Die bisherigen sog. Volksparteien verlieren bei fast allen Wahlen an Zustimmung. Die AfD & andere rechte Organisationen gerieren sich als Herausforderer der Regierungen und der bisher etablierten Parteien. DIE LINKE wird bisher kaum wahrgenommen als Partei einer solidarischen und demokratischen Lebensweise, die Antworten auf die krisenhafte Zuspitzung des Kapitalismus geben kann.

Wir erleben aber nicht nur ein Erstarken der Rechten, sondern auch ein Erstarken von Bewegungen und gesellschaftlicher Opposition. Millionen folgen seit Monaten den Aufrufen von „Fridays for future“. Sie demonstrieren und streiken gegen die Herrschenden und verlangen einen radikalen Politikwechsel um den Klimawandel abzuwenden. Sie lassen sich nicht mit schönen Worten abspeisen und haben so das Klimapaket der Bundesregierung sofort als Mogelpackung entlarvt. Hunderttausende gehen für Seebrücke und #unteilbar, für Menschenrechte und humanen Umgang mit Geflüchteten auf die Straße. Es gibt unzählige Initiativen gegen Rechts und der Aufschrei gegen die Aberkennung der Gemeinnützigkeit der VVN-BdA ist groß. Bis vor kurzem war es undenkbar, dass eine Kampagne zur Enteignung von Immobilienkonzernen von einer breiten Mehrheit in der Bevölkerung getragen und vorangetrieben wird. Gewerkschaftliche Kämpfe mit neuen Forderungen nach Arbeitszeitverkürzung, Mindestpersonalbemessung und Aufwertung von sozialen Berufen, die Frauen*streiks zeigen eine neue Qualität von Klassenkämpfen.

Es kommt nun für DIE LINKE darauf an, an diese Bewegungen anzuknüpfen und sie zusammen zu führen. Es geht um organisierende Arbeit – verbinden, verbreitern, verankern. Das ist gut gelungen in der Kampagne für bezahlbaren Wohnraum in Berlin oder bei der Frage der Personalbemessung in Krankenhäusern. Eine verbindende Klassenpolitik muss an den Alltagsbedürfnissen der Menschen ansetzen und auf unmittelbare Verbesserungen abzielen. Das betrifft betriebliche Kämpfe für bessere Arbeitsbedingungen und Arbeitszeitverkürzung ebenso wie Kämpfe um die Reproduktionsbedingungen wie Gesundheit, Wohnen und Ökologie. DIE LINKE muss in all diesen Kämpfen eine radikale Perspektive aufzeigen und klar sagen, dass wir die kapitalistische Ausbeutung von Mensch und Natur überwinden wollen. Klimaschutz und soziale Gerechtigkeit sind keine Gegensätze sondern Klimaschutz ist eine soziale- und eine Klassenfrage. Die kapitalistische Produktion beruht auf der Ausbeutung von Mensch und Natur und zerstört Klima, Boden, Luft, Wasser. Auch die industrielle Nahrungsmittelproduktion trägt mit zur Zerstörung der Umwelt bei. Die Produktion von immer mehr Autos und Rüstungsgütern nutzen nur den Konzernen und zerstören die Umwelt. Das Privateigentum an Produktionsmitteln und die Konkurrenz auf dem Markt müssen von uns in Frage gestellt werden. In den akuten Auseinandersetzungen und Kämpfen zeigen sich immer auch die verheerenden politischen und sozialen Zustände aber auch reale Alternativen, die über die konkreten Kämpfe hinauszeigen und reale Utopien sichtbar machen.

Eine linke Strategie muss darauf zielen, immer und überall für Schritte der Verbesserung der Lebensverhältnisse der Menschen einzutreten und die tagespolitischen Kämpfe mit der Schwächung der Machthabenden bzw. der Kapitalfraktionen zu verbinden. DIE LINKE muss in diesen Kämpfen immer wieder die Ursachen benennen und daran anknüpfen. Das heißt auch immer den Kampf für Verbesserungen mit der Eigentumsfrage verbinden bzw. mögliche Utopien aufzeigen. DIE LINKE muss gemeinsam mit Bewegungen jene Themen finden und setzen, die nicht nur das Leben der Vielen im hier und jetzt verbessern würden, sondern die auch das Potential eines Bruchs mit dem Kapitalismus in sich tragen. Die Verbindung des Konkreten mit der Eigentumsfrage und einer transformatorischen Utopie kann die gesellschaftliche Hegemonie nach links verschieben, das Zeigen nicht zuletzt die Kämpfe von Deutsche Wohnen Enteignen, Fridays for future und vieler weiterer Initiativ

  • Der Kampf gegen den Klimawandel ist nicht möglich, ohne die kapitalistische Produktionsweise, die Jagd nach Mehrwert und Profiten in Frage zu stellen. Sozial-ökologischer Umbau erfordert als einen ersten Schritt  die Verstaatlichung der Schlüsselindustrien, beginnend mit den Energie- und dann den Automobilkonzernen.
  •  Im Kampf gegen Kriege und Aufrüstung und Rüstungsexporte fordern wir ein Verbot der Rüstungsproduktion den Umbau der Produktion für zivile Produkte unter gesellschaftlicher Kontrolle.
  • Den Kampf gegen die Luftverschmutzung durch den Autoverkehr führen wir für autofreie Städte, den Ausbau des ÖPNV und die Vergesellschaftung der Automobilindustrie und die Umstellung auf die Produktion von Bussen und Bahnen.
  • Den Kampf für ein selbstbestimmtes Leben führen wir mit einer klaren Haltung gegen jegliche Form von Sexismus, LGBTQ-Feindlichkeit und Rassismus. Für eine Gesellschaft, in der Geschlecht, sexuelle Orientierung, sexuelle Identität, Herkunft und Religion keine Diskriminierungsmechanismen mehr sind.
  •  Den Kampf gegen Mietenwucher und für bezahlbares Wohnen führen wir auch als Kampf für ein konkretes Recht auf Wohnen, für die Enteignung der Immobilienkonzerne und für die Vergesellschaftung von Grund und Boden, für kommunale Wohnungen.
  • Den Kampf für mehr Personal in Krankenhäusern und der Pflege verbinden wir mit der Forderung nach Rekommunalisierung aller Krankenhäuser und Pflegeeinrichtungen, der Organisierung eines öffentlichen Gesundheitswesens unter gesellschaftlicher Kontrolle.

Mitmachen in Parlamenten kann diese Kämpfe nur unterstützen, aber nie ersetzten. Deshalb ist es auch notwendig, die Parlamente nicht als Mittel zur Veränderung der gesellschaftlichen Kräfteverhältnisse zu sehen, sondern den Klassencharakter des Staates und der parlamentarischen Gremien zu entlarven. Wir müssen neue Formen von Demokratie entwickeln und in unserer Partei erproben, selbstermächtigend, basis- und rätedemokratisch. Wir entwickeln Demokratie neu in Zukunfts-, Wirtschafts- und Umwelträten.

Connewitzer Kreuz.jpg

Auf dem Weg dahin müssen wir lernen, die Parlamente zur Unterstützung der außer-parlamentarischen Kämpfe zu nutzen. Wir sollten Aktive aus der Klima- und Umweltbewegung, Betrieben und Gewerkschaften, aus den Kämpfen gegen Mietwucher und für soziale Gerechtigkeit in die Parlamente auf Bundes- und Landesebene entsenden und zwar zeitlich begrenzt. Sie sollen ihre Kämpfe in die Parlamente tragen und anschließend wieder zurückkehren in die Bewegungen, die Betriebe und Kommunen. Abgeordnete sollen sich nicht in parlamentarischen Regeln und Geschäfts-ordnungen verfangen, sondern mit der Basis und an der Basis aktiv sein und entsprechend in Parlamenten wirken. Dies gilt in ähnlicher Form auch für unsere Kommunalparlamente.

Zudem müssen wir für eine Partei kämpfen, in der sich Menschen gerne organisieren. Dafür muss es zu einem Bruch mit althergebrachter Redekultur und Organisationsformen kommen. Nicht die monatliche Mitgliederversammlung oder ein – angeblich – allmächtiger Kreisvorstand dürfen der Ausgangspunkt aller Aktivitäten sein. Vielmehr müssen wir diese Organe als Diskussions- und Ermöglichungsrunden verstehen, die es Aktiven in Aktiventreffen und Basisorganisationen erleichtern, eine verbindende Klassenpolitik nach außen zu tragen. Zudem muss an einer Debattenkultur gearbeitet werden, die nicht in Verlier*innen und Gewinner*innen unterteilt, sondern die geprägt ist vom gemeinsamen Wachsen und Lernen und alle Genoss*innen, unabhängig von Alter und Geschlecht, ernst nimmt. Erst eine solche Parteikultur wird zu einer langfristigen Stärkung unserer Partei führen und ihr Leben verleihen.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikqellen :

Oben         —            Scharf  –  Links         –    Bildmontage   HF


Unten       —           Connewitzer Kreuz (Kopie von 1994, Anfertigung Markus Gläser, Original im Stadtgeschichtlichen Museum)

paternité partage à l’identique Ce fichier est disponible selon les termes de la licence Creative Commons Attribution – Partage dans les Mêmes Conditions 3.0 (non transposée).
Attribution: Martin Geisler

Abgelegt unter Medien, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Die Oma ist viel cooler

Erstellt von DL-Redaktion am 7. Januar 2020

Die Umweltsau durchs Dorf treiben

2183Tom Buhrow.JPG

Jaaa – keine  Oma hat auch Staatsknete ohne  Leistung bezogen !
Das macht den Unterschied.

Kolumne von Jürn Kruse

Ein Kinderlied und eine Entschuldigung später fragt sich die abgehängte Landbevölkerung, was das nun wieder für ein Blödsinn war.

Wenn bei Twitter und Facebook wieder einmal (Umwelt-)Säue durchs Dorf getrieben werden, ist es schön, genau dort zu sein: auf dem Dorf. Denn hier auf dem Land, da sind sich doch alle einig, leben einfache, ehrliche Leute. Wo’s Internet ist schlecht, das Leben ist echt.

Ich glaube, dass WDR-Intendant Tom Buhrow dachte, genau diese einfachen Leute zu adressieren und ihnen aus der Seele zu sprechen, als er sich für die WDR-Kinderchor-Version von „Meine Oma fährt im Hühnerstall Motorrad“ (#Umweltsau, #Omagate, Sie wissen schon) „ohne Wenn und Aber“ entschuldigte.

Es begab sich aber zu der Zeit, dass ein Gebot meiner Eltern ausging, dass ich mich und meine Familie nach Weihnachten doch mal bei ihnen blicken lassen könnte, und so verfolgte ich die Umweltsau-Diskussion von der fernen nordfriesischen Tiefebene aus. Der Blick geht hier weit, die Windräder ragen majestätisch aus der Marsch, und da ward mir bewusst: 1.) Was da bei Twitter passiert, kriegt hier kein Schwein mit. 2.) Es interessiert die meisten auch nur so mittel (Merke: Shitstorms wegatmen). 3.) Meine Oma ist viel cooler als Tom Buhrow, Tom Buhrow, Tom Buhrow. Meine Oma ist ’ne alte Umweltsau!

Mary Lou Cook (1858230514).jpg

Gut, meine Oma ist vielleicht nicht cooler als Tom Buhrow. Meine Omas sind ja beide nicht mehr. Aber die Oma meiner Kinder, also meine Mutter, die saß mit am Frühstückstisch, als ich mich darüber ärgerte, dass ich in der vorangegangenen Nacht mindestens eine Stunde meines Lebens an Twitter und diese Umweltsau-Diskussion vergeudet hätte, anstatt sie sinnvoll zu verbringen: schlafend.

Frage meiner Mutter: „Was für eine Umweltsau-Diskussion?“ Ich fasse den Inhalt kurz zusammen. „Ja, stimmt doch alles“, sagt sie.

Quelle           :        TAZ          >>>>>          weiterlesen


Grafikquellen        :

Oben       —          Thomas “Tom” Buhrow (born 29 September 1958 in Troisdorf, Germany) is a German journalist.

Abgelegt unter Feuilleton, Köln, Kultur, Umwelt | Keine Kommentare »

Die Sonntags – Frage

Erstellt von DL-Redaktion am 4. Januar 2020

Wir alle sind Umweltsäue


Von Peter Unfried

Die „Umweltsau“-Debatte der vergangenen Tage verhüllt das eigentliche Kernproblem. Was wir aus ihr trotzdem für das Jahr 2020 mitnehmen können.

Die politische Großdebatte der vergangenen Tage war eine mutmaßlich mehrheitlich geheuchelte „Spektakelpolarisierung“ (Bernhard Pörksen) wegen eines Kinderchors, der in einer Fernsehsatire „Unsere Oma ist’ne alte Umweltsau“ sang. Dennoch kann man das nicht lapidar damit abtun, dass das eh gaga oder nur Twitter sei.

Diese „Umweltsau“-Debatte steht pars pro toto für die Verhüllung des Kernproblems (Klima­krise), die strategische Instrumentalisierung und Beförderung dysfunktionaler Gesellschaftsgespräche durch Gegner von Klimapolitik und die deshalb drängende Lösung der gesellschaftlichen Kommunikationskrise.

Es zu machen, wie Helmut Kohl Europa machte – volle Pulle, aber nicht darüber reden –, geht nicht. Wir müssen ein ernsthaftes Gespräch über das zentrale Problem hinbekommen. Das ist der zu Ende gehende CO2-Speicherraum in der Atmosphäre durch unser aller fossil befeuertes Wirtschaften und Leben. Die Antwort ist eine demokratische Mehrheit für den politischen Wechsel ins postfossile Wirtschaften. Eine gesellschaftliche Mehrheit, nicht eine parteipolitische.

Nun ist Oma (und Opa) im alten Denken tatsächlich eine Umweltsau, wenn das für nicht zukunftsfähige Wirtschafts- und Lebensweise steht. Aber die Enkelin und der Enkel auch. Mutti und Vati. Christ und Muslim. Konservativer, Liberaler, Linker und Grüner. Ocasio-Cortez und Trump. Rassist und Diskriminierte. In der physikalischen Realität sind Europäer (fast) alle „Täter“. Deshalb ist der erste und wichtigste Schritt, die eingeübte Kultur des Spaltens in Gute und Böse abzulegen.

Selbstverständlich handelt es sich auch um einen Generationenkonflikt. Aber eben nicht kulturell oder ideologisch wie 1968 ff., sondern materiell. Das ist der Grund, warum Klimapolitik diese Dynamik bekommen hat; weil sie nicht mehr nur von privilegierten Minderheiten eines bestimmten politischen Spektrums (Ökos, Grüne) moralisch begründet wird, sondern von einem parteiübergreifenden Mainstream namens Fridays for Future als Verteilungskonflikt erkannt wurde.

Quelle          :         TAZ           >>>>>            weiterlesen


Grafikquellen       :

Oben       —        Peter Unfried

Abgelegt unter Köln, Medien, Überregional, Umwelt | Keine Kommentare »

Strategien zur Stabilisierung

Erstellt von DL-Redaktion am 30. Dezember 2019

Internationale Strategien zur Stabilisierung der Machtverhältnisse – die totale Überwachung ist erreicht

Quelle         :        Scharf  —  Links

Von Gewerkschaftsforum Dortmund

Nach dem Ende der bipolaren Welt im Jahr 1989 und dem Abhandenkommen von Gegnern und Grenzen wurden unter der Regie der USA auch alle Einschränkungen im Verkehr von Gütern und Kapital aufgehoben. Dies zu einem Zeitpunkt, an dem sich fast die Hälfte der Staaten der Welt erstmalig dem ausländischen Kapital öffnete, das dann auf ein riesiges Angebot an billigen und qualifizierten Arbeitskräften, einem enormen Vorkommen an Naturschätzen und einem noch nicht da gewesenen großen Absatzmarkt traf. Das kam vor allem dem Kapital der USA, als neue unipolare Macht zugute.

Gleichzeitig bekam die Verbreitung des Neoliberalismus einen Schub, bei dem das Kapital von Einschränkungen befreit und der Arbeitsschutz, die öffentliche Daseinsvorsorge und der Sozialstaat nachhaltig abgebaut wurden.

Vor dem Hintergrund des globalen Kapitalismus mit seinen sozialen Desintegrationsprozessen wurden parallel dazu internationale Strategien entwickelt, um zu gewährleisten, dass die Machtverhältnisse auch stabil bleiben. Dazu wurde vor allem die Polizei militarisiert, das Militär im Inneren einsetzbar gemacht und es gibt mittlerweile kaum ein gesellschaftliches Problem mehr, auf das seitens der Politik mit der Verschärfung des Strafrechts reagiert wird. Gleichzeitig wurde ein Überwachungssystem errichtet, in dem die Bevölkerung total überwacht, von jeder Person massenhaft Informationen gesammelt, sie erpressbar gemacht und ein immenses Meinungs- und Unterhaltungsangebot mit dem Internet aufgebaut wurde, damit die Massen beschwichtigt und ablenkt werden.

Das digitale Zeitalter hat Überwachung so billig und einfach gemacht, wie noch nie, auch deshalb, weil ein Großteil der Daten freiwillig von den E-Phons geliefert werden.

Umfassend bekannt wurde die Möglichkeit der vollständigen Kontrolle aller Menschen weltweit durch die Enthüllungen von Edward Snowden. Das sogenannte PRISM-Programm der National Security Agency (NSA) verschafft dem Geheimdienst einen direkten Zugriff auf die Daten von Google, Facebook, Microsoft, Yahoo, Paltalk, Youtube, Skype, AOL und Apple. Diese Möglichkeit kostet lediglich 20 Millionen Dollar pro Jahr, bei einem Jahresbudget der NSA von weit über 10 Milliarden Dollar.

Massenhaft Informationen über die Bevölkerung sammeln

Obwohl das World Wide Web im Jahr 1989 im Forschungslabor der Europäischen Organisation für Kernforschung (CERN) in Genf erfunden wurde, ist es schnell zu einem rein US-amerikanischen Unternehmen geworden. Mehr als 90 Prozent des weltweiten Internetverkehrs wird über Technologien abgewickelt, die sich im Besitz von der US-Regierung selbst oder von US-Firmen befinden, von ihnen entwickelt wurden die heute mehr denn je am Ein- und Ausschalter des Systems sitzen und dies jeder Zeit bedienen können.

Auch die Software ist überwiegend in US-amerikanischen Händen, genauso wie Hardware und anderes Zubehör, wie Chips, Router, Modems und Plattformen. Der Mailverkehr, die sozialen Netzwerke und Speichersysteme in der Cloud sind in der Regierungshand oder werden von Privatfirmen wie Amazon, das der Regierung Cloud-Dienste und das halbe Internet bereitstellt, betrieben.

Selbst wenn diese Unternehmen im Ausland produzieren, unterliegen sie dem US-amerikan- ischen Recht. Damit ist die US-Regierung in der Lage, alle Menschen zu beobachten, die einen Computer oder ein Telefon bedienen.

„Kooperation der Dienste“ mit Telekommunikations- und Softwareunternehmen

Im Januar 2007 wurde durch die Berichte der Washington Post die Zusammenarbeit zwischen Microsoft und der NSA bekannt. Microsoft begründete diese Kooperation damit, dass dies die Sicherheit ihres Betriebssystems erhöht habe und das Unternehmen aufgrund seiner herausragenden Marktstellung die Kompatibilität ihrer Produkte mit den Bedürfnissen der (amerikanischen) Regierung sicherstellen wollte. Andere IT-Unternehmen folgten schnell dem Beispiel von Microsoft.

Auch das deutschte Bundesamt für Sicherheit in der Informationstechnik hielt die Kooperation der Firmen mit Geheimdiensten für „eher vorbildlich als verwerflich“ und betonte die „Win-Win-Situation“ für den Endnutzer sowie für die Unternehmen.

Berichte über die Zugriffsmöglichkeiten der NSA auf die Betriebssysteme der IT-Untennehmen wurden rasch als Verschwörungstheorien abgetan.

Seit Anfang 2012 ist die NSA Mitentwickler des Betriebssystem „SELinux“ und hat auch das „SEAndroid“ Betriebssystem für Google entworfen. Ein Jahr später wurde bekannt, dass die NSA im Rahmen des Programms „Planing tool for Resource Integration, Synchronization und Management (PRISM)“ in großem Umfang weltweit das Internet ausspähen soll, indem es systematisch die Daten großer Konzerne wie Google, Microsoft, Yahoo, Paltalk, Youtube, Skype, AOL und Apple und deren Nutzer auswertet.

Kabel und Cloud

Große Teile der Daten im Internet laufen über Glasfaserkabel, viele internationale und interkontinentale Verbindungen laufen über Seekabel. Um diese Datenströme zu leiten liegen auf den Meeresböden seit fast 50 Jahren entsprechende Kabel die das weltweite Netz verbinden.

Geheimdienste wie die NSA nutzen viele verschiedene Technologien, um Kommunikationsverkehre abzuhören und zu speichern. Neben dem Hacken von Systemen können sie auch durch die Kooperation mit Betreibern an die gewünschten Daten kommen. Der Telekommunikationskonzern AT&T hat der NSA in San Francisco exklusiv einen eigenen Raum gegeben, in den es die Daten lieferte. Ein Anzapfen der Kabel selbst ist ebenfalls gängige Praxis und wird mit verschiedenen Techniken ausgeführt: Am einfachsten ist die Attacke auf die Lichtsignale, in dem die Glasfaserstrecke aufgetrennt und ein zusätzliches Gerät zwischen Sender und Empfänger eingebaut wird. Mit der Splitter-Coupler-Methode biegen Angreifer die Glasfasern, um mittels spezieller „Biegekoppler“ dann heimlich auf den Informationsfluss zugreifen zu können. Nicht nachweisbar sind Einbrüche, die den direkten Kontakt mit der Datenleitung völlig vermeiden (non-touching methods). Solche Angriffsmethoden beruhen darauf, dass aus jedem Kabel minimale Lichtmengen strahlen, die mit hochempfindlichen Fotodetektoren aufgefangen und verstärkt werden.

In Deutschland gibt es Übergabepunkte auch bei Telekomanbietern , sie heißen hier Sina-Boxen. Der Vorgang läuft so ab: Die Behörde schickt einen Gerichtsbeschluss mit der Datenanforderung, das Unternehmen prüft ihn und gibt anschließend die Daten frei. Die werden dann über die Schnittstelle automatisch an den Dienst übertragen.

Viel effektiver und umfassender als das Anzapfen der Kabel ist das Cloud Computering, bei dem weltweit sich die Menschen sich anmelden, freiwillig ihre Videos, Musikfavoriten, Fotos und private Kommunikation in der „Wolke“ abladen und sich den Anbietern dieses Services bedingungslos unterwerfen. Gelockt werden die Datenlieferanten damit, dass sie mit jedem PC, Smartphones, Laptops und Tabletts ohne irgendwelche teuren Zusatzgeräte, ihre Daten dort in den riesigen Speicherzentren ablegen und verwalten lassen können. Verwalten heißt hier, das dem einzelnen Nutzer seine eigenen Daten nicht mehr gehören und wenn er sie nicht auf seinen eigenen Geräten abgespeichert hat, sind sie weg. Er hat alles abgetreten und die Unternehmen können nach Belieben damit machen, was sie wollen. Mit ihren bis zu 6000 Seiten umfassenden Verträgen haben sich die Firmen diese Rechte gesichert. Gesichert haben sie auch ihr Recht, Daten willkürlich zu löschen, den Nutzen den Zugriff auf seine gespeicherten Daten zu verweigern und eine Kopie in der Firmenablage abzuspeichern oder ohne das Wissen und Einverständnis an die Behörden aushändigen zu können.


Ende des letzten Jahrtausends bereiteten die gigantischen Datenmengen, die beim Abhören anfielen noch große Probleme. Aber die steigende Rechenleistung von Supercomputern und Mega-Rechenzentren ermöglichen es, dass heute ein einzelner Analyst in den Diensten Informationen aus riesigen Mengen von Rohdaten extrahieren kann. Aber nicht nur die Quantität der Daten musste in den Griff bekommen werden, auch die Qualität der Unmengen an Daten warfen Probleme auf.

Heute haben die Informationen Priorität, die ungeschrieben sind, unausgesprochen werden, aber viel über die Verhaltensmuster des einzelnen Menschen aussagen. Hier wurde der Begriff der Metadaten kreiert, gemeint sind Aktivitätsdaten, die Auskunft geben über alles, was mit den elektronischen Geräten gemacht wird und was die Geräten selbständig tun. Bei einem Telefonanruf umfassen solche Metadaten Datum, Urzeit und Dauer des Anrufs, die Nummer, des Anrufers, die Nummer des Angerufenen und seinen Aufenthaltsort. Bei einer E-Mail können die Metadaten Auskunft geben, auf welchen Computertyp geschrieben wurde, wem der Computer gehört, wo, wann und von wem die Mail gesendet wurde, wer sie erhalten hat und auch wer eventuell außer dem Sender und Empfänger wo und wann ebenfalls Zugang zur E-Mail hatte.

Die Metadaten geben auch über sehr private Dinge Auskunft. Dem Überwacher verraten sie, wo die Person übernachtet hat, wann sie aufgestanden ist und verraten, wo sie sich aufgehalten hat und wie viel Zeit sie dort verbracht hat und damit auch mit wem sie Kontakt hatte und wer mit ihr.

Metadaten liefern genau die Informationen, die als Ausgangspunkt für die Überwachung benötigt werden. Dabei helfen vor allem die Metadaten die automatisch entstehen und die der einzelne Mensch nicht beeinflussen kann. Die Maschine sammelt, speichert und analysiert eigenständig, ganz autonom und Diskretion ist dabei ein Fremdwort. Sie kontaktiert den nächsten Mobilfunkmast und sendet Signale aus, die niemals lügen.

Für die Geheimdienste können die Aktivitätsaufzeichnungen nicht nur durch die Analyse flächendeckender Daten ein Bild vom großen Ganzen bieten, auch im kleinen Bereich können sie punktgenaue Zusammenfassungen über das Leben einer Person erstellen und sie meinen sogar, Vorhersagen über ihr zukünftiges Verhalten ableiten zu können.

Die Internetüberwachungsprogramme PRISM und Upstream Collection

Mit der Einführung des Überwachungsprogramms PRISM konnte die NSA Daten in einer unglaublichen Anzahl sammeln. Sie generiert sie aus E-Mails, Fotos, Video- und Audiochats, Webbrowsing-INHALTE, Anfragen an Suchmaschinen und alle Daten, die in den Clouds gespeichert waren. Dazu kommen noch die routinemäßig gelieferten Daten von Google, PalTalk, YouTube, Microsoft, Yahoo, Facebook, Skype, AOL und Apple.

PRISM ist nicht allein eine Software oder ein Datenzentrum, es besteht aus mehreren Komponenten. Die wichtigste ist dabei eine Ausleitungsschnittstelle, über die Daten von den Firmen an die Dienste übergeben werden. Dabei funktioniert sie wie ein elektronischer Briefträger.

Das Programm Upstream Collection ermöglicht die permanente Datensammlung unmittelbar aus der Internetinfrastruktur des privaten Sektors, hervorgeholt aus den Switches und Routern, die den Internetverkehr aus den am Meeresboden verlegten Kabeln oder über die Satelliten abwickeln. Das Programm ist mit seinen Werkzeugen in Lage, ganz nah an der überwachten Person und seiner Privatsphäre zu operieren. Jedes Mal wenn die Person eine Website besucht, einen Webbrowser öffnet, die URL eingibt, geht die Anfrage auf Serversuche. Bevor die Anfrage den entsprechenden Server erreicht, muss sie aber die mächtigste Waffe der NSA die sogenannte TURBULENCE durchlaufen. Bei dem Durchlauf muss die Anfrage einige „schwarze Server“ überwinden, die übereinander gestapelt kaum größer als ein Quadratmeter sind und in allen verbündeten Staaten in besonderen Räumen der Telekommunikationsunternehmen aufstellt sind, ebenso auf US- Militärstützpunkten und in US-Botschaften rund um den Globus.

Die TURBULENCE enthält 2 wichtige Werkzeuge:

  1. TURMOIL betreibt das „passive Datensammlung“ indem es Kopien der durchlaufenden Daten sammelt und bei seiner Wächterfunktion untersucht sie die Metadaten, ob sie etwas enthalt, was „prüfungswert“ erscheint bis hin zu bestimmten Schlüsselwörtern. Werden die Daten als verdächtig eingestuft, gibt TURMOIL den Internetverkehr weiter an die
  2. TURBINE, dieses Werkzeug gibt die Anfrage auf die Server der NSA weiter. Dort wird mit Hilfe von Algorithmen entschieden, welche Schadprogramme der NSA gegen die Person eingesetzt werden. Die Entscheidung wird durch den Typ der Website die angefragt begründet oder durch die Software des Computers und die Art der Internetverbindung. Das ausgewählte Schadprogramm wird dann wieder an die TURBINE gesendet. Diese führt das Schadprogramm zurück in den Kanal des Internetverkehrs und liefert sie dem Anfragenden frei Haus zusammen mit der gewünschten Website. Der gesamte Vorgang dauert weniger als 680 Millisekunden, ohne dass der Nutzer etwas mitbekommen hat. Ab diesem Zeitraum gehört das gesamte digitale Leben des Nutzers dem Geheimdienst.

Beide Programme können durch die obligatorische Datensammlung auf den Servern der Provider (PRISM) und durch die unmittelbare Datensammlung aus der Internetinfrastruktur (Upstream Collection) über den gesamten Globus Informationen überwachen, egal ob sie gespeichert oder übermittelt wurden.

Uneingeschränkte Unternehmensmacht gekoppelt mit unkontrollierbaren staatlichen Diensten

Das Internet ist eine grundlegende Infrastruktur für die Ausübung zahlreicher Menschenrechte. Konzerne wie Facebook und Google sind Torhüter dieser digitalen Welt. Sie haben eine historisch einmalige Macht über den „digitalen öffentlichen Platz“ und bestimmen auch, unter welchen Bedingungen und mit welchen Einschränkungen Meinungs- und Informationsfreiheit online ausgeübt werden können und welchen Preis man dafür zahlen muss.

Die Dominanz von Onlinediensten, wie sie IT-Riesen wie Google und Facebook anbieten, geben diesen Unternehmen eine nie dagewesene Macht über die persönlichsten Daten von Millionen Menschen: 2,8 Milliarden Personen pro Monat nutzen einen Facebook-Dienst, mehr als 90 Prozent aller Internetsuchen finden auf Google statt und mehr als 2,5 Milliarden Handys nutzen das Google-Betriebssystem Android.

Konzerne wie Facebook und Google sammeln Daten in einem unfassbaren, nie dagewesenen Ausmaß – unbeschränkt, dauerhaft. Dies umfasst nicht allein freiwillig zur Verfügung gestellte Informationen, sondern die digitale Erfassung und Überwachung aller Aktivitäten, weit über die Nutzung einzelner Social-Media-Plattformen hinaus. Auch ist es nicht auf die Daten derer beschränkt, die sich bewusst dafür entschieden haben, diese Dienste zu nutzen.

Während internationales Recht und Verfassungen elementare Menschenrechte garantieren, staatliche Behörden reglementieren und diese einer rechtsstaatlichen Gewaltenkontrolle unterwerfen, haben diese Konzerne ein privates Überwachungsregime geschaffen, welches sich der unabhängigen öffentlichen Kontrolle weitgehend entzieht. Parallel zum Ausbau des weltweiten Überwachungssystems, in dem die Bevölkerung total ausgehorcht, von jeder Person massenhaft Informationen gesammelt werden, sie erpressbar macht, wurde parallel dazu ein immenses Meinungs- und Unterhaltungsangebot mit dem Internet aufgebaut, mit dem man die Massen beschwichtigen und ablenken will. Dazu kommt, dass die USA und auch die europäischen Staaten über ein Heer von Einflussjournalisten in Kooperation mit der monopolisierten Medienmacht verfügt, die globale Kommunikation weitgehend steuert.

Mehr noch, in der Zusammenarbeit der staatlichen Behörden und Geheimdienste, IT-Unternehmen und Medienkonzernen ist ein Überwachungssystem entstanden, das sich selbst George Orwell in seinem utopischen Roman „1984“ nicht ausmalen konnte.

Permanent Record/ Meine Geschichte von Eward Snowden, 
Gegenrevolution von Bernard E. Harcourt,
Amnesty-Bericht: "Surveillance Giants“, 
George Orwell: 1984 
Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen        :

Oben          —     Mobile Videoüberwachung der Polizei auf einer Demonstration

  • CC BY 2.5Hinweise zur Weiternutzung
  • File:Gräfenberg ist bunt – Mobile Videoüberwachung.jpg
  • Erstellt: ‎18‎. ‎August‎ ‎2007


2.) von Oben        —        Überwachungskameras


Unten          —       Kameraüberwachung in einer U-Bahn-Station

Abgelegt unter Gewerkschaften, Innere Sicherheit, Nordrhein-Westfalen, Regierung | Keine Kommentare »

Eine Weihnachtsgeschichte

Erstellt von DL-Redaktion am 24. Dezember 2019

Die Legende vom Büderich oder 2019 Jahre schlechte Laune

Bethlehemkirche Meerbusch-Buederich.JPG

Von Manja Präkels

Eine Geschichte über den Büderich, der es nun wirklich sehr deutlich übertrieben hatte.

Der Flecken lag mitten im Dunkel, trotzig, rechtwinklig, in stiller Überschaubarkeit. Umgeben von Feldern ging ein schwaches Funzeln von ihm aus. Denn die Hauptstraße, entlang derer seine Bewohner alles fanden, was sie brauchten, war mit leuch­ten­den Sternen geschmückt. Haus an Haus reihten sich Bank, Bäcker, Fleischer, ein kleines Mode- und Schuhgeschäft (für Damen nur bis Größe 42!), ein Reformladen für die ökologisch Bewussten, ein Laden für die Trinker und Raucher sowie ein Pizzaimbiss mit Döner Hawaii im Angebot.

Alles und jeder hatte hier seinen Platz. Und wer keinen fand, ging fort. Denn dies ist der Lauf der Welt. Nur der Büderich, der hatte es zu weit getrieben. Der hatte seinen Platz verloren. Die Bäckerin öffnete ihren Laden allmorgendlich als Erste. Und kaum hatte die Kirchturmuhr viermal geschlagen, fanden sich die ersten Kunden ein. Allen voran die alte Fuchs, deren Züge versteinert waren, seit ihr Mann pflegebedürftig und somit beider Leben in Armut gefallen war.

Gegen fünf trafen die Monteure ein. Auswärtige Männer mit verlebten Gesichtern und Tätowierungen auf den Händen. Bestellten Kaffee, versammelten sich mit den dampfenden Bechern und hochgezogenen Schultern draußen zum Rauchen. Kamen schnaufend vor Kälte und Müdigkeit zurück in den Laden und frühstückten mit mechanischen Bewegungen. Ihr Arbeitstag hatte begonnen. Bis sieben blieb es ruhig im Ort. Nur vereinzelt fanden sich Schlaflose und Gassigeher am Kirchplatz ein, den täglich einmal zu umrunden zu den Hauptbeschäftigungen der Einwohner des Fleckens gehörte. Dies ist mein Ort. Vier Ecken und zwei Beine. Die Uhr schlägt uns den Rhythmus. Wir schlagen Wege ein.

Nur der Büderich, der hatte es, potz Blitz, zu weit getrieben. Das wussten alle. Selbst solche wie Säbler, der dazu neigte, den Verlauf eines Disputs geduckt abzuwarten, bis er sicher sein konnte, wem der Sieg gebühren würde, auf wessen Seite er sich zu schlagen hatte. Selbst der hielt sich fern vom Büderich, weil er zu weit gegangen war. Und keinen Platz mehr hatte. Ohne Not.

Gegen halb acht eilten schließlich die Schülerinnen und Schüler, gelbgesichtige Bankangestellte, gestresste Verkäuferinnen und der gichtgeplagte Leiter des Reisebüros ihrem Tagwerk entgegen. Endlich wurde es hell, im Bäckerladen löschten sie die Lichter. Wer spart, gewinnt, dass wusste schließlich jeder. Nur der Büderich, der hatte es nun wirklich übertrieben. Selbst mit so einer einfachen Sache wie der Sparsamkeit. Sogar die Gefühle hatte der sich gespart. Und das war es, was sie ihm am wenigsten verzeihen konnten. Denn schließlich haben auch Gefühle einen festen Platz, einen Ort, an den sie hingehören, und an Weihnachten, so viel stand fest, war dieser Platz nun wirklich klar markiert.


Ein Überflüssiger

Ein kräftiger Wind schlug Regentropfen an die Fenster, die zeichneten schräg stehende Muster, die sich mit jeder neuen Böe veränderten und damit die Katzen auf den Fensterbänken hypnotisierten. Johann Fuchs, der sein ganzes Leben der Deutschen Reichsbahn, dem planmäßigen Abfahren und Ankommen schwerbeladener Güterzüge geopfert hatte, versetzte der Anblick einen Stich ins Herz.

Seit Monaten hatte er das Haus nicht mehr verlassen. Er, der die Schienennetze über zigtausende Kilometer hinweg bis ins Mark verinnerlicht hatte. Der noch immer ruhelos durch die Lande fuhr – nachts, allein. In seinen Träumen. Um dann, bei Tage, wieder nutzlos zu sein.

Quelle           :          TAZ        >>>>>          weiterlesen


Grafikquellen         :

Oben      —        protestant church in Meerbusch, Germany (Betlehemkirche)

Abgelegt unter Feuilleton, Nordrhein-Westfalen, Religionen, Überregional | Keine Kommentare »

Transport nach Russland

Erstellt von DL-Redaktion am 12. Dezember 2019

Gronau: Nächster Atommüll-Export blockiert

File:Urananreicherungsanlage der Firma Urenco in Gronau (6964380303).jpg

Quelle       :        untergrund-blättle  CH.

Von   pm

Erneut blockieren Aktivist_innen einen Zug mit Uranmüll der Firma Urenco, der auf dem Weg nach Russland ist. Vorerst kann er nicht weiter fahren, da sich eine Person von der Autobahnbrücke bei MS-Häger über die Schienen abgeseilt hat.

Transparente in russisch und deutsch fordern den Stopp der umstrittenen Transporte: „Keine Atommüll Exporte nach Russland“ und „Gronau stilllegen“ ist dort zu lesen. Dadurch wollen sie ihre Solidarität mit den Menschen in Russland sowie den gemeinsamen Protest zeigen.

Die Blockade ist bei weitem nicht die einzige Protestaktion im Zusammenhang mit diesem Transport, der von seinem gewöhnlichen Fahrplan abwich. Geplant war der Transport an diesem Montag. Vom Münsterland über das Ruhrgebiet und die Niederlande bis hin nach Amsterdam haben zahlreiche Initiativen zu Mahnwachen und Aktionen entlang der Strecke aufgerufen, in Russland werden die Proteste ebenfalls unterstützt. Sogar von dort sind Menschen angereist, um auf das Thema aufmerksam zu machen.

Die Aktivist_innen freuen sich darüber: „Es ist wichtig, zu kämpfen,“ sagt Anne. „Die Exporte nach Russland zeigen einmal mehr, dass Atomkraft ein schmutziges Geschäft ist und dass alle Anlagen abgeschaltet gehören.“ „Mit der Urananreicherungsanlage fangen wir an,“ fügt ihr Mitstreiter hinzu.

Sie sind zuversichtlich, denn die Menschen wirken entschlossen und der Widerstand wächst: „Aufgrund der Proteste konnte der Zug gestern nicht fahren und wird womöglich das Schiff nach St. Petersburg verpassen. Ein klares Zeichen, dass wir erfolgreich sind!“

Bereits der Transport vor drei Wochen war für viele Stunden blockiert worden und hatte für internationale Schlagzeilen gesorgt. Wie sich gestern gezeigt hat, nehmen die Proteste nicht ab. Schliesslich will die Firma Urenco noch zehntausende Tonnen Uranmüll exportieren, die bei der Urananreicherung entstehen.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikqueqelle    :    Urananreicherungsanlage der Firma Urenco in Gronau   –  Torbereich der Anlage

Source Urananreicherungsanlage der Firma Urenco in Gronau
Author UAA Nee
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.
Checked copyright icon.svg This image was originally posted to Flickr by UAA Nee at It was reviewed on by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc-by-sa-2.0.

Abgelegt unter International, Nordrhein-Westfalen, Regierung, Wirtschaftpolitik | Keine Kommentare »


Erstellt von DL-Redaktion am 3. Dezember 2019

Schöffe am Amtsgericht in Euskirchen

File:1031616 Amtsgericht Euskirchen.jpg

Quelle       :         untergrund-blättle     CH.

Von   Richard Albrecht

Im letzten Jahrzehnt war ich vor einigen Jahren einige Jahre lang ehrenamtlicher Richter. Genauer: (Hilfs-) Schöffe an einem Amtsgericht in der Rheineifel.

Euskirchen, historisch Oiskirchn, ist das Tor der Eifel. Aber nicht alle Euskirchner sind Eifler Toren. Es hat auch dort einige Autoren.

Das dortige Amtsgericht ist baulich neu und liegt zentral für alle, die mit dem Zug oder dem Auto anreisen. In den Kleinen Saal wurde in Handschellen reingebracht ein Angeklagter, den ich gut ein Jahrzehnt vor der Verhandlung einmal beobachtete wie er am Bach Frösche fing und mit dem ich über die Jahre auch zwei, drei Sätze irgendwas sprach.

Was er getan haben sollte Jahre bevor er als Angeklagter befragt wurde fiel unters Jugendstrafrecht.

Merkwürdig war, dass Monate vergingen bevor er nach erster polizeilicher Auffälligkeit vor seinen ersten Richter kam. Ich fragte nach. Der Berufsrichter am Amtsgericht war lange Jahre lang Direktor des nahegelegenen Hauses, in dem ich später 15 Tage als Busse für die angebliche „Beleidigung“ eines Rechtsadvokaten abbüssen sollte. Er liess als Vorsitzender pausieren und erklärte im Beratungsraum wortreich, warum´s so war damit das wirken konnte, was Pädagogik genannt wird.

Ob der – nun – junge Mann, den ich – wieder´n paar Jahre später – noch einmal zwischen Regalen in einem Supermarkt sah und den ich an seinen so hellen wie wachen Augen wiedererkannte, nun schlussendlich wegen seines ersten Altdelikts verurteilt wurde oder auch nicht, kann ich nicht wissen.

Die Verhandlung, an der ich laienrichterlich teilnahm, musste aus formalen Gründen vertagt werden.

Die letzte Gerichtsverhandlung, an der ich, ehrenamtlich überhöht sitzend, teilnahm, war geheim: „aus Gründen“ des Jugendschutzes wurde was „die Öffentlichkeit“ heisst ausgeschlossen.

Der alte Mann war das erste Mal in seinem Leben öffentlich angeklagt. Er fühlte sich unschuldig und schämte sich nicht. Sondern hatte Angst vor seiner Frau. Denn er sollte, so staatsanwaltschaftliche Ermittlungen, von hinten eine Minderjährige begrapscht haben.

Diese erschien gross und prall. Die Gutachterin wissend und eifernd.

Der Mann war nicht nur ein alter, sondern auch ein kleiner Mann. Würde er wie allseits beredt behauptet die Titten nicht nur von hinten, sondern auch von oben begrabscht haben, hätte er auf einer kleinen Leiter oder auf einigen Telefonbüchern der Kreise Bergheim-Düren-Euskirchen stehen müssen.

Als ich dies, ehrenamtlich-richternd und gutachterlich-kritisch, anmerkte – herrschte sekundenlang so kundiges wie beredtes Schweigen.

Was den Vorsitzenden trotz Advokatenprotest nicht hinderte, wie Basta durchzuziehen. Und den kleinen alten Mann, der seine Unschuld beteuerte und den die Angst vor seiner Frau schwitzen machte, zu einer milden Geldstrafe zu verurteilen.

Die Verhandlung wurde weder zur Beratung unterbrochen noch später ausgesetzt.

Diesen Berufsrichter sah ich erst Monate später in anderem Zusammenhang im selben Amtsgericht während meines eigenen, von ihm beförderten, Prozesses wegen angeblicher „Beleidigung“ eines Bonner Rechtsadvokaten ebendort wieder – in der Gerichtskantine, nachdem der gegen mich als Angeklagten veranlasste Prozess wegen Besorgnis berufsrichterlicher Befangenheit vertagt wurde.

Seitdem ward er von mir nimmer gesehen.

Und das war und das ist auch nur gut so.

Diese Kurzerzählung erschien zuerst im Sammelband des Autors HELDENTOD. Kurze Texte aus Langen Jahren (Aachen: Shaker Media, 2011).


Grafikquelle          :         Amtsgericht Euskirchen, Sept. 2007

Author Wikoli       —        Source  :  Own work

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Justiz-Kommentare, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »

NRW / Sagel verläßt Linke

Erstellt von DL-Redaktion am 2. Dezember 2019

NRW – Leitlinien und ein Austritt in Bielefeld

Rüdiger Sagel.jpg

Von Sebastian Weiermann, Bielefeld

Der Landesparteitag der LINKEN in Nordrhein-Westfalen hat die Kommunalwahl 2020 vorbereitet.

Für die Linkspartei in Nordrhein-Westfalen ist es nicht leicht, auf sich aufmerksam zu machen. Zwar kommen zu ihrem Parteitag am Wochenende in Bielefeld prominente Bundestagsabgeordnete aus dem Bundesland und mit Özlem Alev Demirel sitzt nun eine fest in der nordrhein-westfälischen LINKEN verankerte Politikerin im Bundestag, aber der Partei fehlt die Präsenz im Landtag.

Ein bisschen Glanz brachte der Parteivorsitzende Bernd Riexinger in den Parteitag. In seiner Rede sprach er sich gegen die AfD und für Solidarität mit der antifaschistischen Organisation VVN-BdA aus. Das neue Vorsitzendenduo der SPD aus Esken und Walter-Borjans kommentierte Riexinger wohlwollend. Es sei zwar fraglich, ob es wirklich eine Erneuerung der SPD gäbe, aber die abstimmenden Mitglieder hätten sich für eine »sozialdemokratischere« Partei ausgesprochen. Das sei kein Grund, von Zusammenschlüssen zu träumen. Die LINKE habe ihren Platz links von der SPD. Sie kämpfe für »demokratischen Sozialismus«. Über Saskia Esken wusste Riexinger noch zu berichten, dass er sie im Jugendzentrum »zum Teil mit politisiert« habe. Das habe offensichtlich nur für die SPD gereicht – aber »immerhin linker Flügel«, wie er anmerkte.

Zentrales Thema des Parteitags war allerdings nicht die SPD, sondern die Vorbereitung auf die Kommunalwahlen, die im September 2020 stattfinden. Dass die Themen dafür in den Städten gesetzt werden, war den Delegierten klar. Aber man wollte mit den »Kommunalpolitischen Leitlinien« einen »Steinbruch« entwickeln, aus dem die Kreisverbände sich bedienen können, wie Landessprecher Christian Leye erklärte. Es sei wichtig, sich auf Landesebene über gewisse Positionen verständige. Man sende damit ein »Signal«, wo man stehe. Die Leitlinien, die er Parteitag beschlossen hat, umfassen mehr als 100 Seiten und bilden das ganze Spektrum der Politik ab. Darin geht es sowohl um größere Fragen, wie der Positionierung der LINKEN gegen Hartz-IV-Sanktionen, als auch um Details, etwa ob man für oder gegen Kunstrasenplätze sei. Diskutiert wurde, ob in den Leitlinien von »Arbeitslosigkeit« oder »Erwerbslosigkeit« die Rede sein solle. Für den ersten Begriff spreche dessen Allgemeingültigkeit, für den zweiten, dass Lohnarbeit damit nicht überhöht würde, worauf die Delegierten sich dann einigten.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Laut und leidenschaftlich wurde es nur selten. Etwa bei der Frage danach, ob der Energiekonzern RWE »verstaatlicht« oder »zerschlagen« werden sollte oder beim Thema Prostitution, bei dem es eine Bandbreite an Positionen gibt, die von einer Liberalisierung bis zum Sexkaufverbot reicht. Man einigte sich auf Grundsätzliches wie Beratungsangebote und die Stärkung von Hilfsmöglichkeiten für die Menschen in der Branche.

Quelle          :          ND         >>>>>           weiterlesen


Grafikquellen       :

Oben       —         Rüdiger Sagel


Unten        —       Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:


  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Eine Schifffahrt, die ist …

Erstellt von DL-Redaktion am 1. Dezember 2019

Die Binnenschifffahrt könnte dabei helfen die Klimaziele zu retten

SophienhafenHalle WSA.JPG

Von Annette Jensen

Die Binnenschifffahrt könnte dabei helfen, die deutschen Klimaziele zu erreichen. Doch die marode Infrastruktur und der Trend zu immer schnelleren Lieferungen erschweren das.

Warten. Am Kai nebenan quietscht seit Stunden ein Kran, der Getreide in ein Schiff schaufelt. Auf der „MS Catharina“ aber ist es still. Ab und zu fegt eine Sturmböe über das flache Schiff und das eingezäunte Gelände im Magdeburger Hafen, auf dem plastikverpackte Rotoren und andere Bauteile für Windräder lagern. Bei diesem Wetter ist es zu gefährlich, 68 Meter lange Flügel zu verladen.

Für Kapitän Klaus Hohenbild, seinen Bruder Karl Georg und seinen Sohn Christoph war das Wochenende am Sonntag schon vorbei. Da sind sie knapp fünf Stunden mit dem Auto von ihrer Heimatstadt Emmerich am Rhein nach Magdeburg an der Elbe gefahren. Sie wollten unbedingt rechtzeitig auf ihrem Schiff sein, wenn der Lkw mit ihrer Ladung eintrifft. Doch jetzt müssen sie erst mal warten.

Zweimal hat Klaus Hohenbild oben am Kai schon nachgefragt. Dann kam der Anruf: Heute nicht. Morgen, vielleicht. Der 65-Jährige brummt und schaut aus dem Fenster. Das Schiff bewegt sich kaum. Vom Sturm merkt man im Bauch der 100 Meter langen „MS Catharina“ so gut wie nichts.

Wenn es nach der Bundesregierung geht, sollen Familie Hohenbild und ihr Schiff dabei helfen, die deutschen Klimaziele zu erreichen. Sie will den Gütertransport von der Straße auf Schienen und Flüsse verlagern. Das Bundesverkehrsministerium unter Andreas Scheuer will die „Attraktivität für Industrie und Logistik steigern“, heißt es im Klimaschutzprogramm.

Denn der Transport auf dem Wasser ist deutlich klimafreundlicher als mit dem Lkw, die in Deutschland gegenwärtig über 70 Prozent des Transports abwickeln. Die Binnenschifffahrt dümpelt bei gerade mal 8 Prozent vor sich hin. Laut Umweltbundesamt werden bei Gütertransporten mit dem Lkw Treib­haus­gase der Menge 103 Gramm pro Tonnenkilometer ausgestoßen, mit der Binnenschifffahrt sind es nur 32 Gramm. Noch in den 1960er Jahren teilten sich Bahn, Laster und Schiff die Transporte zu etwa gleichen Teilen – danach ging es mit der Schifffahrt ab- und mit dem Straßentransport aufwärts. Wie kam die Schifffahrt in die Krise? Und kann man das Ruder wieder rumreißen?

Karl Georg will jetzt etwas tun, um die Wartezeit zu überbrücken. Bekleidet mit Blaumann und ausgebleichtem Stoffhütchen steigt er die steile Treppe in den Maschinenraum hinunter, um dort ein bisschen aufzuräumen und Werkzeuge und Farbtöpfe zu sortieren. Alles ist gut ausgeleuchtet hier, Boden und Bleche sind rot und gelb lackiert, die Rohre grün. Es riecht nach Diesel, obwohl nirgendwo ein Tröpfchen Öl zu sehen ist. Nach einem Kohletransport schrubben sie den Frachtraum sechs bis sieben Stunden lang, bis dort bedenkenlos die nächste Ladung Korn, Dünger, Streusalz oder Windradflügel gelagert werden können. „Schrott transportieren wir nicht. Das gibt zu viele Beulen“, erzählt Karl Georg.

Die drei Hohenbilds hoffen, dass die Fahrt nach Bremen am nächsten Tag beginnen kann. Am Freitag sollen sie dort abladen, anschließend werden die Windradflügel in die Türkei verschifft. Jetzt ist es ist Montag. Sie haben also fünf Tage Zeit, um von Magdeburg nach Bremen zu kommen. Fünf Tage für 385 Kilometer. Das sollte schaffbar sein – oder?

Die Probleme der Schifffahrt

Wartezeiten gehören für Binnenschiffer zum Geschäft. Lade- und Löschzeiten sind Teil der Verträge. Und so werden die Hohenbilds auch für die Verzögerung in Magdeburg ein Ausfallgeld vom Auftraggeber bekommen. Das decke die laufenden Kosten aber kaum, sagt Klaus Hohenbild. Seine Familie ist auch Mitglied in einem Netzwerk, in dem er und seine Kollegen anonym ihre Frachtpreise einstellen, um einem Unterbietungswettbewerb entgegenzuwirken.

„Als ich anfing, war es eine Sensation, wenn eine Schleuse mal zwei Wochen lang nicht funktionierte“, erinnert sich Klaus Hohenbild, während er es sich auf dem Steuer­mannsitz im Führerhaus bequem macht und die Füße hochlegt. Fast 50 Jahre liegt seine Lehrzeit zurück; genau wie sein Sohn Christoph sein Azubi war, so hat auch er auf dem Schiff seines Vaters gelernt.

Klaus Hohenbild holt sein Handy raus, er möchte zeigen, was in der Binnenschifffahrt schief läuft. Auf einem Foto sieht man einen Mann in einem neongelben Anzug, der sich an einem Betonklotz festgekettet hat und an einem Seil zieht. „Das ist im Weser-Datteln-Kanal. Da setzen sie jetzt sogenannte Festmacher ein“, empört er sich. Sein Bruder Karl Georg kichert. Die Innenwände dieser Schleusen sind so marode, dass die Schiffe ihre Taue nicht mehr um die Poller legen dürfen. Obwohl es sich um eine der am meisten befahrenen Wasserstraßen handelt, erließ das Amt vergangenes Jahr auch die Anweisung, dass immer nur ein Schiff auf einmal einfahren darf.

Hohenbild wischt über den Bildschirm und zeigt eine unscharfe Aufnahme: ein winziges Sportboot, das in die über hundert Meter lange Schleusenkammer tuckert. Es ist klein genug, um gemeinsam mit anderen Schiffen durchgeschleust zu werden. Das geht aber nicht – wegen der Anweisung. So entstehen lange Warteschlangen. „Vier, fünf, sechs, sieben Stunden Wartezeit“, sagt Kapitän Hohenbild. Weil die verladende Industrie protestierte, setzt die Schifffahrtsverwaltung jetzt Männer im Dreischichtbetrieb ein, die den Schiffen beim Festmachen helfen. Wie lange dieses Provisorium weitergehen soll? „Weiß keiner. Wir wissen es jedenfalls nicht.“

Auf dem Weg bis nach Bremen müssen sie elfmal in eine Schleuse einfahren, um Staustufen zu überwinden. Auch hier heißt es häufig warten. Da ist die Schleuse Drakenburg, die seit Monaten klemmt. In Minden gibt es seit zwei Jahren eine neue Anlage, die aber nur von großen Schiffen genutzt werden darf. „Sie soll wohl geschont werden“, mutmaßt Kapitän Klaus Hohenbild. Die „MS Catharina“ muss hier oft stundenlang an der Anlage für kleinere Schiffe ausharren. Beide Schleusen werden aus der Ferne gesteuert – und eine parallele Bedienung ist offenbar nicht möglich oder vorgesehen. „Behörde“, stöhnt der sonst so gelassen wirkende Mann.

Zuständig für den Zustand der Schleusen und der Binnenschifffahrt ist die Wasser- und Schifffahrtsverwaltung (WSV). „Da ist kein Zug drin, das System ist krank, keiner will da die Verantwortung übernehmen“, sagt der Kapitän. Jeder Anruf bei der WSV sei schwierig. Oft erreiche er dort niemanden oder er müsse betteln, um zu einer zuständigen Person durchgestellt zu werden.

Erst ein paar Tage alt ist die Meldung, dass der Nord-Ostsee-Kanal für große Schiffe vorübergehend nicht passierbar ist, weil eine Schleuse in Brunsbüttel gewartet wird und sich die andere nicht vollständig öffnen lässt. In der Nische des Schleusentors hat sich Schlick angesammelt. Angesichts solcher Zustände findet es Klaus Hohenbild „zum Lachen“, dass dauernd von Digitalisierung und selbstfahrenden Binnenschiffen als Zukunftsvision die Rede ist.

Ruhrmündung Duisburg Luftaufnahme 2014.jpg

Doch lustig finden die Hohenbilds die Lage der Binnenschifffahrt nicht. Es hapert überall. Und seit Frühjahr nehmen die Frachtanfragen auch wieder ab, die Preise geraten unter Druck. „Die Kohle ist seit Langem auf dem absteigenden Ast, auch Sand und Kies sind rückläufig“, benennt Hohenbild ganz nüchtern die Probleme seiner Branche. Aufgeben aber ist für die Familie Hohenbild keine Option – und auch der 29-jährige Christoph geht fest davon aus, dass er sein gesamtes Berufsleben auf Flüssen und Kanälen verbringen wird. Seit mindestens 1850 gehört die Schifffahrt zur Familientradition der Hohenbilds.

Hört man den Männern zu, könnte man den Eindruck bekommen, dass die Krise der Binnenschifffahrt vor allem ein Ergebnis mangelnder Finanzierung von Schleusen und Technik ist. Die Bundesregierung will das mit einer Verdopplung ihrer Investitionen ändern. Aber die Probleme liegen gerade für das Familienunternehmen Hohenbild tiefer, oder besser: flacher. Fuhr der Vater von Klaus und Karl Georg noch mit einem 300-Tonnen-Frachter, so kann die „MS Catharina“ sechsmal so viel laden. „Das entspricht 74 Lkw“, rechnet Klaus Hohenbild vor. Damit gehört das Schiff heute eher zu den Kleinen: Fast alle neuen Schiffe sind inzwischen 135 Meter lang und für 3.500 Tonnen Last oder Containertransport vorgesehen – sie schippern fast ausschließlich auf dem tiefen Rhein, wo acht von zehn Transporten auf Flüssen stattfinden.

Quelle          :          TAZ          >>>>>          weiterlesen


Grafikquellen        :

Oben        —         Einfahrt zum Sophienhafen, Gebäude des Wasserstraßen- und Schifffahrtsamtes Magdeburg, Halle (Saale)


Unten           —       Aerial shot of mouth of the Ruhr (River) River at Duisburg-Ruhrort into the Rhine

Abgelegt unter Nordrhein-Westfalen, Sachsen-Anhalt, Überregional, Wirtschaftpolitik | Keine Kommentare »

Stadtgespräch aus München

Erstellt von DL-Redaktion am 28. November 2019

Mir san Sommer –
Änderung des Ferienbeginns in Bayern

Fitxer:Starnberger See mit Steg und Alpenblick.jpg

Von Ambros Waibel

Früher in die Ferien? Markus Söder will die Ferienzeiten bewahren. Das ist identitätspolitisch clever, preußisches Rumgenöle wirkt da eher kontraproduktiv.

„Das bayerische Abitur bleibt bayerisch“, hat Bayerns Ministerpräsident Söder den Ausstieg Bayerns und Baden-Württembergs aus dem geplanten nationalen Bildungsrat kommentiert – „übrigens genauso, wie die Ferienzeiten bleiben, wir wollen auch die nicht angleichen.“

Das sind gleich zwei inhaltliche Nullaussagen. Denn dass ein bayerisches Abitur einen im Leben irgendwie weiter brächte als ein beliebiges anderes, ist genauso Unsinn – ich kann hier mitreden – wie das trotzige Bestehen auf dem späten Sommerferientermin in Zeiten des Klimawandels; der ja insbesondere den Juli auch in Nürnberg oder in München zu einem Monat macht, in dem sinnvoller Unterricht in den zumeist nicht klimatisierten Lehranstalten kaum mehr möglich ist.

Politisch, also identitätspolitisch hingegen sind beide Aussagen wirkmächtig. Ich brauchte mindestens zehn Jahre, um mich daran zu gewöhnen, dass die Sommerferien in nördlichen Gefilden nicht mehr oder weniger am 1. August beginnen und am 15. September enden. Es erschien mir grausam, ein Kind, wie in diesem Jahr in Berlin, am 5. August nicht in die Sonne, sondern in die Schule zu schicken.

Logisch lässt sich das nicht begründen. Dem Kind ist es auch wurscht. Pfingstferien, die als Argument für den späten süddeutschen Sommerferienbeginn inzwischen vorgeschoben werden, sind etwas sehr Schönes – insbesondere weil da oft noch Vorsaisonpreise gelten und keine Preußen am Gardasee rumhängen. Aber auch sie taugen letztlich nicht zur Rechtfertigung der bajuwarischen Reservat­rechte. Und wer im Sommer und damit eben auch im September schlicht kein Geld übrig hat, um in den Süden zu fahren, der kann in Bayern die letzten beiden Ferienwochen oft genug damit verbringen, in einen zähen Landregen zu schauen.

Das ganze folkloristische Repertoire

Nehmen wir mal eine andere Perspektive ein. In seinem leider nicht auf Deutsch vorliegenden Reisebuch „La leggenda dei monti naviganti“ (etwa „Die Legende der reisenden Berge“, 2007) erkundet der italienische Journalist Paolo Rumiz die Alpen und macht dabei auch einen Abstecher nach München.

Veitshöchheim Haus der Fastnacht 06.jpg

Seine Gesprächspartner klären ihn darüber auf, dass die CSU in Bayern für immer regieren werde, weil letztlich niemand ein anderes Bayern wolle, auch die CSU-Gegner nicht. Die Gleichsetzung von Staat, Partei und Heimat überlebt jeden CSU-Skandal und konnte bislang nur von der CSU selbst beziehungsweise von noch rechteren Gruppierungen – mit noch mehr „Mir san mir“ – herausgefordert werden: wie aktuell von den „Freien Wählern“.

Quelle             :         TAZ       >>>>>         weiterlesen


Grafikquellen        :

Oben          —            Starnberger See: Steg mit Ausflüglern und Alpenblick von Starnberg aus

Font Treball propi
Autor MAx59

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.


Unten         —         Veitshöchheim, Haus der Fränkischen Fastnacht, Fassadenmalerei (2015) mit Motiven aus der Fernsehsendung „Fastnacht in Franken“: Links im Gefängnis Markus Söder, der sich 2014 für die Fernsehsitzung als Shrek verkleidet hatte.

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 Deutschland“ lizenziert.

Abgelegt unter Bayern, Kommunalpolitik, P.CDU / CSU, Überregional | Keine Kommentare »

Synode Dresden: Missbrauch

Erstellt von DL-Redaktion am 14. November 2019

im Evangelischen Kirchenbezirk Ravensburg ?

Bavendorf Ev Kirche 2011b.jpg

Offener Brief von Stefan Weinert an Herrn Dekan Dr. Friedrich Langsam

Sehr geehrter Herr Dekan Dr. Langsam,

sehr geehrte Damen und Herren im Ravensburger

Evangelischen Gesamtgemeinderat,

auf dem Hintergrund der aktuell stattfindenden EKD-Synode in Dresden und der Tatsache, dass es auch aus dem Kirchenbezirk Ravensburg Bewerber/innen für das zukünftige Amt einer/s Synodalen gibt und unter der Prämisse einer schonungslosen Aufarbeitung hätte ich gerne von Ihnen gewusst, ob es auch im Dekanat Ravensburg, Fälle von sexuellen Übergriffen von Pfarrern, Pastoren, Diakonen, Jugendmitarbeitern, Kirchenmusikern oder Ehrenamtlichen gegenüber ihnen anvertrauten Mädchen, Buben und Erwachsenen gab und gibt. Zwar bin ich kein Mitglied der Evangelischen  Kirche und ich frage auch nicht als Christ, der ich zwar bin, sondern als Mitglied der Gesellschaft, die auch die Evangelische Kirche erheblich finanziert. Es kann und darf nicht nur eine gewisse Transparenz in Dresden geben, sondern sie muss in jeder Kirchengemeinde beginnen. Zudem hätte ich gerne von Ihnen gewusst, wie Sie zu dem Thema „Entschädigung“ stehen. Bitte verzichten Sie bei einer etwaigen Antwort auf  Allgemeinplätze und Verweise nach Oben. Danke.
Denn eigentlich – so die Idee ihres Gründers – sollte die Kirche eine für den, durch den Alltag gebeutelten Menschen, entlastende lebendige Bewegung sein. „Einer trage des anderen Last,“ betont deshalb auch der zum Paulus gewordene frühere Christenverfolger, und fährt fort: „So erfüllt ihr das Gesetz Christi.“ Doch die Kirche – und seit 502 Jahren, die Kirchen – sind für die Gesellschaft ganz im Gegenteil  – wie einst Bruno – zum „Problembär“ geworden. Bereits vor einem Jahr (2018), auf der EKD-Synode in Hannover, sagte die Hamburger Bischöfin Kirsten Fehrs: Eine Kirche, die solcher Gewalt nicht wehrt, ist keine Kirche mehr“.
Damals berichtete die Bischöfin von Johanna (15) , die ihr berichtete, wie alles anfing. Sie (Johanna) fand es eklig, als der Pastor sie das erste Mal überfallartig küsste und an die Brust fasste.Ein Fall von sexuellem Missbrauch, ein Teil einer Serie in Ahrensburg, einer Kleinstadt nördlich von Hamburg. Die evangelische Kirche habe, so Fehrs, aufgrund ihres  Systems ganz spezifische Risikofaktoren. Sexualisierte Gewalt werde an Kindern und Jugendlichen gegangen, aber auch an Erwachsenen in Beratungsszenarien und Abhängigkeitsverhältnissen. Die Täter seien Pastoren, aber auch Jugendmitarbeiter, Kirchenmusiker oder Ehrenamtliche. Gerade weil in der evangelischen Kirche so viele Berufsgruppen und auch Ehrenamtliche Verantwortung gegenüber Kindern und Jugendlichen trügen, müsse man sie alle in den Blick nehmen. Dazu kämen die vereinsartigen Strukturen der evangelischen Kirche: Oft sei es unklar, wer für was zuständig ist, und weil jeder jeden kenne, rede man nicht öffentlich über die Taten. Es gebe unreflektierte Vermischung von Privaten und Dienstlichem und Einrichtungen, die als „Closed Shops“ geführt würden.
Kerstin Claus ist die erste Betroffene von sexuellem Missbrauch, die vor der aktuell stattfindenden EKD-Synode in Dresden spricht. Die heutige Journalistin, Kerstin Claus, wurde als Jugendliche von ihrem evangelischen Gemeindepfarrer über längere Zeit missbraucht.
 Vor einem Jahr in Würzburg hatte die Synode einen Elf-Punkte-Plan beschlossen. Insgesamt sind der evangelischen Kirche mittlerweile 770 Missbrauchsopfer bekannt. 60 Prozent davon betreffen Fälle aus dem Bereich der Diakonie. 40 Prozent ereigneten sich in Kirchengemeinden. 
Einen offenen Dissens gibt es zwischen der EKD und den Betroffenen über die Frage, ob Entschädigungen gezahlt werden sollen. Ein Mitglied des Beauftragtenrats betont, dass die in der katholischen Kirche genannten Entschädigungssummen zwangsläufig zu Auseinandersetzungen über die Beweisbarkeit von Sachverhalten führen könnten, also genau zu den Verfahren, die die Betroffenen über lange Zeit stark belasten und retraumatisieren würden. Bischof Bedford-Strohm sogar meint, sexueller Missbrauch sei ein solch schlimmes Vergehen, dass es mit Geld nicht wieder gut zu machen sei. Anders als es die katholische Kirche seit Jahren tut, wolle die evangelische Kirche keine pauschalen Summen an Opfer zahlen, hatte selbige Bischöfin Fehrs zuvor betont. Wie Claus sagte, gehe es nicht darum, dass die Kirche sich freikaufe. Nötig sei ein lebenslanges Bemühen, den Opfern gerecht zu werden. 
Das ist blanker Zynismus und auch Kerstin Claus sieht das anders. Ihr und den Opfern gingen die Schritte der Kirche nicht weit genug. Die evangelische Kirche habe lange gezögert, ehe sie die Missbrauchsproblematik erst 2018 offensiv angegangen habe. Nun müsse die Kirche die Bedürfnisse der Betroffenen in den Mittelpunkt rücken, es sei eine transparente Entschädigungsregelung nötig.Sie meint, sexueller Missbrauch habe vielfältige biografische Folgen. Auch deswegen müsse es solch eine Debatte geben. Vor allem aber ruft die Betroffene die evangelische Kirche zu einem Mentalitätswechsel auf. „Sie und ihre Kirche haben noch immer keine klare Haltung gefunden, was den Umgang mit uns Betroffenen angeht“, sagte Claus vor der Synode und fuhr fort: „Sie werden Ihre Deutungshoheit aufgeben müssen.“ Und dann meldet Claus auch ganz konkrete weitere wichtige Forderungen an: „Täter dürfen nicht weiter im Verkündigungsdienst der Kirche stehen.“
Für eine erhellende, transparente und zeitnahe Information wäre ich dankbar.
Mit freundlichen Grüßen,
Stefan Weinert
Grafikquellen         :

Oben       —           Evangelischer Friedhof Bavendorf (Ortschaft Taldorf, Stadt Ravensburg) mit der evangelischen Kirche

Abgelegt unter Baden-Württemberg, Kommunalpolitik, Kultur, Religionen | Keine Kommentare »

Elektroautos : Aus Aachen

Erstellt von DL-Redaktion am 12. November 2019

Versucht die fossile Autoindustrie dies zu verhindern?

File:StreetScooter C16.jpg

Quelle       :     Scharf  —  Links

Von Walter Schumacher

Vor über 100 Jahren wurden in Aachen schon mal Autos hergestellt [1].
Seit 2014 gibt es erneut eine Autoproduktion: mit dem „Streetscooter“ und dem e.Go“ werden zwei besonders sinnvolle Elektro-Auto-Typen [2] entwickelt, serienreif gemacht und hergestellt, die wirklich beispielhaft sind für „vernünftige“ E-Autos! [3]

Während einerseits alle politischen und wirtschaftlichen Indikatoren in Richtung eines großen Erfolgs für das Produkt stehen, kommen aber weder die Produktion noch die Auslieferung dieser Fahrzeuge richtig in Gang!

Manipuliert die „fossile“ Autoindustrie die Herstellung vernünftiger Elektro-Autos?

Als kraz beobachten wir diesen erstaunlichen Widerspruch schon seit langem und stellen uns die Frage: Wird die Produktion vernünftiger E-Autos in Aachen gewollt behindert? Und warum könnte das geschehen?

Vorweg das Besondere an Streetscooter und e.Go

  • Der erste war der „Streetscooter“ (10/2015). Er ist ein Elektro-Lieferwagen und es gibt ihn in zwei Größenvarianten: „klein“ wie ein VW-Transporter und „groß“ wie ein Mercedes-Sprinter. Es ist ein zweckmäßig konstruiertes, einfaches Fahrzeug. Die Einzelkomponenten sind weitestgehend Standardprodukte.
    Er passt perfekt in das Anforderungsprofil „Versorgungs- und Arbeitsfahrzeuge im Nahbereich“ (<150km) mit vielen Zwischenhalten, Rückkehr zu einem festen Standort und einem Fahrzeugpool bei flexibler Nutzung von Firmen. Ein perfektes Fahrzeug für ALLE städtischen und regionalen Lieferdienste.
    Die Streetscooter gingen sehr schnell an die Kunden. Seither laufen etwa 10.000 Fahrzeuge in einem harten Alltagsbetrieb. Es sind keine bemerkenswerten Produktionsfehler bekannt geworden.
  • Das zweite Aachener Fahrzeug ist der „e.Go“ (seit 2016), ein kleiner Stadtwagen. Vom Raumangebot her ist er zwischen Smart und Fiat 500/VW Lupo angesiedelt. Technisch ist er komplexer als der Streetscooter, basiert aber auf den Erfahrungen bei dessen Entwicklung. Auch hier werden sehr einfache Komponenten verwendet. Es gibt keine technisch-sachlichen Gründe für Lieferprobleme der Komponenten (außer: man will nicht liefern). Ebenso wenig sind Probleme bei der Zulassung des Wagens bekannt.
    Das Anforderungsprofil ist gezielt für den innerstädtischen Ein-/Zwei-Personenverkehr konzipiert; entweder als Firmenpool-Wagen oder aber als privater Zweitwagen. Mit einem Preis von <20.000€ ist der e.Go deutlich preiswerter als die heutigen anderen E-Autos!

Beide Wagen sind auf ein Käuferpublikum mit folgenden Eigenschaften ausgerichtet: Zweckmäßige Nutzung eines Fahrzeugs, ökologische Orientierung, kein Bedarf an psychologischem Imageaufbau/Protzen (ich-bin-männlich, ich-bin-sportlich, ich-bin-reich).
Diese positive Bewertung bezieht sich ausdrücklich auf das genannte Nutzersegment. [3] Es sind keine klassischen Allzweckautos – da müsste sich noch deutlich was an der Batterietechnik tun. Aber für die genannten Nutzungssegmente gibt es zur Zeit nichts besseres als diese beiden Wagentypen!

==> Hierzu ein positiver Bericht in Auto-Motor-Sport

Die bisherige (kurze) Geschichte von Streetscooter und e.Go

  • Der „Streetscooter“ startete 2014 fulminant und machte ansehnliche Produktionszahlen. Die Firma (Produktionsanlagen) wurde 2014 von der Post AG aufgekauft und sogar noch in Düren durch ein zweites Werk erweitert – und dann würde es plötzlich ganz ruhig um den Wagen.
    Anfangs war er ein Verkaufsrenner. Die Post hat über 10.000 Fahrzeuge im Einsatz, man sieht das Fahrzeug aber auch bei anderen Lieferdiensten. Trotz dieser Erfolge wird der Streetscooter mittlerweile als Sorgenkind präsentiert, Gerüchte besagen, dass die Post das Werk wieder verkaufen will.
  • Den „e.Go“ gibt es seit 3/2017. Seit 5/2017 kann man den Wagen prinzipiell! kaufen. Und mittlerweile arbeiten 500 Leute in dem e.Go-Werk – aber der Wagen wird einfach nicht ausgeliefert!
    Seit mindestens 11/2018 gibt es auf der Hohen Straße in Köln einen großen ‚e.GO Pop-Up Store‘, in dem systematisch Werbung für den Kauf des e.Go macht. Die Verantwortlichen werden das Geld dafür doch nur in die Hand genommen haben, weil sie selber den baldigen Verkauf des Wagens erwartet hatten.
    Stattdessen werden halbjährlich Ausreden für die Nicht-Auslieferung veröffentlicht und die (willigen) Kunden immer wieder vertröstet. Ursprünglich sollten 3000 Fahrzeuge bis Ende 2019 produziert werden. Die Auslieferung ist aber erneut ins Jahr 2020 verschoben worden.
    Den e.Go gibt es „theoretisch“, aber aus irgendwelchen dubiosen Gründen ist er einfach nirgends zu kaufen! Auch der OB Philips wartet nach eigener Aussage immer noch auf „seinen“ e.Go!

Warum also Probleme – bei beiden E-Fahrzeugen?

Diese mysteriöse Geschichte über „Produktionsprobleme“ wird halbjährlich in den lokalen Zeitungen mit wortreichen Ausreden und erstaunlichen Meldungen begründet. Die letzte Überschrift dazu lautet am 19.10.2019 in den AN „e.Go räumt Produktionsprobleme ein.

  • Zu Problemen beim „Streetscooter“ ist (öffentlich) nichts bekannt!
  • Beim e.Go werden öffentlich folgenden Gründe genannt:
    • Der Lieferant ‚Ford‘ liefert nicht. (Was, welche Teile und warum? Ist unklar)
    • Der Batterielieferant ‚BMZ‘ ziert sich mit Lieferungen.
    • Und echt witzig: in den AN vom 19.10.19 wird eine „IP67-Regel für technische Geräte“ zitiert, die folgende skurrile Auflage enthält: „technische Geräte müssen auch nach einem mind. 30 minütigem Tauchbad im bis zu einem Meter tiefen Wasser voll funktionsfähig sein“. Und weil Lieferkomponenten diese Regel nicht erfüllen, darf der e.Go nicht gebaut werden?? Hmm!?

Es gibt ein ganz anderes, aber echtes Problem beim e.Go

Dort entstehen monatliche Unkosten von 2-3 Mio Euro! Seit Monaten sind dort ca. 500 Leute beschäftigt, was bei e.GO mindestens 2-3 Mio Euro Kosten, ohne jedwede Einnahmen erzeugt. Es müsste also ein Kostenproblem existieren – das aber öffentlich NICHT problematisiert wird.

Wieso führt das eigentlich nicht zum Bankrott? Wer bezahlt das?
Sorgt VW dafür, dass das Werk nicht pleite geht? Sorgt VW für Ruhe an den Arbeitsplätzen (wo ja faktisch nicht produziert wird) und „erkauft“ sich (wörtlich) so die Zeit, um seine wesentlich teureren Modell an den Markt bringen zu können? Die Erklärung könnte in der „Strategischen Partnerschaft“ von VW und e.Go liegen (siehe weiter unten).

Unsere Vermutung:
Es gibt einen Boykott der Auto-Industrie gegen ein vernünftiges E-Auto!

Je öfter sich die Ausreden für die Nicht-Lieferung des e.Go wiederholen, desto mehr fragen wir uns, ob wir gerade Zeugen werden, wie die (fossile) deutsche Autoindustrie mit trickreichen Mitteln verhindert, dass endlich mal vernünftige Elektro-Autos (statt der gigantischen E-SUVs) auf den Markt kommen?

Wir haben deshalb mal zusammengestellt, was wirklich hinter dieser eigenartigen und für Aachen (als perspektivischem Produktionsstandort) etwas bitteren Geschichte stecken könnte.

Indizien für eine „gewollte Produktionsbehinderung der sinnvollen E-Autos“

Unser Denkansatz lautet: Die Produkte Streetscooter und e.Go sind (vom Timing und der Funktionsweise) viel zu gut, sodass sie den ganz Großen in der Automobilbranche als Konkurrent echten ökonomischen Ärger machen und deshalb auf dem Markt stark „eingehegt“ oder besser noch „verhindert“ werden müssen. Möglicherweise hatte die fossile Autoindustrie beim Streetscooter noch erwartet, dass die RWTH-Newcomer es nicht schaffen würden. Aber nachdem der Streetscooter dann doch ein Erfolg wurde, wollten sie beim e.Go „besser aufpassen“. Die folgenden Argumente gelten für beide Fahrzeuge.

  • „Zeit schinden, um noch ein/zwei Jahre fossile Autos verkaufen zu können“ (= ExtraProfit-sichern). Jeder Monat spätere Auslieferung guter E-Autos schafft „Zeitraum“ für den Verkauf weiterer (gewinnbringender) Fossil-Autos.
  • „Zeit schinden, um als erstes Protz-E-Autos verkaufen zu können“ (=ExtraProfit-sichern). Solche sinnvollen E-Autos kommen für die fossile Autoindustrie „zu früh“, weil:
    • der Markt für dicke E-SUVs & schnelle E-PKW frei bleiben soll. Leute mit viel Geld wollen sich ein „grünes Image“ kaufen und zahlen dafür auch gerne viel Geld ….
    • erst nach Abdeckung dieses Marktanteils, „lohnt“ sich auch die Belieferung des preiswerteren Marktsegments.
      Sobald einmal der e.Go für 16.000 – 19.000 € auf der Straße zu sehen sein wird, brechen mit Sicherheit die Verkaufszahlen all der wunderschönen E-Golfs E-Opels, E-BMW, E-Benz ein, die zwar (sinnloserweise) in 3 Sek von Null auf 100 km/h „können“, aber preislich mindestens ein/zwei Klassen teurer sind.
  • „Diskreditieren“
    Diese Protz-E-Autos werden die Diskussion um die E-Mobilität bestimmen, weil viele ernsthafte Umweltschützer leider ausschließlich den Irrsinn der Protz-E-Autos sehen werden. Die Relevanz von sinnvollen E-Autos wird dann (wie beabsichtigt?) in den Hintergrund gedrängt.
  • „E-Auto als Spielzeug“?
    siehe zusätzlich auch den Artikel „Produziert e.Go Mobile bald ein VW-Funcar?

Eine vergiftete „strategische Partnerschaft“ mit VW?

Es gibt eine vertraglich/kommerzielle Verbindung zwischen VW und e.Go, die ebenfalls für die von uns unterstellte, bewusste Behinderungs-Strategie spricht: Wir wissen, VW will e.Go als Basis für die eigene, zukünftige E-Mobilitätssparte haben. (In den AN vom 5. März 2019 heißt es dazu: „… Der Weltkonzern öffnet seinen Elektrifizierungsbaukasten (MEB), mit dem es ab 2020 die neue Generation von Elektroautos bauen will, … e.GO ist weltweit der erste Partner in der Elektrosparte … Das Aachener Unternehmer profitiert doppelt von der Kooperation: Zum einen kann der Baukasten in die gerade anlaufende Produktion des eigenen e.GO life integriert werden. Und beide Unternehmen entwickeln in den kommenden Monaten gemeinsam ein Elektro-Auto, das die VW-Flotte ergänzen soll….“ (

Das würde einerseits erklären, wer und warum die Übernahme der aktuell entstehenden Kosten übernimmt. Unfreundlich formuliert ist das dann ein „Leerlauf-Geld“ oder „Bestechungsgeld“ von VW, damit im Aachener e.Go-Werk Ruhe herrscht und man „freiwillig“ nicht liefert, um so den Markt für die in 2020 kommenden (erhofften) VW-Modelle „frei“ zu halten.

Beides macht Sinn für VW: Einerseits so den gefährlichen Newcomer klein halten; gleichzeitig sich dessen Know-how für die eigenen (eigentlich zu spät) kommenden Goliath-Aufgaben an zu eignen!

Es KÖNNTE aber auch ganz anders sein…

Es gibt doch echte Probleme bei der Produktion – eine simplere Erklärung?
Dann wären die Produktions- und Auslieferungsverzögerungen Ergebnis echter Probleme und zeigen nur, dass eine RWTH (bzw. das kommerzielle Spin-Off) nicht in der Lage ist, ein sinnvolles verkäufliches Produkt zu entwickeln, technisch zu planen und zu produzieren. Wir von der kraz glauben DAS nicht.

Zum Schluss eine Bitte

Wir haben versucht, eine wichtige Wirtschaftsentwicklung in Aachen zu beschreiben. Uns fehlen eine Reihe von Fakten, wir haben nur „mögliche“ Erklärungen geliefert. Unsere LeserInnen mögen selber entscheiden, was da eigentlich los ist.

Als kraz-Redaktion würden wir uns aber freuen, wenn wir Insider-Informationen bekämen, die unsere genannten Thesen entweder stützen oder aber widerlegen. Uns geht nicht um das „Recht-Haben“, wir wollen „verstehen“.


[1] Zur Geschichte der Aachener Auto-Produktion
Zu Beginn des vorigen Jahrhunderts (1903) gab es eine Automobilproduktion in Aachen durch die Firmen Fafnir und Cudell. Aber schon 1926 war alles wieder vorbei. Deshalb war es schon eine Sensation, als Streetscooter und e.Go als Spin-Offs der RWTH neu auftauchten.

[2] Das Missverständnis im Namens „Elektro-Auto“
Ein Elektro-Auto heißt so, weil der Antrieb „elektrisch“ ist. Der Strom für den Antrieb kann prinzipiell auf unterschiedliche Art ins Fahrzeug gelangen (Straßenbahnen und O-Busse bekommen ihn per Oberleitung). Bei Autos ist der heutige Standard eine (Lithium)-Batterie. Sie könnten aber genauso gut durch Brennstoffzellen (Wasserstoff) mit Strom versorgt werden! Eine (veraltete) Zwischenlösung war ein kleiner fossiler Motor im Fahrzeug, der dessen Batterie und damit die Elektromotoren mit Strom versorgt.

[3] Unser hohes Lob für den Streetscooter und den E.Go könnten so wirken, als ob wir E-Autos für DIE Lösung der städtischen oder gesellschaftlichen Problematik des Autoverkehrs halten.
Nein, wir wissen sehr wohl, dass Elektrofahrzeuge auch den gleichen Platz verbrauchen, den Fuß- und Radverkehr gefährden und verdrängen, die Städte mit Lärm verpesten usw. usf.. Elektroautos sind nur in einigen Bereichen ein echter Fortschritt gegenüber den fossilen Autos. In anderen sind sie genauso schlecht und für das „schlechte Gewissen bei der Autonutzung“ sind E-Autos sogar eher verführerisch, um sich so ein reines Gewissen zu verschaffen!
Wir wissen, dass die wirkliche Lösung ein anderes Verkehrskonzept (= anderer Modalsplit) mit viel mehr Öffentlichem Verkehr (ÖV) sein muss und sein wird. Hierzu gab und gibt es in Aachen Überlegungen („Renaissance der Tram“), über die wir in einem längeren Artikel berichten werden.

Datei:Streetscooter 3.JPG

ABER: Wir wissen auch, dass die Umformung unserer Lebenswelt in Auto-gerechte-Städte – und leider auch des „Denkens“ der Menschen im Sinne einer ‚Windschutzscheibenperspektive‘ – „erfolgreich“ gesteuert durch die Profitlogik der Autoindustrie gelungen ist und dass mit dem aktuellen Höhepunkt der Perversion durch SUVs und der aktuellen Automode mit den hochgeschürzten, aggressiven Frontpartien der Autos eine spezielle Form der „Männlichkeit“ bedient wird.

Deshalb wird es – egal wie schnell ein deutlich besserer ÖV entwickelt wird – noch lange individuell fahrende Autos geben, die bestimmte Bereiche in den Städten und Regionen mit Autos statt mit ÖV bedienen. Unklar ist, wie lange es noch dauert, bis die selbstgesteuerten durch autonom fahrende Fahrzeuge ersetzt werden. Und spätestens DANN wird ein hoher Bedarf an elektrischen – statt fossilen Antrieben bestehen.

Deshalb wünschen wir uns jetzt schon die beschleunigte Entwicklung der Elektroautos – und gerne auch Aachen als die Stadt, in der die Vorreiterfahrzeuge entwickelt und produziert werden. Heute polemisieren noch nur noch genau diejenigen gegen E-Fahrzeuge, die bisher immer die fossile Industrie und ihre Protz-Autos erhalten wollten. Wenn sie dabei heute das Argument „mehr ÖV“ verwenden, ist das nur verlogen. Wir sagen das aus Kenntnis der Verkehrspolitik der letzten 35 Jahre, die sich an zwei wichtigen Lobbyorganisation manifestiert hat: Dem ADAC (als reine Autolobby) und dem VCD (=Verkehrsclub Deutschland), der sich seit seiner Gründung 1986 eindeutig für ein sinnvolles Miteinander ALLER Verkehrsteilnehmer: Fußgänger, Radfahrer, ÖV-Nutzer und Autofahrer einsetzt.


Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen          :

Oben           —         Prototyp StreetScooter Leichtelelektromobil     C 16

Author Franz Haag

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.


Unten      —          Streetscooter – Ein batteriebetriebenes Lieferfahrzeug für die Deutsche Post, gebaut in Aachen von der Talbot Services GmbH

Urheber RudolfSimon

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Medien, Nordrhein-Westfalen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.


Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.


2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.


3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.


Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

30 Jahre Mauerfall

Erstellt von DL-Redaktion am 2. November 2019

Geistiges Kleingärtnertum

Von Stefan Reinecke

Non Stefan ReineckeDie westdeutsche Linke träumte von Revolutionen. Doch als 1989 eine vor ihrer Haustür geschah, war sie überfordert.

Wir kennen die Bilderschleifen, die jeden 9. November aufs Neue gezeigt werden. Wahnsinn-Rufe, knatternde Trabis, Genscher und der Jubel in der Prager Botschaft. Auch Bilder können Floskeln werden, die mehr verstecken als erhellen. Im Herbst 1989, sagen diese Bilder, waren die Deutschen begeistert.

Alle Deutschen? Die Stimmung im Westen war viel schwankender. Im September waren aus der DDR schon Zehntausende in den Westen gekommen. Es fehlten Wohnungen und Jobs. Laut einer Umfrage meinte fast die Hälfte der Westbürger, das Boot sei jetzt leider voll und die Ostler sollten bitte in Plauen und Güstrow bleiben.

Ein paar Wochen nach dem Mauerfall ventilierte Oskar Lafontaine, ob DDR-Bürger weiterhin ein Anrecht auf Sozialleistungen haben sollten. Damit fördere man ja deren Abwanderung. Der SPD-Chef wollte, zumindest für eine Weile, zwei Staatsbürgerschaften. Lafontaine wollte die DDR genau in dem Moment faktisch anerkennen, in dem die SED politisch und die DDR wirtschaftlich kollabierte.

Er spekulierte auf das Gefühl der Westler, von den Habenichtsen aus dem Osten überrannt zu werden. In seinen Reden erschien die Einheit eher als unvermeidliches Übel. Die Grünen rangen sich widerwillig im Frühjahr 1990 – noch nach der SED/PDS – dazu durch, anzuerkennen, dass die Zweistaatlichkeit Geschichte war.

Keine Hürde für Europa

Die Erklärungen von Sozialdemokraten und Grünen bezeugen, 30 Jahre später gelesen, Realitätsblindheit. Warum diese Irrtümer? Der Historiker Timothy Garton Ash hat die Unfähigkeit der SPD im Herbst 1989 mit der erstarrten Ostpolitik erklärt.

Die SPD war demnach auf die SED-Führung und die Politik kleiner Verbesserungen fixiert und nahm die Bürgerbewegung nur als Störung wahr. Die späte Ostpolitik zeigt in der Tat Wahrnehmungsblockaden einer Politik, die auf Verständigung mit den Macht­eliten einer Diktatur verengt war. Allerdings waren die Grünen eng mit der Bürgerbewegung verdrahtet – und hatten ähnliche blinde Flecken.

Die westdeutsche Linke versagte 1989 komplett: moralisch, analytisch und politisch. Moralisch gab es keine Rechtfertigung dafür, dem DDR-Volk, das sich gerade befreit hatte, vorzuschreiben, in welchem Staat es zu leben hatte. Warum sollte Selbstbestimmung in Tibet und der Westsahara gelten, aber nicht zwischen Rostock und Görlitz? Zudem hatte die DDR laut Grundgesetz-Artikel 23 misslicherweise das Recht, der Bundesrepublik beizutreten.

Politisch hechelte die Linke dem Geschehen hinterher. Kohl setzte zügig die Währungsunion um. Dazu gab es angesichts des Abwanderungsstroms von Ost nach West keine realistische Alternative. Doch Lafontaine war überzeugt, dass die Währungsunion ein Fiasko würde und Kohl, der Nationalist, von seinen haltlosen Versprechungen eingeholt würde. Auch die atemlose Kritik, dass die deutsche Vereinigung die europäische zerstören würde, war falsch. Kohl setzte die Einheit zusammen mit Paris, London, Moskau und Washington ins Werk. Die deutsche Einheit war keine Hürde für Europa – im Gegenteil.

Gegen den Kapitalismus

Nach dem 9. November zeigte sich das geistige Kleingärtnertum der politischen Linken. Sie war fasziniert von Revolten gegen Autokraten – in dem Moment, in dem eine Revolution vor ihrer Haustür passierte, war sie schnell irgendwie beleidigt. Eine Epoche ging zu Ende. Die radikale Linke nahm übel, weil die Ossis genau das wollten, was sie ablehnte: Parlamentarismus und Kapitalismus. Viele Sozialdemokraten und Grüne klammerten sich an ihre eingravierte Überzeugung, dass es zwei deutsche Staaten geben müsse, und mäkelten, dass Kohl wieder alles falsch mache. Aber Kassandra gewinnt keine Wahlen.

Warum dieses Versagen? Es wurzelte nicht in der Nähe zum SED-Regime, sondern tiefer. Es gab in der Linken zwar eine kleine Strömung – um Rudi Dutschke, Tilman Fichter und Peter Brandt – die die Einheit als linkes Projekt verstanden. Doch das Gros hielt das für einen bizarren Spleen.

Die meisten Linken verstanden die Teilung irgendwie als gerechte Strafe für die NS-Verbrechen. Das war historisch Unsinn: Die innerdeutsche Grenze war, wie jedes Schulkind wissen konnte, Resultat des Kalten Krieges. Aber unser Gefühl sagte etwas ­anderes. Wir waren, manche insgeheim, manche ­offen, froh, dass die Mauer die fatale Geschichte des deutschen Nationalstaates beendet hatte.

Bundeshauptstadt Bonn 04.jpg

Ich will die neue Kanzlerin werden. Mein Hab und Gut habe ich mitgebracht.

Und gab es dafür nicht auch solide, vernünftige, moralische Motive? Der Historiker Hans Mommsen hatte 1981 eine historische Einordnung des bundesrepublikanischen Selbstgefühls skizziert. Wie in Österreich gebe es in der Bundesrepublik das Bewusstsein, etwas Eigenes geworden zu sein. Der Bismarck’sche Nationalstaat sei Geschichte und die Deutschen seien angesichts der Katastro­phen des 20. Jahrhunderts besser in mehreren Staaten aufgehoben.

Die westdeutsche Linke war postnational – und damit Avantgarde. Die Hälfte der unter Dreißigjährigen im Westen empfand die DDR 1987 als Ausland. In einem CDU-Programmentwurf von 1988 kam die Wiedervereinigung nicht mehr vor. Hatte nicht auch Helmut Kohl 1981 festgestellt, dass „die verlorene Einheit im Sinne eines alten Nationalstaates nicht mehr wiederherstellbar ist“?

Quelle          :        TAZ         >>>>>        weiterlesen


Grafikquelle          :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt

Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons


2.) von Oben    —           DL / privat  – CC BY-SA 3.0


Unten         —        Die Bundesumweltministerin Angela Merkel am Stresemannufer hinter dem Plenarsaal der ehemaligen Bundeshauptstadt Bonn beantwortet einem Fernsehteam deren Fragen. Im Hintergrund ist das Abgeordnetenhochhaus Langer Eugen zu sehen. Fotografische Impressionen von Andreas Bohnenstengel während der Parlamentarischen Woche im Juni 1995 in: Der Dreizehnte Deutsche Bundestag. Innenansichten unseres Parlaments. ISBN 3-87576-357-2

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Der Cum-Ex-Prozess

Erstellt von DL-Redaktion am 29. Oktober 2019

Der Kronzeuge packt aus


Von , und

Dieser Mann weiß fast alles über den größten Steuerraub der deutschen Geschichte. Denn er gehörte zum inneren Zirkel der Täter. Nun sagt er im Bonner Cum-Ex-Prozess aus.

Im Frühjahr 2016 kommt es in einem Besprechungsraum des Flughafens Zürich zu einer Begegnung, die für die strafrechtliche Aufarbeitung des größten Steuerraubs in der deutschen Geschichte wegweisend ist. Dort treffen sich Männer, die die Geschäfte zulasten der deutschen Staatskasse perfektioniert haben. Gemeinsam haben sie über Jahre hinweg Cum-Ex-Deals eingefädelt. Doch jetzt will einer von ihnen auspacken. Er will zum Kronzeugen der Staatsanwaltschaft werden und alles über die unlauteren Geschäfte erzählen, die sie gemacht haben.

Aufgebracht reden die anderen Männer auf ihn ein. Für sie ist die Staatsanwaltschaft der Feind. Es sei verrückt, mit ihr zu kooperieren. Die Phalanx müsse stehen. Rund anderthalb Stunden geht das so. Dann unterbricht der Anwalt des Aussteigers die aufgeregte Debatte: „Wissen Sie, wir haben das alles gehört. Aber wir machen alles genau anders.“ Der Bruch ist vollzogen. Bald darauf empfängt die Oberstaatsanwältin und Cum-Ex-Anklägerin Anne Brorhilker ihren wichtigsten Belastungszeugen zum ersten Mal in einem unscheinbaren Vernehmungsraum im Landeskriminalamt Düsseldorf.

Der Mann, der von dieser Szene berichtet, soll an diesem Dienstag im ersten Cum-Ex-Strafprozess vor dem Landgericht Bonn als Zeuge aussagen. Dreieinhalb Jahre nach dem Treffen in Zürich dürfte er Dutzende Personen und Banken schwer belasten, sofern er seine Aussagen vor der Staatsanwaltschaft im Gericht wiederholt. Unter anderem äußerte er sich zu den Hamburger Privatbanken M.M.Warburg und Varengold, zur Schweizer Privatbank Sarasin, zur australischen Investmentbank Macquarie und zu verschiedenen Depotbanken. Außerdem zur Kapitalverwaltungsgesellschaft Ballance, die in dem Prozess eine wichtige Rolle spielt.

Vor einem Jahr hat der Zeuge seine Rolle im Cum-Ex-Skandal in einem Gespräch ausführlich beschrieben, das er mit einem Reporterteam vom ARD-Magazin Panorama, der ZEIT, ZEIT ONLINE und Correctiv unter dem Namen Benjamin Frey geführt hat. Er sagte damals: „Das ist organisierte Kriminalität in Nadelstreifen.“ Seine Geschäftspartner und er hätten sich gefühlt, als hätten sie Fort Knox geknackt. „Warum? Weil der Staat die Quelle des Geldes war und diese Quelle, die konnte nicht versiegen.“

Von den Männern, die bei jenem denkwürdigen Treffen in Zürich dabei waren, muss sich im Bonner Prozess allerdings keiner verantworten. Angeklagt sind dort zwei britische Aktienhändler. Sie sollen zwischen 2006 und 2011 insgesamt 447,5 Millionen Euro aus der deutschen Steuerkasse geraubt haben. Aber sie haben, so sagt es der Zeuge, eng mit seinen Geschäftspartnern zusammengearbeitet, unter anderem über ihre Firma Ballance.

Außerdem hat das Landgericht fünf Banken an dem Prozess beteiligt, darunter die Hamburger Warburg-Gruppe, die der Zeuge vor der Staatsanwaltschaft belastet hat. Das Gericht nutzt damit den neu gefassten Paragraf 73 des Strafgesetzbuchs. Wenn Finanzinstitute eine Tat nicht unmittelbar begangen, sich aber mutmaßlich daran beteiligt und daraus Profite erzielt haben, könnten demnach nach einer Verurteilung der Täter Vermögen der Institute eingezogen werden, um den angerichteten Schaden auszugleichen.

Das Bonner Verfahren ist ein Musterprozess. Noch nie ist jemand strafrechtlich dafür belangt worden, dass er sich an Cum-Ex-Deals beteiligt hat. Sollten die beiden Aktienhändler verurteilt werden, wäre eine Grundlage dafür geschaffen, viele weitere Beschuldigte vor Gericht zu bringen. Staatsanwaltschaften in Frankfurt und München ermitteln ebenso wie die Staatsanwaltschaft Köln, die die beiden Aktienhändler vor Gericht gebracht hat.

Quelle          :           Zeit-online            >>>>>          weiterlesen


Grafikquellen          :

Oben          —        Mann mit Maske von Wolfgang Mattheuer (1983), Skulptur am Gesundbrunnen, Heilbronn

Author p.schmelzle

I, the copyright holder of this work, release this work into the public domain. This applies worldwide. In some countries this may not be legally possible; if so:

I grant anyone the right to use this work for any purpose, without any conditions, unless such conditions are required by law.


Unten          —           Hauptsitz der M.M. Warburg & CO in der Ferdinandstraße 75 in Hamburg

Abgelegt unter Finanzpolitik, Justiz-Kommentare, Kultur, Nordrhein-Westfalen | Keine Kommentare »

Polizeigewalt in Köln

Erstellt von DL-Redaktion am 25. Oktober 2019

 Opfer-Täter-Umkehr wie aus dem Bilderbuch

File:Police brutality at Nigerian Embassy protest.jpg

Von Katja Thorwarth

Ein Mann erlebt Polizeigewalt, steht aber als Angeklagter vor Gericht. Obwohl er mehrfach freigesprochen wird, lässt die Staatsanwaltschaft nicht locker. Die Kolumne zum Thema.

Auf den Bildern, die der Mann 2016 auf Facebook postete, sieht man ihm die Misshandlungen an. Das Gesicht und der Kopf sind geschwollen, die Haut mit Blutergüssen übersät, die Arme und Beine malträtiert. Der Mann hatte sieben Stunden in Kölner Polizeigewahrsam verbracht.

An diesem Tag stand die Domstadt ganz im Zeichen des Regenbogens. Die CSD-Parade gegen Diskriminierung sexueller Minderheiten war in vollem Gange, als der Mann in eine Rangelei in einem Schnellrestaurant verwickelt wurde, die vor dem Eintreffen der Polizei bereits ein Ende fand. Den Ort hatte er sich noch geweigert zu verlassen, vielmehr soll er erschöpft auf einem Stuhl gesessen haben.

Opfer von Polizeigewalt: Wie das Protokoll eines Häftlings aus einem russischen Knast

Doch irgendetwas hatte die Beamten wohl getriggert, als der Mann mit einem Schlag ins Gesicht gegen die Wand geschleudert wurde. Er blieb reglos liegen, um mit einem „Schmerzreiz“ wieder in den Bewusstseinszustand überführt zu werden.

Damit sollte ein Martyrium seinen Anfang nehmen, das verschiedene Medien seit drei Jahren aufbereiten, und das sich liest wie das Protokoll eines Häftlings aus einem russischen Knast. Die Staatsdiener, dem Schutz des Individuums verpflichtet, legten ihm Handschellen an, traten und schlugen ihn, ehe sie ihn in ein Polizeiauto verfrachteten und in Unterhose und T-Shirt wegsperrten. Und mit klatschnasser Kleidung aus dem Hinterausgang entließen. „Das ist ein Bild, was voller Scham ist. Ja, voller Schmerz und Gewalt“, wird der Mann zitiert.

Polizeigewalt: Opfer-Täter-Umkehr wieaus dem Bilderbuch

Was hatte er sich zuschulden kommen lassen? „Das brauchst du doch, du dumme Schwuchtel“, soll die Aussage eines Polizisten laut Urteil des Landgerichts Köln gewesen sein, womit die Frage womöglich beantwortet ist. Denn wer sich das Geschehene vergegenwärtigt, könnte zu dem Schluss kommen, dass es sich hier um Homophobie in Uniform handelt, die in kollektivem Sadismus ihre Ausprägung fand. Und die als krimineller Akt zur Anklage gebracht gehört. Das ist bis heute nicht geschehen, im Gegenteil findet sich eine Opfer-Täter-Umkehr aus dem Bilderbuch.

20170707-IMG 9435.jpg

Bislang wurde der Fall zweimal vor Gericht verhandelt, und zweimal war das Opfer der Angeklagte. Die Beamten hatten wegen Widerstands gegen Vollstreckungsbeamte und Beleidigung Strafantrag gestellt, doch die Aussagen des Mannes wurden zweimal bestätigt, er zweimal vom Gericht freigesprochen – und jedes Mal, zuletzt 2019, ging die Staatsanwaltschaft in Berufung. Interessant an dieser Stelle ist, dass 2018 nur zwei Prozent mutmaßlich rechtswidrige Polizeigewalt von der Staatsanwaltschaft zur Anklage gebracht wurden. In diesem Fall scheint es jedoch so, als wolle die Staatsanwaltschaft das Opfer zum Täter umklagen.

Quelle          :       FR           >>>>>          weiterlesen


Grafikquellen          :

Oben          —              Police brutalize protester at rally against „embassy hearings“ in front of Nigerian Embassy, Berlin

Author Berlin Refugee Strike
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.


Unten       —       Ein schwarzer Block der Staatsgewalt rückt aus      —G20 summit policetroops

Abgelegt unter Köln, Kriegspolitik, Kultur, Nordrhein-Westfalen | Keine Kommentare »

Karliczeks Batteriezentrum

Erstellt von DL-Redaktion am 25. Oktober 2019

Ein Forschungsinstitut für Münster

Recke CDU Politischer Aschermittwoch 2014 Anja Karliczek Markus Pieper Karl Josef Laumann 01.jpg

Hoch auf den gebräunten Podest

Von Manfred Ronzheimer

Es wurde eine Kommission gegründet, um den besten Standort für das Institut zu finden. Dann entschied das Forschungsministerium ganz anders. Den Zuschlag bekam die Heimatregion der Ministerin.

Bundesforschungsminis­te­rin Anja Karliczek musste an diesem Mittwoch zum zweiten Mal im Forschungsausschuss des Deutschen Bundestags antreten, um Auskunft in der sogenannten Batterieaffäre zu geben. Seit drei Monaten wird der Politikerin vorgehalten, dass ihr Bundesministerium für Bildung und Forschung (BMBF) in der Standortentscheidung über die Errichtung einer Forschungsfabrik für Batteriezellen die NRW-Stadt Münster bevorzugt hatte, unmittelbar neben dem Wahlkreis der CDU-Bundestagsabgeordneten Karliczek. Zuletzt standen sogar Rücktrittsforderungen im Raum, sogar von der CDU-Kultusministerin Susanne Eisenmann aus dem unterlegenen Baden-Württemberg, ein ungewöhnlicher Vorgang – „friendly fire“.

Die Batterieaffäre hat in den letzten Wochen die Kommunikationsfähigkeit des deutschen Forschungsministeriums – mit 18 Milliarden Euro immerhin der viertgrößte Einzelplan im Haushalt der Bundesregierung – bis an die Grenzen belastet. Hintergrundgespräche und Briefings in Folge, eine außerplanmäßige Anhörung des Ausschusses in der Sommerpause, durchgestochene Dokumente aus den Beratungen – auf den Ministeriumsneubau am Rande der Spree rollte offenbar ein Polit-Tsunami zu.

Oder doch nur ein Sturm im Wasserglas? Am Dienstag dieser Woche trifft die Ministerin im Morgengrauen mit zwei Journalisten der Süddeutschen Zeitung zusammen, um Fehler einzugestehen, was sie tags darauf auch im Parlamentsausschuss wiederholen wird. Aber die Schuldeingeständnisse sind eher banal. So hätte die „Gründungskommission“ der Zellenfabrik aus ihrer Sicht einen weniger missverständliche Namen tragen müssen.

Tatsächlich aber ist die fragwürdige Vergabepraxis für die Forschungsfabrik nur die innere Puppe einer Art russischer Matroschka, die tiefer reichende Defizite der deutschen Innovations- und Industriepolitik in größeren Zusammenhängen symbolisiert. Puppe 2: Die innovative Fehlentwicklung der deutschen Automobilwirtschaft, die jedes Jahr Abermilliarden an Forschungsgeldern in die Fortentwicklung auslaufender Verbrennungstechnologien investiert und den Epochenübergang zur Elektromobilität verschlafen hat, zum Schaden des gesamten deutschen Volkswirtschaft.

Puppe 3: Der widerstandslose Abbau der Elektrochemie – einst ein Paradefeld deutscher Grundlagenforschung – in den Hochschulen der 80er und 90er Jahre, mit dem Nebeneffekt, dass der einst führende Batteriehersteller Varta in diesen Jahren zerlegt wird. Ausstieg aus einem Zukunftsfeld, auch durch Fehleinschätzungen der damaligen Wissenschaftspolitik. Der diesjährige Chemie-Nobelpreis 2019 für die Lithium-Ionen-Batterie geht logischerweise an keinen deutschen Forscher.

Ein internationales Wettrennen

Nun muss sich Deutschland sputen, um im internationalen Wettrennen um die Stromspeicher von morgen nicht abgehängt zu werden. Batterien unterschiedlicher Bauart werden nicht nur für die Elektromobilität auf der Straße oder die mobile Kommunikationstechnik, sondern vor allem als Puffer für die erneuerbaren Energien benötigt. In den letzten Jahren hat das BMBF rund 500 Millionen Euro in den Aufbau neuer Strukturen für die Batterieforschung investiert. Am stärksten profitiert hat davon der Standort Ulm in Baden-Württemberg.

Im vorigen Jahr reiften im BMBF die Pläne zum Aufbau einer Forschungsfabrik für neue Verfahren zur Produktion von Batteriezellen, die mit 500 Millionen Euro aus dem Forschungsetat finanziert wird. Als Träger wurde die Fraunhofer-Gesellschaft ausgewählt. Vorbild ist die vor einigen Jahren installierte „Forschungsfabrik Mikroelektronik“, die von Fraunhofer zusammen mit der Leibniz-Gemeinschaft realisiert wurde.

Das BMBF-Vorhaben läuft parallel zum Aufbau einer konventionellen Fabrik zur Produktion von Batteriezellen, die das Bundeswirtschaftsministerium (BMWi) aus seinem Etat mit einer Milliarde Euro bezuschusst. Den Antrag eines europäischen Industriekonsortiums hat Wirtschaftsminister Peter Altmaier am 9. Oktober bei der EU-Kommission in Brüssel zur Genehmigung für ein sogenanntes IPCEI (Important Project of Common European Interest) eingereicht. Hauptziel ist es hier, die Abhängigkeit der europäischen Autoindustrie von asiatischen Antriebsbatterien zu verringern.

Anja Karliczek 04.jpg

An dem Interessensbekundungsverfahren des BMWi hatten sich mehr als 30 Unternehmen aus der gesamten Wertschöpfungskette „mit Vorschlägen hoher Qualität beworben“, teilte das Altmaier-Ministerium mit. „Sie kommen aus den Bereichen Rohstoffe und Exploration, Materialgewinnung und Recycling, Kathoden-, Anodenfertigung und mechanische Komponenten, Batteriezellproduktion, -integration und -anwendung.“ Die Standort-Entscheidung soll in den nächsten Wochen getroffen werden.

Datenvernetzte Fabriken

In der Forschungsfabrik des BMBF sollen dagegen neue Wege beschritten werden. Anfang des Jahres 2019 wurde auf einer Veranstaltung des Batterieforums das BMBF-„Dachkonzept Forschungsfabrik Batterie“ vorgestellt, das den „Aufbau und Betrieb einer weltweit einzigartigen Pipeline für Batterieinnovationen“ umriss. Dabei geht es vor allem um die drei Teilbereiche „ Materialkonzepte“, „Zellkonzepte“ – wie sie auch schon in der Forschungsproduktionsanlage am ZSW in Ulm „validiert“ wurden sowie um „Produktionskonzepte“, bei denen die deutschen Stärken im Bereich von „Industrie 4.0“, der datenvernetzten Fabrik, ausgespielt werden sollen.

Quelle       :          TAZ         >>>>>           weiterlesen


Grafikquellen        :

Oben      —          The 13th Political Ash Wednesday (Politischer Aschermittwoch) of the CDU-Kreisverband Steinfurt in Recke, Kreis Steinfurt, North Rhine-Westphalia, Germany. Among the CDU politicians on the podium were (from left to right) the member of the Bundestag Anja Karliczek, the member of the European Parliament Dr. Markus Pieper and Secretary of State of Germany Karl-Josef Laumann.

Abgelegt unter Bildung, Nordrhein-Westfalen, P.CDU / CSU, Regierung | Keine Kommentare »

Köln-Kurden machten mobil

Erstellt von DL-Redaktion am 24. Oktober 2019

Der Krieg auf der Domplatte

Fichier:Düsseldorf, Rosenmontag 2016, politische Karnevalswagen (06).jpg

Aus Berlin und Köln Dinah Riese, Anett Selleund, Christian Werthschulte

Adnan organisiert in Köln Proteste gegen den türkischen Einmarsch. Bekir Yılmaz in Berlin kann dagegen verstehen, dass die Türkei keinen PKK-nahen Staat tolerieren will. Der eine ist Kurde, der andere Türke. Landet der Konflikt an der syrischen Grenze jetzt mitten in Deutschland?

Aus dem Hauptbahnhof von Köln strömen an diesem wie an jedem Abend die Pendler*innen hinaus. Aber statt des Dom-Panoramas erwartet sie heute etwas anderes: gelb-grün-rote Fahnen der kurdischen Miliz YPG. Seit über einer Woche versammeln sich hier kurdische Gruppen, um gegen den Einmarsch der Türkei in Nordsyrien zu demonstrieren. „Operation Friedensquelle“ nennt die Türkei das, was sie tut; als „nicht im Einklang mit dem Völkerrecht“ bezeichnet es Bundesaußenminister Heiko Maas (SPD). Am Mittag gab es in Köln eine Mahnwache, jetzt am frühen Abend eine Demonstration. Heute sind etwa einhundert Menschen gekommen. „Man muss einen Tag als Kurde leben, um die Kurden zu verstehen“, sagt Adnan, der die Versammlung angemeldet hat. Sein Nachname soll nicht in der Presse veröffentlicht werden.

Adnan arbeitet als Sozialarbeiter in Köln, seine Familie kommt aus einem Dorf in der Nähe von Kobani auf der nördlichen Seite der türkisch-syrischen Grenze. „Ich schaue jede freie Minute aufs Handy“, sagt er. Er liest Nachrichtenportale, wartet auf E-Mails seiner Verteiler und telefoniert mit Freund*innen, die südlich der Grenze auf syrischem Territorium gewohnt haben. Sie sind mittlerweile in die 100 Kilometer entfernte Stadt Raqqa geflohen. „Ich fühle mich so hilflos“, erzählt er. „Wir sind bestürzt, dass wir alleingelassen werden.“ Aber die Solidarität der Bevölkerung mit der Mahnwache sei groß. Einen Tag später, am Samstag, demonstrieren in Köln 10.000 Menschen. An einem der Startpunkte flucht eine Frau im Vorbeigehen im rheinisch-türkischen Akzent: „Diese Scheißkurden. Sollen die doch woanders demonstrieren.“ Niemand beachtet sie.

Es ist kein neues Phänomen, dass sich Konflikte in und um die Türkei auch in Deutschland niederschlagen, sei es die türkische Militäroffensive gegen die syrische Stadt Afrin im Januar 2018 unter dem Namen „Operation Olivenzweig“ – ebenfalls ein Friedenssymbol – oder der Putschversuch in der Türkei 2016; oder seien es die verschiedenen Militärputsche in der Türkei, etwa 1971 oder 1980, in deren Folge viele Kurd*innen vor Verfolgung aus der Türkei fliehen mussten – zum Beispiel nach Deutschland.

Türkischstämmige Menschen bilden laut Mi­krozensus 2018 die größte Minderheit in Deutschland: 13,3 Prozent der „Menschen mit Migrationshintergrund“ hierzulande haben diesen, weil sie selbst oder mindestens ein Elternteil die türkische Staatsbürgerschaft hat oder hatte. Das sind rund 2,8 Millionen Menschen. Darunter sind auch viele Kur­d*innen. Wie viele von ihnen in Deutschland leben, lässt sich nicht so leicht beziffern. Schätzungen gehen von 600.000 bis anderthalb Millionen aus, sie oder ihre Familien stammen vor allem aus der Türkei, aus Syrien, dem Irak oder dem Iran.

Beiderseits wird provoziert. Bei spontanen, nicht angemeldeten Aktionen gegen kurdische Versammlungen und Demonstrationen seien nach Einschätzung des nordrhein-westfälischen Verfassungsschutzes „Anhänger der rechtsextremistischen Grauen Wölfe“ unter den Teilnehmenden gewesen, erklärt das Innenministerium des Landes. Diese, „aber auch nationalistische regierungstreue Türken“ hätten bei diesen Aktionen den Wolfsgruß gezeigt, um ihr Gegenüber zu provozieren. Kurd*innen wiederum reagierten „auf dieses Zeichen hoch emotional.“

Anfang dieser Woche kommt es in Herne zu einer Schlägerei zwischen Türken und Kurden, wie die örtliche Polizei berichtet, beteiligt sind 50 bis 60 Personen. Schon in der Vorwoche wurde in der Stadt im Ruhrgebiet der Wolfsgruß gezeigt, wo­raufhin kurdische Demonstrant*innen erst einen türkischen Kiosk und dann ein Café angriffen. Eine kurdische Demonstration in Mönchengladbach wurde „verbal attackiert“, so das NRW-Innenministerium, bevor es zu körperlichen Auseinandersetzungen kam. In Dortmund wurden türkische Fahnen sowohl gezeigt als auch verbrannt, Letzteres hat der Versammlungsleiter rasch unterbunden. In Lüdenscheid wurde ein türkischstämmiger Mann mit einem Messer schwer verletzt, in Bottrop wurden aus einer Gruppe von etwa 200 Menschen heraus Pflastersteine auf eine kurdische Versammlung geworfen. Immer wieder seien auch Parolen der auch in Deutschland verbotenen Kurden-Partei PKK gerufen oder entsprechende Symbole gezeigt worden.

So hätte der „Schwarze Block des Staat“ aussehen können.

Es sei eine Situation „kurz vor der Explosion“, man sitze „auf einem Pulverfass“ – so ist seit Tagen zu lesen. Unsicher fühle er sich in Köln im Moment nicht, widerspricht Adnan, auch wenn er bestimmte Ecken meidet, wo sich ultranationalistische Türken treffen: „Das hat man nichts zu suchen.“

Im Bundesinnenministerium gibt man Entwarnung. Im Zusammenhang mit der türkischen Militäroffensive würden bereits seit geraumer Zeit „Mobilisierungsaktivitäten kurdischer und deutscher linker Organisationen verzeichnet“, sagt ein Sprecher des Ministeriums auf Nachfrage. Vereinzelte gewaltsame Auseinandersetzungen seien „nicht auszuschließen“. Eine „Verschärfung der ­Gefährdungslage“ sei derzeit aber „nicht erkennbar“.

Quelle       :         TAZ              >>>>>            weiterlesen


Grafikquellen          :

Oben        —        So sah es einmal in Düsseldorf aus. /Düsseldorf, Rosenmontag 2016, politische Karnevalswagen.

Cette œuvre a été placée dans le domaine public par son auteur, Kürschner. Ceci s’applique dans le monde entier.


Unten     —          Bereitschaftspolizei officers during a demonstration

Abgelegt unter Feuilleton, Köln, Medien, Überregional | Keine Kommentare »

Armut und Reichtum

Erstellt von DL-Redaktion am 23. Oktober 2019

Zieht doch nach Duisburg!

Sofienstraße - Karl-Morian-Straße, Duisburg-Neumühl, etwa 1976.jpg

von Utta Seidenspinner

Mit einem Mietendeckel will der rot-rot-grüne Berliner Senat die Hauptstädter entlasten: So sollen Vermieter nicht mehr als 30 Prozent des Haushaltseinkommens verlangen dürfen. Das aber geht am Problem vorbei, argumentiert die Journalistin Utta Seidenspinner. Wer Mieter schützen will, muss grundsätzlichere Lösungen finden.

„Ja, das möchste: / Eine Villa im Grünen mit großer Terrasse, / vorn die Ostsee, hinten die Friedrichstraße; / mit schöner Aussicht, ländlich-mondän, / vom Badezimmer ist die Zugspitze zu sehn – / aber abends zum Kino hast dus nicht weit. / Das Ganze schlicht, voller Bescheidenheit.“ So beschrieb Kurt Tucholsky 1927 das Berliner Ideal.

Frappierend aktuell, möchte man sagen. Alles wollen und auf nichts verzichten, so lautet derzeit die Devise der Berliner Politik: Mehr Wohnungen in der Hauptstadt der viertgrößten Wirtschaftsmacht der Welt fordern, aber bitte zum Preis von Görlitz. Erst in den 2000er Jahren die kommunalen Wohnungen verhökern, so das Stadtsäckel füllen und dann den Investoren die Schuld an der verfehlten Wohnungspolitik in die Schuhe schieben.

Warum so erbost? Weil hier mit der linken Bausenatorin Karin Lompscher eine Berliner Ballungsraum-Politikerin mit hilfloser Polemik auf jene Leute losgeht, die in den vergangenen Jahren überhaupt Wohnungen gebaut und saniert haben und es weiterhin tun sollen. Investoren aber können auch ausweichen. Und wer baut dann? Das notorisch klamme Berlin wohl kaum.

Der Job eines Investors hingegen ist es grundsätzlich, Geld zu verdienen. Wo er dieses Geld anlegt, ist seine Wahl. In Aktien, Rentenpapieren oder Immobilien. In Asien, USA oder Europa. Sein Kompass sind Kriterien wie Risiko, Aufwand, Zeithorizont und Rendite. Berlin hat soeben bei mindestens zwei der Kriterien – Risiko und Rendite – Alarm ausgelöst. Bei Mietern und damit bei den Wählern mag das gut ankommen. Mittel- und langfristig ist es aber kontraproduktiv, Investoren zu verschrecken.

Bewährt hat es sich in einer sozialen Marktwirtschaft vielmehr, Anreize zu schaffen, um Wünschenswertes zu fördern und Unerwünschtes zu verringern. Es geht darum, durchdachte, behutsame Prozesse anzustoßen, die über den Ballungsraum-Tellerrand hinausweisen müssen. Denn in vielen Teilen Deutschlands besteht das Problem in Leerstand und mangelnder öffentlicher Versorgung. Dort wäre man glücklich über jeden Investor.

Ganz ohne politische Eingriffe funktioniert es hierzulande allerdings ebenso wenig: In Zeiten des Neoliberalismus Anfang dieses Jahrhunderts wurde entschieden, es sei das Beste, wenn sich der Staat aus allem heraushält. Aber das geht nicht, wenn er sich vorher rund einhundert Jahre lang in alles eingemischt und gezielt ein Volk von Mietern gefördert hat. Die Politik hat bei uns mehr als anderswo die Verantwortung, sich um das Wohnen zu kümmern, es galt in Deutschland nämlich schon seit der Weimarer Republik als gesellschaftliche Aufgabe. Und da Menschen nicht in ein Vakuum hineingeboren werden, ist es zu Recht ihre Erwartungshaltung, dass man sie vor dem freien Spiel der Kräfte schützt.

Was also wären sinnvolle Maßnahmen, um die Auswüchse in den Ballungsräumen zu puffern?

»In fast der Hälfte der Sozialwohnungen leben Menschen, die sich eigentlich mehr Miete leisten könnten.«

Der Bau von Sozialwohnungen gehört nicht unbedingt dazu. Mit ihnen hat man nicht nur gute Erfahrungen gemacht. So ziehen Menschen zwar arm ein, bleiben es aber vielleicht nicht. Dann kommt es zu einer sogenannten Fehlbelegung, deren Quote derzeit bei 42 Prozent liegt. In fast der Hälfte dieser Wohnungen leben also Menschen, die sich eigentlich mehr Miete leisten könnten – auf Kosten der Allgemeinheit, die diese Wohnungen finanziert hat.

Industrienahe Experten plädieren daher gerne für ein höheres Wohngeld, um damit gezielt Menschen zu fördern: Subjektförderung (Mensch) statt Objektförderung (Immobilie). Das Frühjahrsgutachten der Immobilienwirtschaft warnt sogar ausdrücklich vor großen Sozialwohnungsprogrammen: „Für besonders gefährlich halten wir Mengenvorgaben der Politik, wie z. B. in Berlin. Die kommunalen Wohnungsbaugesellschaften sind hier darauf verpflichtet worden, ihren Wohnungsbestand durch Neubau und insbesondere Bestandskäufe um gut 100 000 Wohnungen zu erhöhen. Nicht nur, dass dies angesichts der überhöhten Preise hochspekulative Investitionen sind, die sich als Fehlinvestition mit öffentlichen Geldern herausstellen können. Noch ärgerlicher ist es, dass eine solche Politik die Preisspirale weiterdreht und es den Rückgang der Preise für Wohnungen und Wohnungsbauprojekte verzögert, wenn das Land Berlin zum ‚Buyer of last Resort‘ wird.“ Harald Simons vom Forschungsinstitut Empirica gibt überdies zu bedenken, dass 50 bis 60 Prozent aller städtischen Haushalte einen Anspruch auf geförderte Wohnungen hätten: „Und von denen gewinnen dann 5000 ein Los und alle anderen gehen leer aus. Das ist auch ungerecht.“ Auch er empfiehlt, den Markt sich selbst zu überlassen und Einkommensschwache direkt mit Geld zu unterstützen.

Einen anderen Vorschlag macht der Deutsche Städtetag. Er plädiert für eine Abkehr von der bisherigen Praxis, öffentliche Flächen meistbietend zu verkaufen. Denn wenn Höchstpreise für die Grundstücke bezahlt werden, bleibt Bauträgern gar nichts anderes übrig, als Luxuswohnungen zu errichten, damit sich die Investition lohnt. Und laut Bundesinstitut für Bau-, Stadt- und Raumforschung sind diese Grundstückskosten derzeit das größte Problem: Bei einem neuen Haus verschlingen sie inzwischen bis zu 70 Prozent des Budgets, in den großen Städten – aufgrund der dichteren Bebauung – immerhin noch durchschnittlich 30 bis 50 Prozent.

Die Preise für Bauland sind in den vergangenen Jahren so enorm gestiegen, dass die Spekulation damit größeren Gewinn verspricht, als tatsächlich zu bauen. Das Land wird gehortet und liegt brach. Dieses „Landbanking“ wird finanziell sogar gefördert, denn der Staat besteuert unbebautes Land niedriger als bebautes. Die Forderungen nach einer Umkehr dieser Logik werden lauter, ausnahmsweise sogar von Industrie und Politik gleichermaßen.[1]

Hans-Jochen Vogel, ehemals SPD-Oberbürgermeister von München, hat „Sorge, dass wir die Dinge weitertreiben lassen und damit die soziale Kluft in unserem Lande noch weiter verbreitern“. Er rechnet vor, dass die Grundstückspreise in München seit 1950 um stolze 69 000 Prozent gestiegen sind. Damals kostete Bauland (erschlossen und baulich nutzbar) 6 Mark, rund 3 Euro, pro Quadratmeter heute sind es 2100 Euro. Das liegt vor allem an der gestiegenen Attraktivität der Stadt, der Lage, den Jobs, der funktionierenden Infrastruktur, der Versorgung mit Schulen und Universitäten. Nichts von alledem haben Grundstücksbesitzer erarbeitet, es ist ihnen in den Schoß gefallen.[2]

Auch bundesweit sind von 1962 bis 2015 die Baulandpreise um 1600 Prozent gestiegen, der normale Preisindex hingegen nur um 302 Prozent – eine Entwicklung, die bereits Anfang der 1970er Jahre abzusehen war. Der Münchner Stadtrat unter Oberbürgermeister Vogel forderte bereits im März 1972 vom Bund die Einführung einer Bodengewinnsteuer und die Abschöpfung der Planungsgewinne. Wenn Wertminderungen durch Planungsentscheidungen entschädigt werden müssten, dürften auch Wertsteigerungen nicht beim Eigentümer verbleiben. Selbst der damalige CSU-Chef Franz Josef Strauß sagte: „Die Grundstückspreise steigen in einem Maße, dass es nicht zu verantworten ist, diese Gewinne unversteuert in die Taschen weniger fließen zu lassen.“ Passiert ist dennoch nichts.

Duisburg, Zinkhüttensiedlung, 2012-11 CN-02.jpg

„Im Gegensatz zu damals gibt es heute aber noch nicht einmal eine öffentliche Diskussion darüber“, kritisiert Vogel in einem Gastbeitrag für die „Süddeutsche Zeitung“. Das Problem müsse ganz rasch zurück auf die politische Tagesordnung: „Grund und Boden ist keine beliebige Ware, sondern eine Grundvoraussetzung menschlicher Existenz. Er ist unvermehrbar und unverzichtbar, […] jeder braucht ihn in jedem Augenblick seines Lebens wie das Wasser oder die Luft.“[3]

Schon das Bundesverfassungsgericht beschloss vor über 50 Jahren, am 12. Januar 1967: „Die Tatsache, dass der Grund und Boden unvermehrbar und unentbehrlich ist, verbietet es, seine Nutzung dem unübersehbaren Spiel der Kräfte und dem Belieben des Einzelnen vollständig zu überlassen: eine gerechte Rechts- und Gesellschaftsordnung zwingt vielmehr dazu, die Interessen der Allgemeinheit in weit stärkerem Maße zur Geltung zu bringen als bei anderen Vermögensgütern.“ Und dann kommt ein aus heutiger Sicht revolutionär anmutender Satz: „Es liegt hierin die Absage an eine Eigentumsordnung, in der das Individualinteresse den unbedingten Vorrang vor den Interessen der Gemeinschaft hat.“[4] Und ausgerechnet in der Bayerischen Verfassung heißt es in Artikel 161, Absatz 2: „Steigerungen des Bodenwertes, die ohne besonderen Arbeits- oder Kapitalaufwand des Eigentümers entstehen, sind für die Allgemeinheit nutzbar zu machen.“ Das aber wurde bislang versäumt.

»Die Infrastruktur im ländlichen Raum wurde vernachlässigt oder radikal weggespart.«

Quelle        :          Blätter        >>>>>           weiterlesen


Grafikquellen      :

Oben       —          Ecke Sofienstraße / Karl-Morian-Straße in Duisburg-Neumühl. (Im Hintergrund sind Häuser auf der Lüneburger Straße zu sehen. Die auf dem Foto zu sehende Grünfläche war zu diesem Zeitpunkt noch unbebaut. Das Foto ist vor 1977 entstanden, vermutlich 1976.)


Unten         —        Duisburg (North Rhine-Westphalia, Germany) – borough Hamborn, district Obermarxloh – residential complex at square Zinkhüttenplatz

Abgelegt unter Nordrhein-Westfalen, P.CDU / CSU, Sozialpolitik, Umwelt | Keine Kommentare »

Sie trainieren unser Ende!

Erstellt von DL-Redaktion am 19. Oktober 2019

Zur laufenden Atomkriegsübung in Büchel 

Quelle         :       Scharf  —  Links

Ein Beitrag von Kathrin Vogler

Seit Montag und bis heute trainieren US-Truppen gemeinsam mit der Bundeswehr in der jährlichen Militärübung „Steadfast Noon“ den Atomkrieg über Deutschland. Die Bundeswehr setzt dabei Tornados und Eurofighter ein. Trainiert werden die Einsatzbereitschaft und die Fähigkeit zur Zusammenarbeit zwischen den europäischen Militärs und der in Europa stationierten US-Air Force-Kräfte. Die beteiligten deutschen Standorte sind in diesem Jahr Büchel und Nörvenich. Auch in Nörvenich waren früher Atomwaffen stationiert. In Büchel lagern aktuell bis zu 20 Atombomben des Typs B61. Das Taktische Luftwaffengeschwader 33 der Bundeswehr soll im Atomkriegsfall die Bücheler Atombomben im Rahmen der Nuklearen Teilhabe ins Ziel bringen.

Kathrin Vogler, friedenspolitische Sprecherin der Fraktion Die Linke im Bundestag, dazu: „Es ist völlig wahnsinnig, was da gerade geschieht. Die USA übt mit der Bundeswehr sowie niederländischen, italienischen und polnischen Streitkräften, wie man einen Atomkrieg in Europa führt. Käme es dazu, würden Millionen Menschen sterben und kein Stein bliebe auf dem anderen. Es ist auch skandalös, dass die Bevölkerung nicht informiert wird. Wir wissen zum Beispiel nicht, ob die Bücheler Atombomben während der Übung über der Eifel herumgeflogen werden.

Kathrin Vogler 3.jpg

Ich habe Mitte September eine Kleine Anfrage zu Steadfast Noon  gestellt, die die Bundesregierung bis heute nicht beantwortet hat. Wie groß ist das Risiko, dass hier ein katastrophaler Unfall geschieht? Dass diese Atomkriegsübung eine politische und militärische Drohgebärde gegenüber Russland sein soll, macht alles noch schlimmer: Steadfast Noon markiert den Rückfall in den nuklear bestückten Kalten Krieg, der uns alle als Geiseln nimmt. Meine Antwort darauf: Wir müssen alle Atomwaffen abschaffen. Die Bundesregierung muss sofort den UN-Atomwaffenverbotsvertrag unterschreiben.“


Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen      :

Oben       —       Explosion von Upshot-Knothole Badger 1953 auf der Nevada Test Site


Unten      —        Kathrin Vogler. Foto: Niels Holger Schmidt


Abgelegt unter Bundestag, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Beleidigungsbrief der ARGE

Erstellt von DL-Redaktion am 8. Oktober 2019

 ca. 35 Erwerbslose feierten eine „Arme Würstchen Party“ im Jobcenter

Quelle      :        Scharf  —  Links

Von KEAs e.V. und Initiative erwerbslos nicht wehrlos

Verleihung der Auszeichnung „Goldener Haufen rassistischer/klassistischer Scheiße“ an die Leitung des Jobcenters Köln-Porz

Anlass der Party war ein anonymer Beleidigungs- und Drohbrief, der per Hauspost an die Beratungsstelle Die KEAs e.V. (Kölner Erwerbslose in Aktion) gesendet wurde und mit offiziellem Stempel aus dem Jobcenter versehen ist . In diesem Brief werden Beratende und Alg II-Bezieher*innen pauschal als “Arme Würstchen“, „ Penner“ , „lächerlicher Haufen Scheiße“ und „ Asis und Kanaken“ bezeichnet. Die heutige Party war die Antwort der Initiative erwerbslos nicht wehrlos darauf .

Der Einladung folgten über dreißig Menschen, die eine stimmungsvolle Party mit Musik, Tanz uvm. im Wartebereich des Jobcenters feierten. Schmunzelnde sog. „Kunden „ im Wartebereich, Verteilung von Ballons an Kinder, sichtlich überforderte Mitarbeiter*innen und Sicherheitsdienst und immer wieder die Forderung, die Leitung möge sich her bemühen um ihren hart bzw. „hartz“ verdienten Preis entgegen zu nehmen – den goldenen Haufen rassistischer/ klassistischer Scheiße.

Die Preisträgerin ließ eine halbe Stunde auf sich warten, dennoch wurde sie mit einem hartzlichen Applaus begrüßt.

Auf den Wunsch der Preisträgerin hin wurde die Preisverleihung vor das Gebäude verlegt. Dort wurden die Gäste bereits von ca. 20 Polizist*innen erwartet. Trotz kleinerer Störungen seitens der Beamt*innen, wurde der Leitung der anonyme Beleidigungs- und Drohbrief verlesen. Die Jobcenter Leitung nahm den Inhalt desinteressiert auf und beauftragte im Anschluss die Beamten, die Personalien der Demonstrierenden festzustellen.

Diese Reaktion bestätigte die Jury in der Entscheidung, dass sie eine wirklich würdige Preisträgerin ist. Nach einer kurzen Laudatio und der Überreichung des goldenen Haufens rassistischer/ klassistischer Scheiße wollten die Protestierenden das Gelände verlassen. Einigen gelang dies, andere wurden auf dem Parkplatz von der Polizei eingekesselt oder vom öffentlichem Raum zurück auf das Jobcenter Gelände gezerrt. Dieses Vorgehen diente der Feststellung von Personalien, auch wenn dies nicht bei allen gelang.

File:Protest - "Hartz 4 macht nackig".JPG

Hiernach wurde noch auf der Straße bei Snacks und Grillwurst heiter weiter gefeiert und gefleyert.

Es bleibt dabei – Widerstand lohnt sich! Der Ausgangspunkt der Proteste und des Schreibens vom Jobcenter, war eine besonders böswillig und rassistisch agierende Fallmanagerin – Fr. A.. Diese soll laut mehrerer Betroffener seit Anfang September immerhin nicht mehr in Erscheinung getreten sein (erste Aktion: ).

„Ihr werdet uns nicht los, wir sind viele und werden mehr.“ so die Ansage von Kim O. .

Hartz IV abschaffen!

Reichtum verteilen!

Armut abschaffen! 

Initiative erwerbslos nicht wehrlos & KEAs e. V.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen       :

Oben      —          Scharf-Links

privat     —   KEAs


Unten       —  

„Hartz 4 macht nackig“.
Source Own work
Author High Contrast
(Reusing this file)
I, the copyright holder of this work, hereby publish it under the following license:
w:en:Creative Commons

Abgelegt unter Deutschland, HARTZ IV, Köln, Nordrhein-Westfalen | Keine Kommentare »

Climate: Justice – Chaos ?

Erstellt von DL-Redaktion am 4. Oktober 2019

Wetterfeste FFF Bewegung

Quelle      :  Scharf  —  Links

Von Jimmy Bulanik

Das Thema von FFF ist das Klima. Deshalb gilt es für die Bewegung unabhängig an Lebensjahren, Raum der Sozialisierung, gegenwärtiger Aufenthaltsort (wie von Besucherinnen und Besucher einer Messe oder Touristinnen und Touristen), Bildungsgrad, soziale Stellung in der Gesellschaft und Wohnorten mit ihrer Wetterfestigkeit wie der aktuell bevorstehenden Herbstferien auch zur Weihnachtsferien, Weihnachtszeit 2019, im Übergang zum Jahr 2020 das bestehende Ausmaß an Entschlossenheit öffentlich und medial unter Beweis zu stellen. Das stärkt ihre bereits bestehenden Glaubwürdigkeit im Inland als auch im Ausland. Sofern die Menschen in der Bundesrepublik Deutschland weiter unbeirrt Freitags für das Klima demonstrieren, desto höher die Chance das die Menschen im EU Ausland es vor Ort gleich handhaben werden.

Insbesondere die Menschen in Großstädten mit ihrem vorhandenen ÖPNV stehen in der Verantwortung. Ebenfalls wichtig dabei ist, dass von allen Landeshauptstädten, der Bundeshauptstadt Berlin, den EU Großstädten und EU Hauptstädten ein sichtbares und hörbares Signal ausgesendet wird, das weltweit nicht zu ignorieren ist. Jene Menschen welche im Umland einer Landeshauptstadt, Großstadt, EU Hauptstadt wohnen haben die Option eine Gemeinschaft zu bilden um gemeinsam in einer Großstadt vor Ort an den FFF Veranstaltungen teilzunehmen. Um Hürden abzubauen, gerne sich an die eigene Familie, Freundeskreis, ein (Sport) Verein, die Gewerkschaft oder eine Partei zu wenden um nach Unterstützung zu fragen. Einen Mangel an Fahrräder wird es mit Sicherheit nicht geben. Eine weitere Möglichkeit besteht darin Geld zusammenzulegen damit mehrere Personen auf ein ÖPNV Ticket fahren dürfen. Was allen offen steht ist die Menschen im persönlichen Zirkel, Zirkeln in jeglicher Form der analogen, digitalen Form der Kommunikation zu motivieren auch an den FFF Demonstrationen teilzunehmen. Die Bundesrepublik Deutschland hat viele Rentnerinnen und Rentner, Pensionärinnen und Pensionäre dessen Bedeutung an politischen Wahlen stetig wächst.

In der Thematik der Verschmelzung von Ökologie, Ökonomie und Soziales insbesondere in Verbindung mit der Digitalisierung befindet sich erheblich viel an positiver und progressiver Macht. Mitunter die Behandlung einer globalen Frage des bestehenden und zukünftigen System. Dies darf gerade in global volatilen Zeiten zu keinem Zeitpunkt unterschätzt werden und immer richtig eingeordnet. Menschen die an Kapitalmärkten, Banken, Unternehmungen dahinter arbeiten wissen dies nur zu präzise. Deshalb ist es ratsam das teilnehmende Personen an den FFF Demonstrationen mittels des dem Smartphone, Laptop, dem Internet ungefiltert Öffentlichkeit schaffen. Für die Qualität sind alle selbst verantwortlich und können sich dahingehend gemeinsam und gegenseitig fachlich optimieren.

Die Motive zur Teilnahme an den FFF Demonstrationen gibt es genug. Die neueste Augenwischerei der gegenwärtigen Bundesregierung in Sachen Klimapolitik ist aktuell lediglich eines davon.

Die innerdeutsche Landschaft der politischen Parteien wird die Entwicklung der FFF Demonstrationen bemerken. Es obliegt allen Menschen ob sie und ihre legitimen Inhalte und Ziele von der bestehenden Bundesregierung weiter ernst genommen werden oder ob die Parteien der neoliberalen FDP und der menschenverachtenden AfD, dessen Funktionär Höcke laut Gericht als Faschist betitelt werden darf bei ihren bevorstehenden Veranstaltungen zum Karneval im Jahr 2020 im Fernsehen in der Live Übertragung wie beispielsweise der politische Aschermittwoch hämische Witze auf Kosten von über 1,4 Millionen Menschen in der Bundesrepublik Deutschland, weitere Millionen Menschen in der Europäischen Union und weltweit der FFF, Klima Demonstrantinnen und Demonstranten artikulieren und obendrein dafür noch Applaus bekommen werden und beim geneigten Publikum lautes Gelächter auslösen werden. Die deutsche und internationale Industrie wie zum Beispiel der Automobilindustrie, Pharma Konzerne  würde es ihren Erfüllungsgehilfinnen und Erfüllungsgehilfen in den politischen Parteien mittels Aufträge, Posten und monetäre Zuwendungen danken.

Daher ist es allen möglich sich wetterfeste Kleidung anzuziehen, sich ökologisch und gerecht gehandelten vegetarisch oder veganen Proviant vorzubereiten und Fairtrade Kaffee, Kräutertee in einer Thermokanne auf die FFF Demonstrationen mitzunehmen. Von Menschen aus Südkorea habe ich vor vielen Jahren in meinem Leben gelernt, das diese ziemlich gerne eine warme Suppe in einer Thermokanne transportieren um dies außer Haus zu genießen. Vielleicht ist dies in kalten Zeiten auch etwas für die Menschen im Herzen oder Westen von Europa, bzw. der Europäischen Union.


Bodo Wartke – Hambacher Wald

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle      :

Wellington, Neuseeland, 15. März 2019

Abgelegt unter APO, International, Köln, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

Ein Stadtgespräch aus Essen

Erstellt von DL-Redaktion am 1. Oktober 2019

RWE baut das Portfolio um – Heuchlerische Pläne


Von Ingo Arzt

Die RWE feiert sich dafür, dass man jetzt auf Ökoenergien macht. Dabei ist der Konzern viel zu spät dran und zerstört weiterhin Dörfer für die Kohle.

Sie nennen sich „Menschenrecht vor Bergrecht“ und hatten zumindest am Montag keine Chance gegen RWE: Der Essener Energiekonzern generierte eine Menge positiver Schlagzeilen an der Börse und in der Wirtschaftspresse. Am Morgen präsentierte Vorstandschef Rolf Martin Schmitz die Neuaufstellung des Konzerns und bastelte daraus eine Jubelmeldung.

Fast zeitgleich schickten Anwohner*innen des Tagesbaus Garzweiler II einen Brief an Schmitz. Sie forderten eine „Klarstellung, dass in Zeiten des beschlossenen Kohleausstiegs und der Klimakrise keine Dörfer mehr für den Kohleabbau zerstört werden dürfen“. Der Konzern will die Orte Keyenberg, Kuckum, Berverath, Ober- und Unterwestrich und weitere trotz Kohleausstiegs zerstören und abbaggern. Das, obwohl Berechnungen etwa des Deutschen Instituts für Wirtschaftsforschung ergeben haben, dass für die Restlaufzeit der Kraftwerke bis 2038 mehr als genug Kohle in den vorhandenen Tagebauen abgebaut werden kann.

Schmitz‘ Konzernumbau ist deshalb heuchlerisch. Bis 2040 will er RWE „klimaneutral“ und zu einem weltweiten Player für erneuerbare Energien machen. Bereits 2018 hat RWE dabei mit Eon, dem zweiten großen deutschen Energiekonzern, das Terrain in Sachen Energiewende abgesteckt: Die beiden Energiealphatiere haben die Eon-Tochter Innogy unter sich aufgeteilt. Eon bekommt die Stromnetze, die wegen der Energiewende digitaler und intelligenter werden müssen, und außerdem das Geschäft mit den Endkunden, also uns. RWE übernimmt dafür komplett die Stromerzeugung aus erneuerbaren Energien von Eon und Innogy.

20170613 xl P1120777-Ostsee-Windpark-zwischen-Deutschland-und-Schweden.jpg

Kurzum, beide Konzerne kommen sich nicht in die Quere, in guter, alter Tradition: Seit der Weimarer Republik haben sich in Deutschland RWE und die Firmen, aus denen Eon im Jahr 2000 zusammenfusioniert wurden, den deutschen Strommarkt staatlich abgesegnet fein aufgeteilt. In den Nullerjahren sprachen sich die Konzerne regelmäßig ab, das Bundeskartellamt sprach damals von einem „Duopol“.

Quelle         :      TAZ        >>>>>        weiterlesen


Grafikquellen        :

Oben        —        Beschreibung Bildbeschreibung: Ortseingang Kuckum. Quelle: eigenes Foto… Fotograf/Zeichner: bodoklecksel 20:31, 25. Jun 2006 (CEST) Datum: Juni 2006… Sonstiges: …

Abgelegt unter Nordrhein-Westfalen, Überregional, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Typisch Deutsche Reflexe

Erstellt von DL-Redaktion am 30. September 2019

BDS und der Nelly-Sachs-Preis

Kamila shamsie 3280373.jpg

Kommentar von Stefan Reinecke

Die BDS-Aktivistin Shamsie bekommt den Nelly-Sachs-Preis nicht. Das ist verständlich, doch israelkritische Positionen werden zu oft diskreditiert.

In Dortmund hat eine Jury der britisch-pakistanischen Autorin Kamal Shamsie erst den Nelly-Sachs-Preis verliehen, dann wieder entzogen, weil Shamsie die Israel-Boykott-Bewegung BDS unterstützt. Das wiederum hat harschen internationalen Protest provoziert. Mehr als 200 vor allem angloamerikanische AutorInnen, darunter mehrere LiteraturnobelpreisträgerInnen, bekundeten ihre Bestürzung über die Aberkennung des Preises. Eine peinliche Affäre für die Jury.

Auf den ersten Blick fügt sich der Fall Shamsie in eine Reihe von kritikwürdigen Anti-BDS-­Aktionen. Der Bundestag hat BDS in toto für antisemitisch erklärt, was Augenmaß und Differenzierung vermissen ließ. BDS besteht in Deutschland, anders als in Irland oder Schweden, nur aus ein paar Dutzend AktivistInnen und spielt politisch keine Rolle. Zudem ist BDS eine facettenreiche Bewegung, die von christlich motivierten AktivistInnen, die sich für die Rechte der Palästinenser einsetzten, über antikolonial inspirierten Widerstand bis zu fundamentalistischen Israelgegnern reicht.

BDS ist komplexer als es scheint

In Deutschland ist man aus historischen Gründen mehr als vorsichtig mit Boykottforderungen in Richtung Israel. Das ist richtig. Trotzdem ist das Bild komplexer, als es der auf die NS-Zeit fixierte deutsche Blick erfasst. So war BDS in Palästina der Versuch, nach dem Debakel der gewaltsamen Inti­fada einen zivilen, friedlichen Weg einzuschlagen.

In der deutschen BDS-Debatte kommt dies ebenso wenig vor wie die Tatsache, dass in Israel Liberale vor einer Hexenjagd gegen BDS warnen. Sie hegen wenig Sympathien für die Boykottbewegung, sind aber alarmiert, weil sie in der professionell inszenierten Anti-BDS Kampagne des Ministeriums für strategische Angelegenheiten eine rechtsautoritäre Formatierung der Öffentlichkeit und einen Angriff auf die liberale Demokratie in Israel erkennen. Die Netanjahu-Regierung bereitet völkerrechtswidrig die Annektierung eines Teils des Westjordanlandes vor – die Anti-BDS-Aktionen der Regierung sollen Kritik an der Besatzung als illegitim diffamieren.

In Deutschland kreist die Debatte indes über das Kampfwort Antisemitismus. Das ist naheliegend, aber unterkomplex. Man dürfe, heißt es großzügig, die israelische Regierung kritisieren. Doch wer das entschlossen tut, wird schnell als anti­semitisch disqualifiziert. Die deutsche BDS-Debatte ist undifferenziert und so selbstfixiert, dass noch nicht mal auffällt, wie seltsam der BDS-Beschluss des Bundestages in anderen westlichen Demokratien wirkt.

Deutsche Ängstlichkeiten

Der Fall Shamsie scheint in dieses Muster zu passen: hier deutsche Ängstlichkeit, dort Protest von literarischen Koryphäen wie Richard Ford, A. L. Kennedy, Deborah Eisenberg, Rachel Kushner, Michael Ondaatje und Teju Cole, die allesamt nicht zu den üblichen Unterzeichnern in Sachen BDS zählen. Hat die Jury also doppelt versagt – erst weil sie wenig über Shamsie wusste, dann weil die deutschen Reflexe einschnappten?


Der Fall ist schwieriger. Die deutsch-jüdische Schriftstellerin Nelly Sachs, von den Nazis ins schwedische Exil getrieben, hat so intensiv wie Paul Celan den Mord an den Juden literarisch bearbeitet und der Qual des Überlebens eine Stimme gegeben. „Wir Geretteten/ Immer noch essen an uns die Würmer der Angst“ heißt es in dem Gedicht „ Chor der Geretteten“.

Israel erschien Sachs als das Land des „Urväterstaubs“. Ob sie, wie Peter Hamm mutmaßte, fürchtete, dass in Israel aus „den Verfolgten bald Verfolger werden könnten“, wissen wir nicht. Sachs war mit Politik weniger vertraut als mit existenzieller Einsamkeit. Mag sein, dass sie die Idee Israel mehr bewunderte als deren Verwirklichung.

Quelle         :          TAZ           >>>>>            weiterlesen


Grafikquellen           :

Oben       —     reading at „The Global Soul: Imagining the Cosmopolitan“

Abgelegt unter Kultur, Mensch, Nordrhein-Westfalen, Positionen | Keine Kommentare »

Fridays For Future Köln

Erstellt von DL-Redaktion am 22. September 2019

Ein globales Signal

Datei:Bundesarchiv B 422 Bild-0086, Köln, Rheinufer, Hochwasser.jpg

Quelle           :      Scharf   —  Links 

Von Jimmy Bulanik

Köln – weit über 70.000 Menschen aus allen Segmenten der Zivilgesellschaft aus natürlichen Personen, juristische Personen kamen zwecks Fridays For Future Klimastreik, Demonstration um 11 Uhr zum DGB Haus am Hans – Böckler – Platz bis zum Hohenzollernring. Mit mittels Absperrungen, Beeinträchtigungen für den Verkehr auf den Straßen von Köln. Das Mobilfunknetz in Köln war zeitweilig überlastet. Köln stellt in NRW die größte Anzahl der Teilnehmerinnen und Teilnehmer und somit einer der größten Demonstrationen in der Bundesrepublik Deutschland. In NRW haben sich über 270.000 Menschen an den Veranstaltungen beteiligt. Bundesweit handelt es um über 1,4 Millionen Demonstrantinnen und Demonstranten. Begleitet wird dies von Gewerkschaftlerinnen und Gewerkschaftler wie Verdi, DGB als auch dem Künstlerinnen und Künstler, wie beispielsweise der Band Cat Ballou welche für ihr Lied „Et jitt kei Wood“ bundesweit bekannt ist. Sehr viele anwesende Demonstrantinnen und Demonstranten werden im Bundesland NRW künftig Erstwählerinnen und Erstwähler werden. In jedem Fall leidenschaftlich politisiert und im harmonischem Einklang mit der Generation ihrer Eltern und Großeltern. Die Ziele bestehen in der so zeitnah als möglich Einleitung einer Energiewende insgesamt Sowohl persönlich (mit der Auswahl des Stromanbieter wie Greenpeace Energy eG, der persönliche Pizza Konsum) als auch gemeinschaftlich als Binnenmarkt und international.

Mittlerweile konstatieren Ökologische Strom Anbieter wie Greenpeace Energy eG das nicht allein natürliche Personen zu ihren Kundschaft zählen, als auch juristische Personen wie Büros von den Bündnis 90 / Die Grünen. Selbst eine Gesellschaft mit Bussen und Züge in grüner Farbe gehört zu solch einem Geschäftskunden.

Es werden künftig mehr Geschäftskunden werden. Das Bewusstsein bei den Menschen in der gesamten Gesellschaft besteht seit langem, wächst jedoch weiter. Dies bemerken auch Lebensmittelgeschäfte bei ihren Verkaufszahlen von fleischlosen Lebensmittel.

Die Sonne schien in Köln bei zirka 13 Grad Celsius. Die Stimmung war fröhlich und ausgelassen. Die Menschen, welche am Köln Bahnhof West der Route der Demonstration leben, zeigten aus geöffneten Fenstern mit ihrem Zuwinken und Daumen in Richtung blauen Himmel zeigend ihre Zustimmung.

Tatsache ist das die ökologischen Themen von allen demokratisch wählbaren Parteien aufgegriffen werden. Über Modalitäten des Sparens von Energie wird vielfältig gerungen.

In meinen Interviews mit den Demonstrantinnen und Demonstranten vor Ort in Köln wurde die massive Förderung eines egalitär bezahlbarer DB Bahnkarte 100 der zweiten Klasse im Jahres Abo verlangt. Somit wird der Verkehr auf den Straßen, Autobahnen gravierend entlastet. Ungeachtet der Form des Energieträgers ob fossil oder basierend auf regenerativ gewonnener Strom für Batterie oder noch besser Wasserstoff. Ziemlich verteidigend waren die (jungen) Leute zum Thema Windräder. Sie erkannten für sich das mit den modernen und effizienten Windrädern welche heute größer sind, als der Kölner Dom die Energiewende steht.

Der Internationalismus kommt bei den Fridays For Future Demonstrantinnen und Demonstranten nicht zu kurz. Sie artikulieren mitunter das es für alle Menschen nur eine Welt besteht in der wir gemeinsam leben, sich darin gegenseitig brauchen. Die Informationen über die Anzahl derer welche heute global für das Klima von ihrem verbrieften Grundrecht auf Versammlung den öffentlichen Raum friedlich und demokratisch in Anspruch nehmen motiviert die anwesenden in Köln.

Alles in allem steht eine stärkere Verbindung von Ökologie, produzierender Ökonomie mit ebensolchen Erwerbsarbeitsplätzen in der Bundesrepublik Deutschland bevor. Von der Bundesrepublik Deutschland kann ein Mondscheineffekt für andere Volkswirtschaften darstellen.

Dies zu bewerkstelligen obliegt uns allen.

 Jimmy Bulanik


 Cat Ballou – Et jitt kei Wood

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle        :        Namensnennung: Bundesarchiv, B 422 Bild-0086 / Sers, Günter / CC-BY-SA 3.0

Abgelegt unter Köln, Nordrhein-Westfalen, Überregional, Umwelt | 1 Kommentar »

Der Kauf des Staatsfunk ?

Erstellt von DL-Redaktion am 21. September 2019

Der Klima-Podcast, der verschwand

Ende Gelände part of the Red Finger at the brim 22-06-2019 12.jpg

Von Alexander Nabert

WDR und SWR starteten im Juni einen wöchentlichen Klima-Podcast. Doch schon nach der ersten Ausgabe war Schluss. Der SWR bedauert das, der WDR spricht von einem Missverständnis. Wurde eine Chance auf kritischen Journalismus vertan?

Der Podcast „Klimazone“ startete als ambitioniertes Projekt. „Willkommen in der Klimazone, dem wöchentlichen Podcast zur Klimakrise von SWR und WDR“, begrüßen Werner Eckert vom SWR und sein WDR-Kollege Jürgen Döschner die Zuhörer der ersten Folge. Das war im Juni. Eckert und Döschner sind ansonsten vor allem im Radio zu hören und beschäftigen sich schon lange mit dem Klimawandel. Eckert berichtet seit Jahrzehnten von Umwelt- und Klimakonferenzen, Döschner ist seit 2011 offizieller „Energieexperte“ des ARD-Hörfunks, schon zuvor berichtete er im WDR über Energie. Wenn zwei Urgesteine des Klimajournalismus sich in Zeiten von Fridays for Future für einen Podcast zusammentun, ist das bemerkenswert. Vor allem wenn die Kooperation scheitert. Still und leise.

Man hatte sich vorgenommen, den Themen rund ums Klima mehr Zeit einzuräumen, heißt es in der ersten Folge. Dösch­ner referiert zu Beginn einen alten Spruch aus dem Radio: „Ob du faul bist oder fleißig: Am Ende wird’s 1:30.“ Damit spielt er darauf an, dass die meisten nachrichtlichen Beiträge im Radio sehr kurz sind. Der Podcast aber biete, so Eckert, die Chance, „tiefer eingehen zu können auf die Probleme, die momentan ganz offensichtlich ganz Deutschland bewegen“. Klima sei nach Jahren mal wieder oben auf der Tagesordnung. „Wir haben uns gedacht: Es muss mehr geben, als die Stanzen der Politiker und die Forderungen der Aktivisten“, erklärt Eckert, „da muss es irgendjemanden geben, der sich mit beidem beschäftigt und versucht, das irgendwie zusammenzubringen.“

Man könnte meinen, dass ein öffentlich-rechtlicher Klima­pod­cast in diese Zeit passt. Der Klimawandel dominiert seit Monaten die Themensetzung von Politik und Medien. Gleichzeitig erlebt das Format Podcast einen nie dagewesenen Boom. Auch die Öffentlich-Rechtlichen sind mit vielen Podcast-Projekten dabei. Knapp eine Million Mal wurde die App der ARD-Audiothek mittlerweile auf mobilen Endgeräten installiert. Martin Wagner, der Vorsitzende der ARD-Hörfunkkommission, sprach in dieser Woche von einer „Erfolgsgeschichte“. Seit dem Start der ARD-Audiothek im November 2017 wurden über 41 Millionen Mal Audios abgerufen.

Auch der wöchentlich angekündigte Podcast „Klimazone“ erschien im Juni in der ARD-Audiothek und auf der Webseite des SWR. Doch es blieb entgegen der Ankündigung bei einer Folge. Ohne eine öffentliche Mitteilung wurde der Podcast eingestellt.

Mehr noch: Während Jürgen Döschner vom WDR auf seinem Twitter-Kanal im Vorfeld ein Logo des Podcasts veröffentlichte, auf dem die Logos beider Sender vorhanden waren (siehe Abbildung in der Mitte dieser Seite), fehlte bei der Veröffentlichung des Podcasts plötzlich das Logo im WDR. Auf den Kanälen und der Webseite des WDR ist der Podcast nicht beworben worden. Geschweige denn veröffentlicht. Will der WDR plötzlich nichts mehr damit zu tun haben?

Ende Gelände Green Finger in Viersen 21-06-2019 16.jpg

Auf Anfrage teilt der WDR mit, dass der SWR die „federführende Anstalt“ und eine „dauerhafte Beteiligung des WDR über die Entwicklung hinaus“ nicht vorgesehen sei. „Diese Entscheidung liegt ausdrücklich nicht am Inhalt oder der handwerklichen Qualität des Podcasts.“ Aber woran dann? Dazu sagt der WDR in seiner Antwort nichts.

Immer wieder hat der Sender Ärger wegen Döschner, manch einer findet ihn zu kritisch. Seine Berichterstattung war bereits Thema im Innenausschuss des Landestags Nordrhein-Westfalen und im Rundfunkrat des WDR. Und in einer Facebookgruppe „RWE Mitarbeiter contra WDR“ polemisierte man heftig gegen Döschner, mehrfach twitterten leitende Angestellte von RWE gegen den Klimaexperten.

SWR widerspricht WDR

Quelle      :           TAZ          >>>>>       weiterlesen


Grafikquellen        :

Oben       —      Teil des Roten Fingers von Ende Gelände oberhalb der Abbruchkante des Tagebaus Garzweiler am 22. Juni 2019.


Untebn        —   Grüner Finger von Ende Gelände beim Losgehen in Viersen am 21. Juni 2019.

Abgelegt unter Baden-Württemberg, Nordrhein-Westfalen, Rheinland-Pfalz, Umwelt | Keine Kommentare »

Fleisch – woher der Scheiß?

Erstellt von DL-Redaktion am 18. September 2019

Das System Tönnies muss gestoppt werden

File:Technologiezentrum zur Mühlen Gruppe.JPG

Abmahnungen der Schertz-Kanzlei soll Tönnies-Kritik unterbinden

Quelle   : untergrund-blättle ch.

Von Werner Rügemer

Statt Tarifvertrag – nur Mindestlohn. Statt Leiharbeit – Werkverträge. Dieses System des europäischen Marktführers bei der Schweineschlachtung hat sich nicht nur in die Arbeitsverhältnisse eingefressen, sondern auch in die Natur. Mit Abmahnungen der Anwaltskanzlei Schertz will dieser nun seine Kritiker einschüchtern.

Wir fordern das Ende des Systems Tönnies. Denn der Konzern im Eigentum des Rassisten und Menschenverächters Clemens Tönnies und seines Familienclans ist ein System.

Das System Tönnies verletzt die Menschenrechte und die Demokratie. Dieses System des europäischen Marktführers bei der Schweineschlachtung hat sich nicht nur in die Arbeitsverhältnisse eingefressen, sondern auch in die Natur, in die Lebensgrundlage Wasser, in die Tierwelt und nicht zuletzt in die politischen Verhältnisse in Deutschland und in der Europäischen Union, auch in die Kommunen, die mit Tönnies-Standorten gesegnet beziehungsweise belastet sind.

Die zentrale Tönnies-Holding mit Sitz in Dänemark hat jetzt mit Hilfe der berüchtigten Medienkanzlei Schertz Bergmann beim Landgericht Berlin gegen «aktion gegen arbeitsunrecht» eine Einstweilige Verfügung erwirkt. Die Organisation soll unter anderem nicht mehr behaupten dürfen, dass Tönnies Lohnraub begeht. Die «aktion gegen arbeitsunrecht» ist gegen diese Verfügung in Widerspruch gegangen und wird die Gelegenheit nutzen, die Tönnies-Praktiken weiter bekannt zu machen.

Tönnies Machenschaften, Methoden und Marken sind weitgehend unbekannt

Denn obwohl Tönnies der größte Schweineschlacht-Konzern ist, sind seine Praktiken der Bevölkerung, den Einwohnern der Tönnies-Standorte und auch den meisten Käufern der Tönnies-Produkte so gut wie unbekannt. Dafür sorgen auch unsere Leitmedien, die privaten wie die öffentlich-rechtlichen, die der sogenannten Meinungsfreiheit verpflichtet sind. Sie kritisieren ein bisschen, wenn der Chef Clemens Tönnies sich als Rassist äußert und Menschen in Afrika verächtlich macht, aber diese ach so freien Medien schweigen – bis auf löbliche Ausnahmen im öffentlich-rechtlichen Rundfunk und vereinzelten investigativen Print-Reportagen – auf der nationalen Ebene zu den Arbeitsverhältnissen in den Tönnies-Betrieben und was diese sonst noch an Schweinereien in der Gesellschaft anrichten.

Sozialschädliche Arbeitsverhältnisse

Ja – der Konzern begeht Lohnraub, systematischen Lohnraub, und zwar durch die Kombination mehrerer Praktiken. Die Mehrheit der Schlachter ist nicht bei Tönnies angestellt, sondern bei Werkvertragsfirmen. Von diesen Vermittlern gibt es bei Tönnies mindestens ein Dutzend. Sie haben öffentlich so unbekannte Namen wie PTW, DSI, Best Promo, MGM, FSD, Agriserv Europa Meat ZNL, Lazar, Flash Works, Besselmann Services, Ni.Ke, FBS, Ninbog und Christian Fleisch – schon mal gehört? Clemens Tönnies und sein Geschäftsführer Josef Tillmann behaupten: Festanstellungen seien nicht möglich, denn die Bulgaren, Rumänen, Ungarn, Polen, Griechen undsoweiter wollen nur befristet arbeiten und ihr Leben in ihren Heimatländern nicht aufgeben.2 Aber: Auch für eine zeitlich befristete Anstellung von einem oder zwei Jahren kann bekanntlich ein regulärer Arbeitsvertrag abgeschlossen werden, viele solche Arbeitsverträge sind heute befristet.

Statt Tarifvertrag: nur Mindestlohn. Statt Leiharbeit: Werkverträge

Oder Tönnies könnte sich Leiharbeiter holen. Aber nein, selbst Leiharbeiter sind noch zu teuer und haben zu viele Rechte, denn immerhin nach 9 Monaten müssen Leiharbeiter mit den regulär Beschäftigten gleichgestellt werden. Nein, Tönnies lässt sich die Mehrheit der Beschäftigten als Werkvertragsarbeiter liefern. Sie bilden die Mehrheit in Rheda-Wiedenbrück, der größten Tönnies-Schlachterei, und im ostdeutschen Weißenfels, der zweitgrößten Schweineschlachterei, sind es etwa 70 Prozent.

Werkvertragler haben einen noch schlechteren Status als Leiharbeiter. Sie können auch keinen Betriebsrat wählen und können sich auch nicht selbst zur Wahl stellen. Das Kündigungsschutzgesetz gilt nicht. Der Mindestlohn gilt zwar im Prinzip, aber nicht für diejenigen, die als Selbständige beziehungsweise als Scheinselbständige arbeiten. Tarifliches Recht auf Kranken-, Urlaubs- und Weihnachtsgeld gilt nicht – Tönnies weigert sich, mit der zuständigen Gewerkschaft NGG überhaupt zu verhandeln.

Werkverträge als moderne Sklaverei

Hinzukommen weitere Praktiken. Selbst der Vorsitzende der CDU-Mittelstandsvereinigung in Paderborn, Friedhelm Koch, sieht Tönnies als „Sklavenhalter“. In zwei Branchen bestehe diese moderne Sklaverei. Damit wird die Armut in den von der EU verarmten Peripherie-Staaten ausgenutzt, nämlich in der Prostitution und in der Fleischzerlegung, sagt Koch. Diese Art moderner Sklaverei zeige sich darin, dass Tönnies den Werkvertraglern „schon einmal 200 Euro für ein Bett in einer überfüllten Wohnung abzieht“.

Die NGG Ostwestfalen kennt Wucherpreise bis 270 Euro im Vierbettzimmer.3 Der MDR berichtete über 250 Euro pro Bett in einem 7-Bett-Zimmer.4 Dass es sich um ein Element von Lohnraub handelt, wird auch daraus deutlich, dass osteuropäische Vorarbeiter, die zudem viel besser bezahlt werden, von Tönnies eine viel bessere Wohnmöglichkeit bekommen, und die ist außerdem kostenlos.5

Ein weiteres Element, auf dem der Lohnraub beruht, sind die Gebühren, die die Fleichzerleger schon in der Heimat ihren Werkvertragsfirmen bezahlen müssen. Sie müssen dieses teure Eintrittsticket kaufen, um überhaupt zu Tönnies zugelassen zu werden.6 Wenn sie ganz normale Arbeitnehmer wären, bräuchten sie dieses Eintrittsticket gar nicht. Also auch hier: ein Element des Lohnraubs.

Tönnies nutzt Armut und Abhängigkeit aus und führt ein Angstregime. Kaum ein Werkvertragler spricht öffentlich über das Arbeitsunrecht. Nur ganz ganz wenige haben sich einmal für ihre Rechte vor Gericht getraut. Und dann blockiert das Tönnies-System feige ein Urteil, scheut den Rechtsstaat.

Zum Beispiel haben zwei Werkvertragler auf Nachzahlung der täglichen Rüst- und Wegezeiten geklagt. Sie mussten als Angestellte der Werkvertragsfirma Besselmann Services eine halbe Stunde vor dem eigentlichen Arbeitsbeginn im Tönnies-Betrieb sein und sich mit der Schutzkleidung ausrüsten und dann zum Arbeitsplatz gehen. Diese Zeit wurde nicht bezahlt, obwohl das zur Arbeitszeit zählt. Das Gericht ordnete an, dass ein Gutachter in den Betrieb geht. Doch Tönnies verweigerte ihm den Zutritt. Zum Gerichtsverfahren erschien das Werkvertragsunternehmen nicht. Das Gericht erließ deshalb ein Versäumnisurteil, Besselmann zahlte sofort in aller Stille für die täglichen 26 Minuten nach: Damit wurde aber ein Grundsatzurteil verhindert. So berichtet der DGB Rechtsschutz.7

Die DGB-Beratungsstelle „Faire Mobilität“ berät Wanderarbeiter aus Osteuropa, auch viele, die an diversen Standorten von Tönnies arbeiten. Der mit den Werkvertragsfirmen vereinbarte Mindestlohn wird vielfach unterlaufen: Überstunden werden nicht dokumentiert und nicht bezahlt, ebenso Umkleide- und Wegezeiten. Die meisten Arbeiter nehmen ihre Rechte nicht wahr, aus Angst, den ohnehin befristeten Job zu verlieren, so berichtet der Mitarbeiter der Beratungsstelle Szabolcs Sepsi.

So führt Tönnies ein Angstregime. Was ist hier mit der ansonsten so gelobten Meinungsfreiheit? Meinungsfreiheit für Rassisten wie Tönnies – aber keine Meinungsfreiheit für hart arbeitende Menschen? Tönnies verletzt Menschenrechte, tausendfach, dauerhaft.8

Wie wurde Deutschland zum Niedriglohnparadies?

Die Bundesregierungen mit den Regierungsparteien CDU, CSU, SPD und Grünen sind verantwortlich für die Niedriglohnwüste Deutschland. Und dafür, dass Unternehmer, die Gesetze verletzen, nicht bestraft werden. Deshalb haben Schlachtereien aus anderen EU-Staaten wie Dänemark und den Niederlanden Schlachtereien nach Deutschland verlegt. So wurde der führende Niedriglohnstaat Deutschland zum führenden Schlachtzentrum Europas und Tönnies dessen Marktführer.

Auch die Europäische Union hat zu diesem Arbeitsunrecht beigetragen. Auch der Marktführer Tönnies hat möglichst lange den Werkvertragsarbeitern die üblichen Sozialabgaben vorenthalten. Das war möglich, solange es noch Sonderregelungen für osteuropäischen EU-Beitrittsstaaten gab. Da waren die Werkvertragler bei ihren Vermittlern in Bulgarien und Rumänien angestellt und da galt nicht einmal das niedrige Arbeitsrecht in Deutschland.

Die Lüge vom Fachkräftemangel

Chef Tönnies behauptete: „Wir sind auf Werkvertragsunternehmen angewiesen. Sonst würden wir nicht die Mitarbeiter in Menge und Qualifikation finden, die wir brauchen.“9 Natürlich ist das eine Lüge. Natürlich würden die Arbeiter aus Rumänien, Bulgarien, Polen, Ungarn und Griechenland auch kommen, wenn sie regulär angestellt würden. Da würden sie sogar noch viel lieber kommen, sie würden mehr verdienen und sie würden mehr Rechte haben. So strickt Tönnies auch mit an der Lüge des Fachkräftemangels.

Klärschlamm-Wahnsinn: Nitrat ins Trinkwasser, Methangas in die Luft

Die Tönnies-Schlachterei in Rheda-Wiedenbrück leitet von den täglich etwa 30.000 geschlachteten Schweinen täglich tonnenweise Schlachtabfälle in das Abwasser-Klärwerk der Stadt Rheda-Wiedenbrück ein. Daraus entsteht Klärschlamm. Tönnies verursacht davon täglich 480 Kubikmeter. Das sind 70 Prozent des Klärschlamms der Stadt, während alle weiteren Betriebe in der Stadt und alle Einwohner zusammen nur 30 Prozent des Klärschlamms verursachen.

Bevor der schadstoffhaltige Klärschlamm täglich durch zwei Sattelzüge mit jeweils 22 Tonnen abtransportiert wird, muss er im Faulturm zwischengelagert werden. Der hat ein Fassungsvermögen von 11.500 Kubikmetern. Dabei entsteht das ozonschädliche Methangas. Hallo Umweltfreundinnen und Umweltfreunde: Methangas aus den Klärschlämmen! Schon gehört?

Der Klärschlamm wurde und wird nach „Ostdeutschland“ entsorgt, Ihr wisst schon: Dorthin wo man aus dem sauberen Westen und der sauberen Stadt Rheda-Wiedenbrück und aus der sauberen Tönnies-Schlachterei allen Schmutz wegschaffen kann. „Ausnahmeregelung zur Düngung von Zwischenfruchtflächen in Ostdeutschland“ heißt das im offiziellen deutschen Beschönigungs-Unrechts-Sprech.

Die Tönnies RWE-Braunkohle-Connection

Ein größerer Teil des Klärschlamms wird allerdings tief in den Westen weggeschafft. Er wird nämlich in Kohlekraftwerken mitverbrannt. Und die gehören wem? Richtig, die gehören dem Umweltvergifter RWE. Und der Klärschlamm aus Weißenfels wird ins Braunkohlekraftwerk Lippendorf in der Lausitz verbrannt. Bei der Verbrennung gelangen Schadstoffe auch in die Luft. Schadstoffe, die im Filter aufgefangen werden, werden in stillgelegte Bergwerke weggeschafft und können das Grundwasser verseuchen. Hallo Umweltfreunde: Schon mal gehört? Tönnies gehört also, bisher ungenannt, zur Braunkohle-Verbrennungs-Umwelt-Zerstörungs-Connection.

Tönnies schlachtet immer mehr, auch wenn das schon überlastete Klärwerk von Rheda-Wiedenbrück gar nicht auf die Verarbeitung der immer mehr Schlachtabfälle eingerichtet ist. Deshalb muss die Stadt auf ihre Kosten seit 2018 einen zusätzliche Lagerplatz bauen. Schon mal 320.000 Euro für den ersten Bauabschnitt. Da liegt also der Klärschlamm herum. Methangas tritt aus. Die Düngemittel- und Klärschlamm-Verordnung wird verletzt. Der überschuldete Stadthaushalt wird durch Tönnies noch weiter überschuldet.

Geschundene Flüsse: Ems und Saale

Die Abwässer aus dem Klärwerk von Rheda-Wiedenbrück werden in den Fluss Ems eingeleitet. Die Ems gehört zu den besonders mit Schadstoffen belasteten Flüssen in Deutschland. Aber haben die sogenannten Aufsichtsbehörden aussagekräftige Messungen über multiresistente Keime in der Ems vorgenommen, hinter der Einleitungsstelle des Klärwerks Rheda-Wiedenbrück im Vergleich zur Belastung vor der Einleitungsstelle? Nein, solche Messungen gibt es nicht.

Die Behörden sperren wie die drei Affen Nase und Mund und Ohren zu. Rechtsstaat mit Tönnies?

Im ausgebeuteten Ostdeutschland kann Tönnies sich noch viel mehr erlauben. Von 2006 bis 2011 hat seine Schlachterei in Weißenfels seine Abwässer in die Saale geleitet, illegal, durch einen Bypass im städtischen Klärwerk. Dafür hat Tönnies, erst gezwungen nach einem langen Gerichtsverfahren, 1,5 Millionen Euro Buße gezahlt. Methode Tönnies: Gesetze brechen, wenn keiner aufpasst. Damit Gewinne machen. Notfalls nachher ein Bußgeld aus der Portokasse

Übrigens, wenn wir schon mal dabei sind: vernutzt auch das wertvolle Grundwasser. Tönnies zapft in Weißenfels das Grundwasser an. Zusätzlicher Vorteil: Tönnies braucht dafür nicht das Wasser aus den Stadtwerken zu bezahlen.

Nichts sehen, nichts hören, nichts riechen – und schon gar nicht drüber reden

Wir haben den stellvertretenden Leiter des Klärwerks von Rheda-Wiedenbrück, Rainer Bollmers angefragt:

  • Wieviel Kubikmeter Abwasser leitete Tönnies in den Jahren 2016, 2017 und 2018 in die Kläranlage ein?
  • In welche der vier Schadstoff-Belastungsstufen wurde das Tönnies- Abwasser entsprechend der Abwassersatzung der Stadt eingestuft?
  • Welchen Verschmutzungszuschlag zahlt Tönnies entsprechend dieser Einstufung?
  • Wurden überhaupt Messungen in der Zuleitung aus dem Schlachtbetrieb in die Kläranlage vorgenommen?
  • Wie hoch ist die Emission des ozonschädlichen Methangases aus dem Faulturm und vom Lagerplatz?
  • Wieviele Tonnen Klärschlamm wurden in den Jahren 2016, 2017 und 2018 in RWE-Kraftwerken verbrannt?
  • Die Verbrennung einer Tonne Klärschlamm kostet die Stadt 150 Euro – wieviel davon zahlt Tönnies?

Weder Herr Bollmers noch jemand anders aus der Stadtverwaltung hat geantwortet. Es herrscht das Gesetz des Schweigens.

Toennies Fleisch.jpg

Wir haben dieselben Fragen auch an Tönnies gerichtet. Tönnies hat ja zur Beantwortung von Fragen eine eigene „Kommunikations“abteilung. Chef ist Herr Dr. André Vielstädte. Er hat schon viel zur schönen Sauberkeit der Arbeitsverhältnisse und auch des Wassers bei Tönnies an die Medien kommuniziert. Aber zu unseren Fragen schweigt verbissen auch dieser ansonsten vielschwätzende Kommunikationsstratege.

Komplizen: Landkreis Gütersloh und Regierungspräsident Herford

Tönnies als größter Schlachtbetrieb Europas beruht auf der Schweinemast in zahlreichen Mastbetrieben. Dort wird Gülle in die Umwelt eingeleitet, in den Boden als Dünger, ebenfalls in die dortigen Kläranlagen, in die Flüsse, in das Grundwasser. Ebenfalls versenkt Tönnies Klärschlämme als Zwischennutzung in Ostdeutschland. Aber die Komplizenschaft der Behörden auf kommunaler Ebene setzt sich beim Landkreis Gütersloh und beim Regierungspräsidenten in Herford fort. Dasselbe in Weißenfels im ostdeutschen Sachsen-Anhalt.

Immerhin: EU kritisiert verseuchtes Grundwasser

Bekanntlich stellt die Europäische Kommission, die gewiss sehr nachsichtig ist, besonders mit dem mächtigen Deutschland und seiner christlich-nachsichtigen Bundeskanzlerin, immer wieder fest: Die Bundesrepublik verletzt nachhaltig die Gülle-Verordnung. Das hat auch der Europäische Gerichtshof festgestellt. „Deutsches Grundwasser gehört zum schlechtesten in der EU“, erklärt die Kommission. In einigen Regionen wird der zulässige Grenzwert um das vier- bis sechsfache überschritten. Vom Grundwasser gelangt das krebserregende Nitrat ins Trinkwasser. Die Bundesregierungen erlauben die dauerhafte Verletzung des Gesetzes, gefährden die Bevölkerung, insbesondere Kleinkinder und Schwangere.

Zur Belohnung gibt’s EU-Subventionen obendrauf

Dabei hat die Europäische Union zum Aufstieg von Tönnies selbst beigetragen: acht Schlachtereien in Deutschland, weitere Standorte inzwischen in Dänemark, Polen, Frankreich und Großbritannien, Exporte in 80 Staaten. Das hat die EU nicht nur durch die Förderung der Niedriglöhne in den armen Mitgliedsstaaten und durch die Freizügigkeit für Werkvertragsfirmen bewirkt. Die EU hat Tönnies auch mit Agrarsubventionen beschenkt. So erhielt Tönnies im Jahre 2008 2,67 Millionen Euro aus dem Europäischen Garantiefonds für die Landwirtschaft.10

Kartellamt durch Bauerntrick getäuscht

2014 verhängte das Bundeskartellamt gegen 21 Wursthersteller wegen illegaler Preisabsprachen Bußgelder von insgesamt 338 Millionen Euro. Der Löwenanteil von 128 Millionen Euro entfiel auf Haupttäter Tönnies. Doch Tönnies trickste und löste die betroffenen Tochterfirmen Böklunder, Plumrose und Könecke schnell auf. Das Kartellamt resignierte. Tönnies brauchte nicht zu zahlen.11

Was können wir tun?

Das System Tönnies schadet den Beschäftigten und ihren Menschenrechten, dem Wasser, den Böden, den Tieren, den Bürgern in den betroffenen Kommunen, dem Rechtsstaat, der Demokratie.

Wir fordern deshalb:

  • Das System Tönnies endlich stoppen!
  • Reguläre Arbeitsverträge und Meinungsfreiheit für die Werkvertragsarbeiter!
  • Menschenwürdige Unterbringung!
  • Glasklare Messungen der Abwässer aus den Tönnies-Schlachtereien!
  • Keine Verbrennung der Klärschlämme in den RWE-Kohlekraftwerken!
  • Einwohner von Rheda-Wiedenbrück, Weißenfels, Kempten und so weiter: Klopft Euren Stadtverwaltungen auf die Finger!

Und was können wir noch tun? Böklunder, Gutfried & ALDI-Fleisch meiden

Kaufen wir Tönnies nichts mehr ab! Seine Marken Böklunder – für Schweine und Rindfleisch – und Gutfried – für Geflügel – liefert er an alle Supermärkte, für ALDI beliefert Tönnies die Hausmarken Tillmann’s, Sölde, Rolffes, Landbeck.

Hallo Fans von Schalke 04 und VfB Stuttgart: Sorgt dafür, dass Tönnies Böklunder Dumping-Wurst aus euren Fußballstadien verschwindet! Dann macht Fußball erst richtig Spaß!


1 Werner Rügemer ist der Vorsitzende des Vereins aktion ./. arbeitsunrecht – Initiative für Demokratie in Wirtschaft & Betrieb. Er hält die Rede am 13. September 2019 in Rheda-Wiedenbrück. Die Rede mag vervielfältigt und bei Aktionen genutzt und – auch auszugsweise – verlesen werden.

2 Kreis Gütersloh, Der Landrat: Protokoll des Erörterungstermins am 12.7.2017, S.10

3 CDU-Mittelstandspolitiker: Tönnies macht Profit mit „Sklaverei“, WDR-Lokalzeit 16.8.2019;

4 Viel Arbeit, wenig Lohn, mdr/Heute im Osten 27.11.2017,

5 Was Tönnies‘ Angestellte zu ihren Arbeitsbedingungen sagen, Der Westen, 30.8.2013,

6 Siehe Fußnote 2

7 Kein Grundsatzurteil über Umkleide- und Wegezeiten, 28.6.2017,

8 Siehe Fußnote 3

9 Siehe Fußnote 3

10 Hintergrund, 27.8.2013

11 Wurstkartell: Kartellamt gibt auf, Tönnies ist aus dem Schneider,, 19.10.2016

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).


Grafikquellen         :

Oben     —      Technologiezentrum zur Mühlen Gruppe

 Zu Tönnies-Wurstimperium gehört auch die Fleischwarenfabrik Böklunder. / zur Mühlen-Gruppe – zur Mühlen ApS & Co. KG (CC BY-SA 3.0)

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: zur Mühlen-Gruppe – zur Mühlen ApS & Co. KG


Unten      —     Rheda-Wiedenbrück, Tönnies Fleischwerk im Stadtteil Rheda. Aufgenommen am 14. Januar 2006 von Daidalus.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled GNU Free Documentation License. Free Documentation Licensetruetrue

Abgelegt unter Nordrhein-Westfalen, Schicksale, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Der Antisoziale Patriotismus:

Erstellt von DL-Redaktion am 16. September 2019

Die Rentenpläne der AfD

Maischberger - 2018-01-24-1895.jpg

Von Christoph Butterwegge

Vor den anstehenden Landtagswahlen in Brandenburg, Sachsen und Thüringen im September beziehungsweise Oktober inszeniert sich die ostdeutsche AfD als Fürsprecherin der Benachteiligten – und all jener, die sich benachteiligt fühlen. Allerdings zeigt sich die vermeintliche „Kümmererpartei“ gerade hinsichtlich ihres Rentenkonzepts nicht nur zutiefst gespalten, sondern auch hochgradig unsozial. Dort, wo vielen Menschen aufgrund längerer Arbeitslosigkeit und/oder schlecht bezahlter (Leih-)Arbeit künftig Altersarmut droht, plädiert der völkisch-nationalistische und in weiten Teilen rechtsextreme Parteiflügel um Björn Höcke, dem Landes- und Fraktionsvorsitzenden der thüringischen AfD, für einen „solidarischen Patriotismus“, der all jenen zugutekommen soll, die eine deutsche Staatsbürgerschaft besitzen. Dagegen setzt der national- bzw. wirtschaftsliberale Flügel um Bundessprecher Jörg Meuthen und die Bundestagsfraktionsvorsitzende Alice Weidel weniger auf staatliche Interventionen als auf den (Finanz-)Markt, das Prinzip Eigenverantwortung und individuelle Selbstvorsorge.

Obwohl die Richtungsgruppierungen innerhalb der AfD in vielen Politikbereichen konträre Positionen vertreten, gelang es ihnen bisher fast immer, zugunsten einer möglichst breiten Akzeptanz in der Wählerschaft für alle Strömungen tragbare Kompromisse zu schließen. Dabei bildet die „Massenmigration“ von Flüchtlingen das Schlüsselthema, mit dem die Partei alle übrigen Themenkomplexe zu verbinden und die konträren Lager zu einen versucht.[1] Dies gilt auch für das Problem der Altersarmut, obwohl es mit der Fluchtthematik nichts zu tun hat: Erstens erhalten Flüchtlinge (noch) keine Rente. Und zweitens hat der Bundestag bereits lange vor dem „Sommer der Migration“ im Jahr 2015 beschlossen, dass das Sicherungsniveau der Renten von damals 53 auf bis zu 43 Prozent vor Steuern im Jahr 2030 sinken kann, ohne dass der Staat eingreift.

Auch sechseinhalb Jahre nach ihrer Gründung hat die AfD immer noch kein Rentenkonzept verabschiedet. Die Vielzahl unausgegorener Papiere der verschiedenen Parteigruppierungen sollte eigentlich im September dieses Jahres auf einem Sonderparteitag zur Sozialpolitik in einen Beschluss münden. Doch da die AfD in der Rentenpolitik nach wie vor heillos zerstritten ist, verschob ihr Bundesvorstand den Parteitag kurzerhand auf das kommende Jahr. Bis dahin kann jede Strömung ihr eigenes Konzept als mehrheitsfähig präsentieren – und damit auf Wählerfang gehen.

Eigentum als Alterssicherung

Die Werbetrommel wird bereits seit längerem kräftig gerührt. Im Mai 2018 stellte Uwe Witt, nordrhein-westfälischer AfD-Bundestagsabgeordneter und Vorsitzender der „Alternativen Vereinigung der Arbeitnehmer“ (AVA) dieser Partei, zusammen mit dem Oberurseler Stadtverordneten Peter Lutz ein Diskussionspapier mit dem Titel „Alterssicherungskonzept für die Bürgerinnen und Bürger Deutschlands“ vor. Ausgehend von der These, dass die Rentenversicherungsbeiträge zu hoch, die Renten zu niedrig und die Zukunftsaussichten katastrophal seien, nahmen sie das jahrzehntelange Hinausschieben „notwendiger Anpassungsmaßnahmen“ ins Visier.[2] Gemeint waren damit offenbar Rentenkürzungen, denn Witt und Lutz lehnen Beitragserhöhungen ebenso ab wie höhere Steuerzuschüsse. Was sie als „Flexibilisierung durch Lebensarbeitszeit“ bezeichnen, läuft auf eine Verlängerung der Lebensarbeitszeit und eine Anhebung des durchschnittlichen Renteneintrittsalters hinaus: „Wir müssen uns […] in Zukunft von einem fixen Renteneintrittsalter entfernen und allein die geleistete ‚Lebensarbeitszeit‘ zum Maßstab des Renteneintritts nehmen. Wer mit 15 Jahren anfängt zu arbeiten und Rentenbeiträge zu zahlen, sollte auch mit 60 Jahren abschlagsfrei in Rente gehen dürfen. Wer sich hingegen mit seiner Ausbildung viel Zeit lässt, muss dann auch die Konsequenz ziehen und erst später in die Rente eintreten.“[3] Abgesehen davon, dass schon heute kaum noch jemand die 45 Beitragsjahre des „Standardrentners“ erreicht, hieße dies, dass für Akademiker*innen mit entsprechend langen Ausbildungszeiten die Rente mit 70 oder 75 Jahren zur Regel würde.

Neben einer Verlängerung der Lebensarbeitszeit soll die Einnahmebasis der Rentenversicherung um Beamte und Selbstständige erweitert und das „Lohnabstandsgebot“[4] beachtet werden. Darüber hinaus fordern Witt und Lutz einen „On Top Zuschuss“ zur Rentenbeitragszahlung der Niedriglohnempfänger*innen von bis zu 40 Prozent.[5] Weiter setzt die AVA auf ein Drei-Säulen-Modell – bestehend aus staatlicher, betrieblicher und privater Vorsorge –, bei dem sich die Unterstützung der betrieblichen und der privaten Altersvorsorge „an Effizienzkriterien zu orientieren“ habe: „Insbesondere in der dritten Säule, der privaten Vorsorge, wollen wir neue Wege gehen. Denn wir fordern hier eine deutlich höhere staatliche Förderung bei der Schaffung von selbstgenutztem Wohneigentum für jeden Erwerbstätigen wie auch die staatliche Unterstützung bei der Bildung von Unternehmenseigentum in Arbeitnehmerhand.“[6] Staatlich subventioniertes Eigentum soll also an die Stelle von Sozialleistungen treten – ohne ihn zu nennen, greift die AVA dabei die Idee des „Volkskapitalismus“ von Ludwig Erhard auf, während ansonsten wenig originelle Ideen entwickelt wurden.

Völkische Sonderregelungen

Ebenfalls bereits im Mai des letzten Jahres veröffentlichte Markus Frohnmaier ein „Impulspapier“ zu Rentenpolitik. Er ist langjähriger Bundesvorsitzender der Jungen Alternative, verfügt über gute Kontakte in die rechtsextreme Szene und ist heute AfD-Bundestagsabgeordneter. Frohnmaier spricht sich für einen „Volkskapitalismus“ im Sinne einer „Volksrente“ nach Schweizer Vorbild aus. Das bisherige Umlageverfahren soll zwar nicht abgeschafft, sein Schwerpunkt aber zu einem „kapitalgedeckten“ – in Wirklichkeit: zu einem finanzmarktabhängigen – Rentensystem verschoben werden.

Die geplante „Volksrente“ verfügt über drei Bestandteile: erstens eine „Grundrente“ für „alle Menschen mit deutscher Staatsangehörigkeit weltweit“, die sie durch Pflichtbeiträge finanzieren, sofern ihr Jahreseinkommen mindestens 15 000 Euro beträgt; zweitens eine „Lebensrente“ als „kapitalgedeckte private Teilzwangsversicherung“, welche die Lebensleistung widerspiegeln und im Idealfall den Löwenanteil der Ausgaben eines Ruheständlers decken soll; drittens eine „rein private und freiwillige Zusatzrente“, durch die sich der Lebensstandard im Alter dem Lebensstandard im Arbeitsleben noch stärker angleichen soll.[7]

Beiträge zur Grundrente wären an die Höhe des Einkommens, aber auch an die Zahl der Kinder gekoppelt (pro Kind würden sie halbiert).[8] Nichtdeutsche hätten jedoch stets den vollen Grundrentenbeitrag zu entrichten und erhielten auf ihr „Lebensrentenkonto“ im Unterschied zu deutschen Staatsbürger*innen auch keinen staatlichen Zuschuss.

File:2017-04-23 AfD Bundesparteitag in Köln -68.jpg

Zwei Ärsche ohne Kopf – ergeben keinen Zopf

Ganz im Sinne einer völkischen Ideologie werden Deutsche privilegiert und wird die traditionelle Familie hochgehalten: „Eine deutlich bessere Absicherung im Alter als jedes Rentensystem [sind] nach wie vor die eigenen Kinder“, so Frohnmaier; mit ihnen könne „auf eine höhere Lebensrente im Zweifel einfacher verzichtet werden“.[9] Frohnmaier gehört folglich zu den Verächtern, nicht zu den Verteidigern des modernen Sozialstaates, glaubt er doch, man könne die Altersvorsorge im 21. Jahrhundert wie in einer altertümlichen Gesellschaft organisieren, in der Kinder den Reichtum ihrer Eltern darstellten und diese im Alter mit „durchfütterten“. Statt jedoch die Konsequenz aus seiner absurden Vorstellung zu ziehen und den Eltern mehrerer Kinder, die sie im Alter versorgen könnten, eine staatliche Rente vorzuenthalten, macht Frohnmaier das Gegenteil und möchte sie gegenüber Kinderlosen privilegieren.

Nichtdeutsche dürfen derzeit nicht gegenüber Deutschen diskriminiert werden, denn das Sozialversicherungssystem finanziert sich durch verfassungsrechtlich nach Art. 14 Abs. 1 GG als Eigentum geschützte Beiträge von Arbeitnehmer*innen und Arbeitgebern. Wer also gewisse Rentenbestandteile deutschen Ruheständler*innen vorbehalten will, verstößt gegen die Verfassung – weshalb Frohnmaier auch eine Grundgesetzänderung anstrebt. Zugleich will die AfD, wie in ihrem Bundestagswahlprogramm angekündigt, zum Blutrecht zurückkehren und sowohl Mehrfachstaatsangehörigkeiten als auch Einbürgerungen nach dem seit knapp zwanzig Jahren geltenden Territorialprinzip wieder abschaffen.[10] Hier lebende Nichtdeutsche hätten dann keine Möglichkeit mehr, die deutsche Staatsbürgerschaft und damit volle Rechte als Rentenbezieher*innen zu erhalten.

»Staatsbürgerrente« für deutsche Geringverdiener

Quelle           :         Blätter         >>>>>          weiterlesen


Grafikquellen       :

Oben     —         MAISCHBERGER am 24. Januar 2018 in Köln. Produziert vom WDR. Thema der Sendung: Ganz unten: Wie schnell wird man obdachlos? Foto: Christoph Butterwegge (Armutsforscher)

Abgelegt unter Köln, P.AfD, Rentenpolitik, Sozialpolitik | Keine Kommentare »

Tönnies stoppen –

Erstellt von DL-Redaktion am 9. September 2019

Bundesweite Proteste und zentrale Kundgebung in Rheda

Quelle       :    Scharf  —  Links

Von Aktion gegen Arbeitsunrecht und Bündnis gegen die Tönnies-Erweiterung

Einladung zum Aktionstag

Am Freitag, dem 13. September 2019 findet eine Demonstration zur Konzernzentrale der Schlachtfabrik Tönnies in Rheda-Wiedenbrück statt. Treffpunkt ist um 15 Uhr auf dem Bahnhofsplatz in Rheda-Wiedenbrück. Der Protest ist Teil des von der Aktion gegen Arbeitsunrecht und dem Bündnis gegen die Tönnies-Erweiterung organisierten bundesweiten Aktionstages „Freitag, der 13.“. Von Kiel bis Kempten, von Düren bis Berlin, in über 20 Städten sind bereits Aktionen angemeldet, um auf die Machenschaften des Konzerns aufmerksam zu machen. Der Fleischkonzern reagierte mit einer einstweiligen Verfügung und erwirkte mit Hilfe der Kanzlei Schertz Bergmann auf fragwürdige Weise die Schwärzung mehrerer Passagen auf der Homepage der Aktion gegen Arbeitsunrecht.

Mit dem Aktionstag „Freitag, der 13. – Das System Tönnies stoppen“ gewinnt der Widerstand gegen die Ausbeutung von Mensch, Tier und Natur eine neue Qualität. Die Demonstration in Rheda-Wiedenbrück wird vom Bündnis gegen die Tönnies-Erweiterung und der Aktion gegen Arbeitsunrecht veranstaltet und organisiert. Bündnispartner und Unterstützer sind u.a. Attac Gütersloh, der BUND-OWL, Fairleben e.V., Venga e.V., Safe Movement Bielefeld, die LAG Tierschutz DIE LINKE.NRW, ARIWA OWL, IG WerkFAIRträge, die Linksjugend [’solid] Kreis Gütersloh und DIE LINKE Kreisverband Gütersloh Die Fridays for Future Gruppen in OWL wurden von dem Bündnis zur Teilnahme an der Veranstaltung eingeladen und haben bereits zugesagt. Anderswo organisieren die Greenpeace-Jugend, zahlreiche Tierrechts-Organisatoren und viele andere den Protest.

Die Breite des Widerstandes zeigt sich auch an den Rednerinnen und Rednern, die nach Rheda kommen werden. Der Journalist und Publizist Dr. Werner Rügemer spricht für die Aktion gegen Arbeitsunrecht. Die Tierrechtsaktivistin Dr. Bettina Rehberg vertritt ARIWA OWL. Der Student und Fridays for Future-Aktivist Ercan Korkmaz wird den Klimaschutz zum Thema machen. Ebenfalls als Rednerin wird die Bundestagsabgeordnete Amira Mohamed Ali auftreten. Die Juristin Amira Mohamed Ali aus Oldenburg vertritt die Partei DIE LINKE. im Bundestag in den Ausschüssen Recht und Verbraucherschutz sowie Ernährung und Landwirtschaft.

Der Protest richtet sich gegen ein System, das auf die skrupellose Ausbeutung von Menschen, das grausame Quälen von Tieren und die Zerstörung der Natur setzt. Die industrielle Fleischproduktion gehört zu den Hauptverursachern der Klimakatastrophe. Das verbindet den Aktionstag am 13. September mit der eine Woche später beginnenden globalen Klimastreikwoche. Eine Übersicht der bundesweit stattfindenden Aktionen gegen Tönnies am 13. September findet sich hier:

Von den juristischen Drohungen durch die von Tönnies beauftragten Anwälte werden sich die Organisatoren nicht einschüchtern lassen. Sollte es zu einem Prozess kommen, könnte dieser zu einem Tribunal gegen Tönnies und die Praktiken der Kanzlei Schertz Bergmann werden.

Weitere Infos:

Twitter-Hashtag: #Fr13Toennies

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle      :           Bild: Aktion Arbeitsunrecht   –      Schatf – Links

Abgelegt unter Arbeitspolitik, Gewerkschaften, Nordrhein-Westfalen, Regierung | Keine Kommentare »

Anlass zur Unruhe

Erstellt von DL-Redaktion am 7. September 2019

AfD gewinnt, LINKE verliert deutlich

Quelle     :          AKL   

Von Claus Ludwig

Dass die AfD in keinem Bundesland zur stärksten Partei geworden ist, ist kein Grund zur Entwarnung. Die Landtagswahlen vom 1. September markieren eine Stabilisierung der offen rechtsextrem auftretenden AfD auf hohem Niveau und bestätigen deren Ergebnisse der Bundestags- und Europawahlen.

Die gestiegene Wahlbeteiligung basiert teilweise darauf, dass es eine Anti-AfD-Mobilisierung in letzter Minute gab, die überwiegend den jeweiligen Parteien des Ministerpräsidenten – CDU in Sachsen, SPD in Brandenburg – nutzte. Die Parteien der Berliner Koalition sind Wahlverlierer, doch mit dem blauen Auge davongekommen, weil es keine sichtbare Alternative zu ihrer Regierung gab.
Trotz des beschämenden Wahlergebnisses der SPD in Sachsen wird diese dort zum Regieren dringlicher gebraucht als je zuvor. Ihr Absturz beschleunigt nicht das Ende der sogenannten GroKo, sondern stabilisiert diese zunächst.
Aufgrund der gestiegenen Wahlbeteiligung legen AfD, Grüne, FDP in beiden Ländern bei den absoluten Stimmen zu, ebenso die CDU in Sachsen und die SPD in Brandenburg. Die LINKE hingegen wird in beiden Ländern prozentual fast halbiert, verliert in Brandenburg fast 48.000 (CDU: 30.000) und in Sachsen 85.000 (SPD: 38.000) Stimmen.
Die schwelende Krise der Partei, mit Schwächen bei mehreren Landtagswahlen, einem mittelmäßigen Ergebnis bei der Bundestagswahl 2017 und dem schwachen Abschneiden bei der Europawahl hat damit einen akuten Zustand erreicht.

Profillose LINKE verliert

Dafür gibt es nicht nur einen Grund. Der erste und wichtigste Schritt raus aus dem Tief der LINKEN wäre, nicht mehr so viel falsch zu machen, selbst wenn man noch nicht so genau wüsste, was danach käme. Brandenburg ist ein Paradebeispiel für die verheerende Wirkung der Regierungsbeteiligung.
Die Brandenburger LINKE hat dem repressiven Polizeigesetz zugestimmt. Sie hat entgegen dem bundesweiten Programm die Ausdehnung des Braunkohle-Abbaus mitgetragen. Sie hat Kürzungsmaßnahmen im öffentlichen Dienst beschlossen und keinen Ansatz geboten, die Probleme von Provinzflucht, schlechter Versorgung und geringer Mobilität anzugehen. 70% äußerten in einer Umfrage, die LINKE hätte „in der Landesregierung nichts durchgesetzt, was mir besonders aufgefallen wäre“. [1]

Das ist in Sachsen nicht grundlegend anders. Hier erbringt DIE LINKE den Beweis, dass man auch als Oppositionskraft eine staatstragende Haltung an den Tag legen kann.
Während diese Tatsachen für jede*n klar erkennbar sind, gehen Teile der Partei- und Fraktionsführung, vor allem die Vorsitzende Katja Kipping und der Fraktionsvorsitzende Dietmar Bartsch in die Offensive, um die Bereitschaft für das Mitregieren in Ländern und im Bund zu erhöhen. Angesichts des grünen Höhenflugs ist R2G rechnerisch wieder wahrscheinlicher geworden. Doch politisch ändert dies nichts.

Eine Zusammenarbeit mit dieser SPD und diesen Grünen ist nur um den Preis der politischen Selbstaufgabe der LINKEN zu haben. Im Osten hat die Partei ihre Funktion als soziale Protestpartei bereits weitgehend verloren, sie wird als Teil des Establishments gesehen und wird überflüssig, weil die Grünen den Spagat zwischen fortschrittlich klingenden Versprechungen und kapitalistischer Realpolitik eleganter aussehen lassen.
Es mag Zwischenhochs geben wie aktuell in Berlin oder Anfangseuphorie wie in Bremen. Am Ende kommt die Rechnung dafür, von einer grundlegend anderen Politik geredet, aber nicht geliefert zu haben.
Nichtregieren allein ist auch keine Lösung. Die sächsische LINKE gebärdet sich seit Jahren wie eine Regierungspartei im Wartestand. In ihrem Programm zur Landtagswahl spricht sie von einer „Privatisierungsbremse“, aber nicht davon, Privatisierung komplett abzulehnen und die schon privatisierten Betriebe wieder in öffentliches Eigentum zu überführen. Den sozialen Wohnungsbau
wolle man „ankurbeln“, aber die Aussage, dass das Land und die Kommunen die Wohnungen bauen werden, wollte die sächsische LINKE nicht treffen.

Soziale Frage unterbetont?

In der LINKEN wird seit Längerem darüber gestritten, ob man die „soziale Frage“ genug betone. Vor allem die Anhänger*innen von Sarah Wagenknecht behaupten, die LINKE hätte diese vernachlässigt und wäre den Grünen zu ähnlich, als großstädtische Partei, die auf Fragen wie Antirassismus und Umweltschutz setze.
Natürlich sind die bereits erlittenen sozialen Abstiege im Osten, niedrige Löhne, prekäre Jobs und Sorgen bezüglich kommender wirtschaftlicher Verwerfungen oder Altersarmut und auch die realen Erfahrungen mit der LINKEN an der Regierung Teil des Frustrations-Mixes, auf dem die Angst-
Propaganda der Rechtspopulisten basiert.
Allerdings waren soziale Gerechtigkeit und wirtschaftliche Probleme nicht die ausschlaggebenden Faktoren bei dieser Wahl. 58% in Brandenburg und 75% in Sachsen sind mit ihrer wirtschaftlichen Lage nach eigenen Angaben zufrieden. Hingegen fürchten 63% in Sachsen, dass „der Klimawandel unsere Lebensgrundlagen zerstöre“ und 60%, der „Einfluss des Islam“ werde in Deutschland „zu stark“. [2]
Es nutzt nichts, die „soziale Frage“ wie eine Monstranz vor sich her zu tragen. Sie muss konkret beantwortet werden. Dazu gehört, eine klare antirassistische Position zu formulieren. Die LINKE sollte in der Klimafrage in die Lücke stoßen, welche die Grünen lassen: Für eine radikale ökologische Wende eintreten und gleichzeitig dafür kämpfen, dass nicht die Arbeiter*innenklasse dafür bezahlt, sondern die Reichen und die Konzerne.

Klimaschutz und Arbeitsplätze

Die AfD hat flächendeckend unter „Arbeitern“ [3] gut abgeschnitten, zudem war sie im Lausitzer Braunkohlerevier erfolgreich. Mit einer Ausnahme ist sie dort in allen Wahlkreisen stärkste Partei geworden. Das Gegeneinander-Ausspielen von Ökologie und Ökonomie, von Klimaschutz und Arbeitsplätzen hat gegriffen. Wohl aus Sorge um ihre Jobs haben viele Arbeiter*innen die Klimaleugner-Partei gewählt. Hier hilft weder der opportunistische Kurs der Brandenburger LINKEN, die an der Braunkohle festhalten will noch die ignorante Haltung der Grünen, sich um die Jobs nicht zu scheren. Hier müsste eine Linke agieren, die ohne Zögern für den Ausstieg aus dem Klimakiller Braunkohle kämpft und genauso kompromisslos dafür eintritt, dass die Löhne der Braunkohle-Beschäftigen unbefristet weiterbezahlt werden bis eine gleichwertige Anschlussbeschäftigung gesichert ist. Dies wird nicht funktionieren, wenn man sich scheut, die Eigentumsfrage – die notwendige Vergesellschaftung der Energiewirtschaft unter demokratischer Kontrolle – aufzuwerfen.

Hahn Wahlkampfauftakt, August 2009 - by Die Linke Sachsen.jpg

Nachvollziehbar ist auch, dass die Braunkohle-Arbeiter*innen allgemeinen Versprechungen von Ersatzarbeitsplätzen und Strukturprogrammen angesichts Kohls historischer Lüge von den „blühenden Landschaften“ nicht trauen. Die LINKE müsste für ein umfassendes öffentliches Programm zum ökologischen Umbau der Industrie eintreten, dafür aktiv auf die Straße gehen, müsste auch in den Gewerkschaften für diese Position argumentieren und den Beschäftigen eine Perspektive aufzeigen, wie diese selbst aktiv werden können, um ihren Lebensstandard zu verteidigen.

System change

Die „soziale Frage“ lediglich defensiv aufzugreifen, im Sinne eines zweiten Aufgusses der Sozialdemokratie, wird nicht funktionieren. Es gibt keinen Platz für eine „Kümmererpartei“, welche sich anbietet, den ausgefransten Sozialstaat zu flicken. Die Klassenfrage ist untrennbar mit den großen Zukunftsfragen Migration und Klima verbunden, mit der Frage, wie wir leben wollen und wer darüber entscheidet. Die Partei sollte die „soziale Frage“ nach vorne gerichtet aufgreifen. Dazu müsste sie offensiv antikapitalistisch agieren.
Das System befindet sich, ungeachtet des noch im Bewusstsein wirkenden relativen Aufschwungs in Deutschland, in einer strukturellen ökonomischen, ökologischen, sozialen und politischen Krise. Die LINKE wird nur aus ihrer strategischen Klemme herauskommen, wenn sie Antworten auf diese Krise bietet und in den konkreten Auseinandersetzungen zeigt, dass sie sie einen Gebrauchswert hat, weil sie dies Auseinandersetzungen inhaltlich und praktisch befördern kann.
Solange der LINKEN der Mut zur grundlegenden Infragestellung des Kapitalismus fehlt, solange sie Fragen wie Klimaschutz, Wohnungsnot, Rassismus und Armut durch die Augen einer Werbeagentur sieht und sich fragt, welches Thema man wann auf die Plakate schreiben soll, gar einige einen Widerspruch darin sehen anstatt verschiedene Aspekte einer Krise des Systems, wird die Partei den Entwicklungen hinterherlaufen. Die Partei muss die Vision einer grundlegenden anderen Gesellschaft vermitteln, sie braucht eine sozialistische Perspektive, die mit konkreten
Vorschlägen untermauert werden muss.
Weder die weitere Anpassung an SPD und Grüne noch gegenseitige Schuldzuweisungen und neue Personaldebatten helfen der Partei jetzt weiter. Die LINKE muss umschwenken von einer parlamentarisch fixierten, auf die Establishment-Parteien starrenden Politik, hin zu Kampagnen, rein in die sozialen Auseinandersetzungen, muss sich als aktive Kraft beweisen, die einen Gebrauchswert für die Menschen vor Ort hat. [4]

AfD zeckt sich fest

Die Krise des Systems, das Auseinanderdriften der EU und gewachsene Widersprüche zwischen den Regionen der Welt führen zu einer Polarisierung – nach links und nach rechts. Nur findet die Polarisierung nach links, die sich aktuell in großen antirassistischen Protesten sowie der Bewegung Fridays for Future ausdrückt, keine Entsprechung auf Wahlebene. Der AfD ist es gelungen, die rechte Polarisierung bei Wahlen nahezu zu monopolisieren.

Die AfD verfügt über Eigenschaften einer „Protestpartei“. So sagen 87% der AfD-Wähler*innen in Brandenburg und 83% in Sachsen, das wäre die einzige Partei, mit der man einen Protest gegen die Etablierten ausdrücken könne.
Doch es handelt sich dabei nicht um einen fehlgeleiteten Sozialprotest, der sich leicht nach links umlenken lassen würde. Nur 14% der AfD-Wähler*innen in Brandenburg gaben an, Löhne und Renten wären ausschlaggebend für ihre Wahlentscheidung gewesen, 11% in Sachsen sagten dies über die soziale Sicherheit. 97% in Brandenburg und 99% in Sachsen gaben an, dass sie die AfD gut fänden, weil diese „den Zuzug von Ausländern und Flüchtlingen begrenzen“ will, 30% bzw. 34% sagten, Forderungen in diese Richtung wären ausschlaggebend für ihre Wahlentscheidung gewesen. [5]

Erfolg für den „Flügel“

Horst Kahrs von der Rosa-Luxemburg-Stiftung schreibt in seiner Wahlanalyse: „Wer AfD wählt, will eine andere Gesellschaft.“ Das ist vereinfacht, aber nicht falsch. Der Protestcharakter der AfD
basiert auf tiefsitzenden völkischen und rassistischen Einstellungen, sie schwimmt mit auf der weltweiten Welle reaktionärer Antworten auf die Krise des Kapitalismus. Nur 24% der AfD-Anhänger*innen sind der Meinung, die Lebensumstände hätten sich massiv verschlechtert. Aber
92% sorgen sich vor dem Einfluss des Islam und 80%, dass sich „unser Leben“ zu stark verändere.
Das erklärt auch, warum die klare Rechtsentwicklung der Partei kaum deren Beliebtheit einschränkt. Die Landesverbände in Sachsen und Brandenburg sind zur aktivistischen, militanten Rechten hin offen, der Brandenburger Spitzenkandidat Kalbitz selbst hat Kontakte zu bekennenden Nazis. Im gesamten Osten ist der völkische, aggressiv rassistische „Flügel“ um Bernd Höcke dominant.
So schnell werden wir die AfD nicht los. In einer Phase, in der soziale Kämpfe nicht offen ausgetragen werden und die Klassenfrage in den Hintergrund tritt vor scheinbaren „Wertefragen“ kann die AfD die Widersprüche zwischen ihre prokapitalistischen Wirtschafts- und Sozialpolitik und der Demagogie, sich als Vertreterin der „kleinen Leute“ zu gebärden, relativ einfach verschleiern.
Ihr Aufstieg ist kein Grund zur Panik, aber sollte Anlass zur Unruhe sein. Die AfD in der Opposition verschiebt den politischen Diskurs nach rechts und treibt vor allem die CDU vor sich her.
Durch die Wahlerfolge im Stammland von Höckes „Flügel“ wird der völkische, offen rechtsextreme Teil der Partei gestärkt. Höcke hat bereits angekündigt, sich auf die im Herbst anstehenden Wahlen für den Parteivorstand vorzubereiten. Gleichzeitig wird die AfD einem stärkeren
Anpassungsdruck ausgesetzt sein. Bald werden die Stimmen in der sächsischen oder brandenburgischen CDU lauter werden, die AfD „einzubinden“, sie zu „entzaubern“.
Eine Regierungsbeteiligung der AfD würde dem Protest- und Anti-Establishment-Gehabe der Partei einigen Schwung nehmen. Die österreichische Erfahrung zeigt allerdings, dass die Rechtspopulisten nicht durch diese derartige „Entlarvung“ strukturell geschwächt werden. Dort konnten sie sich festigen und treiben die gesamte etablierte Politik weiter nach rechts.

Zum Autor

Claus Ludwig lebt in Köln und ist Mitglied im Landessprecher*innen-Rat der Antikapitalistischen Linken NRW und im Bundesvorstand der Sozialistischen Alternative.


[1] Zitiert nach: Kahrs, Horst: Die Wahl zum 7. Landtag Brandenburg und zum 7. Sächsischen Landtag am 1. September 2019, Wahlnachbericht, erste Kommentare und Daten, Rosa-Luxemburg-Stiftung.

[2] Ebd.

[3] In der Wahlanalyse sind damit Arbeiter*innen im klassischen Sinn, Handarbeiter*innen in der Industrie und im Handwerk, gemeint.

[4] Zitiert nach: Kahrs, Horst: Die Wahl zum 7. Landtag Brandenburg und zum 7. Sächsischen Landtag am 1. September 2019, Wahlnachbericht, erste Kommentare und Daten, Rosa-Luxemburg-Stiftung.

[5] Ebd.

akl - Antikapitalistische Linke


Grafikquellen      :

Oben       —        von Foto René Lindenau auf scharf – links


Unten       —          Dr. André Hahn bei Wahlkampfauftakt der sächsischen LINKEN

Abgelegt unter Köln, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Riegelsberger lechts-rinks

Erstellt von DL-Redaktion am 26. August 2019

Wer kann mit wem in Riegelsberg?


Von Marco Reuther

Was ist Politik? Dass sie eine Gemengelage aus vielen Gesichtspunkten und auch persönlichen Befindlichkeiten sein kann, zeigt gerade das Beispiel Riegelsberg. Dort sorgen die Beigeordneten-Wahl, eine Linke-„Abweichlerin“ und ungewöhnliche Partner für politisches Zähnefletschen.

In Riegelsberg ist der wechselseitige Ärger in den Ratsfraktionen noch nicht so ganz verraucht. Vor der konstituierenden Gemeinderatssitzung hatten CDU und Linke vereinbart, sich mit ihren gemeinsamen Stimmen die Ehrenämter der Beigeordneten zu teilen. Was aber wiederum die für die Linke neu in den Rat eingezogene Petra Brück nicht unterstützen wollte, so dass sie wieder aus der dreiköpfigen Fraktion der Linken austrat – dennoch konnten CDU und Linke ihre Kandidaten durchbringen (wir berichteten).

Erster Beigeordneter ist nun Benjamin Schmidt (CDU), mit 17 Ja-, einer Nein-Stimme und 14 Enthaltungen gewählt. Zweiter Beigeordneter ist der Linken-Fraktionsvorsitzende Ludwig Dryander. Er gewann die geheime Wahl mit 17 zu 14 und einer ungültigen Stimme. Die Sitzverteilung im Riegelsberger Gemeinderat: CDU 13, SPD 10, Bündnis 90/Die Grünen 4, Die Linke 3, AFD 2, FDP 1. In der Sitzung fehlte die FDP-Vertreterin wegen Urlaubs.

Der SPD-Fraktionsvorsitzende Frank Schmidt spricht nun davon, dass sich CDU und Linke die Beigeordneten-Ämter „geschnappt“ hätten, obwohl Ludwig Dryander zuvor kein Interesse an dem Amt gezeigt habe. Offenbar wolle die CDU lieber mit zwei „schwachen Linken“ zusammenarbeiten als mit der SPD. Man müsse nun schauen, wo man Mehrheiten herbekommt. Er hoffe, dass von CDU und Linken keine Blockaden kommen.

Es gibt sicher viele Linke deren Hände gerne in Taschen der Rechten enden ! Oder Umgekehrt

Dazu muss man auch wissen, dass das wechselseitige Verhältnis zwischen Bürgermeister Klaus Häusle (SPD) und der bisherigen Linken-Fraktionsvorsitzenden Birgit Huonker, ehemalige Landtagsabgeordnete und hauptberuflich Referentin der Linken-Landtagsfraktion, bestenfalls unterkühlt war. Birgit Huonker war in der ersten Runde der Bürgermeisterwahl – angetreten als unabhängige Kandidatin – knapp auf Rang drei verwiesen worden und hatte, wie im Wahlkampf angekündigt, nicht mehr für den Gemeinderat kandidiert. Vor der Stichwahl sprach sie sich für den CDU-Kandidaten Benjamin Schmidt aus. Im Hintergrund ist sie weiterhin aktiv und ihr Mann Joachim Schild-Schröder ist für die Linken neu in den Gemeinderat eingezogen, wo er nun neben Dryander das zweite verbleibende Fraktionsmitglied der Linken ist.

Quelle     :         Saarbrücker-Zeitung         >>>>>          weiterlesen 


Grafikquellen        :

Oben       —        Neujahrsempfang DIE LINKE. Birgit Huonker und Oskar Lafontaine


Unten      —        Rechte Tasche – linke Tasche – übrig blieb die leere Flasche /  Screenshot  YOUTUBE

Abgelegt unter Kommunalpolitik, P. DIE LINKE, Positionen, Saarland | 7 Kommentare »

Die Linke in Riegelsberg

Erstellt von DL-Redaktion am 14. August 2019

Eklat im Riegelsberger Gemeinderat

Jetzt geht die Nächste ?

Von Monika Jungfleisch

Petra Brück von der Linken tritt noch in der ersten Sitzung des Gemeinderats aus ihrer Fraktion aus. Ihre Parteigenossen reagieren auf die Entscheidung mit Unverständnis.

Mit einem Paukenschlag endete am Montag die konstituierende Sitzung des Gemeinderates Riegelsberg. Petra Brück, die für „Die Linke“ neu in den Rat gewählt worden war, trat noch in der Sitzung aus der Fraktion aus.

Zuvor hatte die 64-Jährige, vor der Wahl des 2. Beigeordneten, eine Erklärung abgegeben: Sie plädierte, entgegen der anderen Linken, für Dominik Blaes von der SPD als 2. Beigeordneten. „Dies entspricht meinem Demokratieverständnis und auch dem Wählerwillen. Die zwei stärksten Fraktionen sollten den ersten und zweiten Beigeordneten stellen.“ Dies hätten auch vor fünf Jahren die damalige Linken-Fraktionsvorsitzende Birgit Huonker sowie das Grünen-Ratsmitglied Stephan Lehberger zu Protokoll gegeben. Ihre Unterstützung für den SPD-Kandidaten nützte jedoch nichts, denn der Linken-Kandidat, ihr (Ex-)Fraktionskollege Ludwig Dryander, gewann die Wahl mit 17 zu 14  und einer ungültigen Stimme (Sitzverteilung: CDU 13 Sitze, SPD 10, Bündnis 90/Die Grünen 4, Die Linke 3, AFD 2, FDP 1 (fehlte wegen Urlaub).


Und Mama Hu ? Sie macht das rechte Auge auf und zu !

Bautzen Großwelka - Sauriergarten - Homo erectus 03 ies.jpg

Die sucht nun bei den ALTEN Ruhm ?

Schon im Zuge der Bürgermeisterwahl im Mai war das enge Verhältnis der Linken-Bürgermeisterkandidatin Birgit Huonker mit der CDU auffallend. Nach ihrer Niederlage im ersten Wahlgang, knapp hinter dem zweitplatzierten CDU-Kandidaten, hatte sich Huonker für den CDU-Herausforderer Benjamin Schmidt stark gemacht – was vielen in den eigenen Parteireihen missfiel. Auch in den Verhandlungen nach den Gemeinderatswahlen bestimmte sie die Gespräche zwischen den im Rat vertretenen Parteien.

Quelle        :         Saarbrücker-Zeitung           >>>>>          weiterlesen


Grafikquellen       :

Oben     —          Screenshot DL /  privat –  Saarbrücker-Zeitung – Foto: Becker&Bredel


 2.) von Oben      —       Neujahrsempfang DIE LINKE. Birgit Huonker und Oskar Lafontaine


Unten         —      Jagdszene: Homo erectus im alten Teil („Sauriergarten Großwelka“) des Saurierparks in Bautzen-Kleinwelka

Abgelegt unter Kommunalpolitik, P. DIE LINKE, Saarland, Überregional | 68 Kommentare »

Diskussion um Einschulung

Erstellt von DL-Redaktion am 12. August 2019

Alle mit dabei


Von Ralf Pauli

Sollten Kinder mit mangelnden Deutschkenntnissen erst später in die Grundschule? Was ErzieherInnen und LehrerInnen von der Debatte halten.

 Wenn an diesem Samstag 73 neue Erstklässlerinnen und Erstklässler an der Möwensee-Grundschule im Norden Berlins eingeschult werden, hat Manuel Honisch sie im Kopf schon sortiert. Nach Kindern, die keine Reime erkennen. Nach Jungen, die ihren Namen falsch schreiben. Nach Mädchen, die Sätze unvollständig formulieren.

Die ganze Woche über haben der Sonderpä­da­goge und andere Lehrkräfte der Schule die Kinder einzeln für je eine Stunde getestet: auf Motorik, auf Konzentrationsfähigkeit und Zahlenverständnis – und eben auf Deutschkenntnisse. In den kommenden Wochen folgen noch Tests in der Kleingruppe und der gesamten Klasse. Doch schon jetzt ist sich Honisch sicher: „Mehr als die Hälfte hat Sprachförderbedarf“.

Zum Beweis hat Honisch – kurze Hose, Ohrringe, pinkes Hemd – einen Stapel weißer Hefte mit ins „Förderzimmer“ gebracht. Dieser Raum ist das Reich der beiden SonderpädagogInnen an der Möwensee-Grundschule. Hier treffen sie sich nachmittags mit ihren Sprachfördergruppen oder dem „Matheclub“, hier sind Honisch und seine Kollegin Anna Brinkmann nun verabredet, um die Tests der neuen ErstklässlerInnen zu sichten und Lernziele für die Förderbedürftigen zu formulieren.

Für viele wird die Empfehlung lauten, das „phonologische Bewusstsein“ zu trainieren, dafür reichen Brinkmann und Honisch nur wenige Blicke auf die Sprachübungen. Manche werden vielleicht ein richtiges Sprachtraining benötigen. Das könne man aber erst nach Ende aller Tests mit Sicherheit sagen.

Was Honisch und Brinkmann aber jetzt schon wissen: Sie werden mit ihren beiden Teilzeitstellen nur die Kinder mit „intensiven Förderbedarf“ betreuen können. Im letzten Schuljahr waren das 40 Erst- und ZweitklässlerInnen, fast jedeR Dritte. Durch die Neuen, schätzen Honisch und Brinkmann, dürften 20 weitere Kinder hinzukommen, die dem Unterricht vermutlich nur schwer folgen können.

Keine Ahnung

Es ist keine neue Debatte, die in dieser Woche hochgekocht ist. Wie Schulen mit diesen Kindern umgehen sollen, darüber wird in Deutschland seit den 70ern leidenschaftlich gestritten. Jedes Bundesland hat seine eigene Antwort darauf gefunden, ob und wie lange SchülerInnen verschiedener Niveaus zusammen lernen sollen.

Seitdem die schleswig-holsteinische Bildungsministerin Ute Erdsiek-Rave (SPD) 2005 jedoch als Erste das gegliederte Schulsystem aus Hauptschule, Realschule und Gymnasium zugunsten einer Gemeinschaftsschule aufbrach, vertiefen sich die ideologischen Gräben wieder: zwischen den Verfechtern des getrennten Lernens, die um die Unterrichtsqualität fürchten – und den Befürwortern des integrativen Lernens, die darin den Schlüssel zu mehr Bildungsgleichheit für alle sozialen Schichten sehen.

Selten wurde das so eindrucksvoll sichtbar wie diese Woche, als der CDU-Haushaltspolitiker und Fraktionsvize Carsten Linnemann der Rheinischen Post ein Interview gegeben hat. Darin hatte er vor „neuen Parallelgesellschaften“ gewarnt und gefordert, Kinder ohne ausreichende Deutschkenntnisse nicht einzuschulen. Zu seinen Äußerungen erhielt Linnemann Zustimmung, aber es gab auch viel Kritik.

Vom Thema keine Ahnung

„Man sieht, dass der Mann von dem Thema keine Ahnung hat“, sagt Sonderpädagoge Honisch. An seiner Schule sei der Sprachstand sehr niedrig und der Anteil der SchülerInnen mit Migrationshintergrund sehr hoch, 70 Prozent. Nichts Ungewöhnliches im Stadtteil Wedding. Honisch warnt aber vor falschen Rückschlüssen. Die Sprachdefizite der SchülerInnen hätten vor allem mit der sozialen Schicht und dem Mangel an Lernunterstützung durch Eltern zu tun.

„Wir haben ausländische Kinder aus Syrien oder Russland, die ohne ein Wort Deutsch an die Schule kommen und in erstaunlich kurzer Zeit dem Unterricht folgen können. Und wir haben deutsche Kinder, die mit erheblichem Förderbedarf an die Schule kommen und später die Schule abbrechen.“ Honisch ärgert sich vor allem über Linnemanns Alternative zur Einschulung: eine verpflichtende Vorschule für alle Kindern, die kaum Deutsch sprechen. „Wie sollen die Kinder Deutsch lernen, wenn sie keine Sprachvorbilder um sich herum haben?“

Tatsächlich ist diese Praxis längst verbreitet, in Hessen beispielsweise. Allerdings ist die Teilnahme an den Vorlaufkursen dort freiwillig. Der Berliner Senat hingegen hat vor Jahren die Vorschulklassen abgeschafft und stattdessen eine flexible Schuleingangsphase eingeführt. An der Möwensee-Grundschule lernen Erst- und ZweitklässlerInnen zusammen; wer nicht weit genug ist, bleibt noch ein drittes Jahr.

Carsten Linnemann CDU Parteitag 2014 by Olaf Kosinsky-1.jpg

Ein  Hinterbänkler aus der CDU, Carsten Linnemann –  eine Niete in Nadelstreifen

Zwar hat die Berliner SPD zuletzt ins Spiel gebracht, das letzte Kitajahr vor der Schule zur Pflicht zu machen, um auch die letzten 5 bis 7 Prozent Abstinenzler an die Kitas zu bringen. Auf taz-Anfrage äußert sich der Berliner Senat aber ablehnend zu den Vorschlägen Linnemanns: „Natürlich ist es wünschenswert, dass Kinder vor der Einschulung Deutsch lernen und so gut in die Schule starten können.“ Das aber sei kein Grund, Kinder, die nicht gut Deutsch können, länger von der Schule auszuschließen.

Stattdessen setzt Berlin wie fast alle anderen Bundesländer auf frühzeitige Sprachförderung schon im Kita-Alter. Acht Bundesländer testen sämtliche Kinder mit vier oder fünf Jahren, also bis zu zwei Jahre vor dem Schuleintritt. Woanders werden nur nichtdeutsche Kinder getestet (Bayern), oder solche, die keine Kita besuchen (Nordrhein-Westfalen). In Hessen ist der Test freiwillig. Nur Schleswig-Holstein und Thüringen prüfendie Deutschkenntnisse gar nicht.

Quelle       :         TAZ           >>>>>          weiterlesen


Grafikquellen         :

Oben       —         Schultafel gesehen am Ersten Schultag. Veröffentlicht in: Münchner 09/1998, Seite 22

Abgelegt unter Bundestag, Nordrhein-Westfalen, P.CDU / CSU, Wirtschaftpolitik | Keine Kommentare »

Tönnies muss weg !

Erstellt von DL-Redaktion am 8. August 2019

Neues vom Lügenleser

2018-08-17 1. FC Schweinfurt 05 vs. FC Schalke 04 (DFB-Pokal) by Sandro Halank–059.jpg

Kolumne von Juri Sternburg

Menschen lügen, manchmal aus Selbstschutz. Andere wie Schalke-Chef Tönnies tun es wissentlich und offenbaren dabei ein menschenfeindliches Weltbild.

Menschen machen Fehler, na klar. Man sagt ab und zu Dinge, die man nicht so meint. Eine kurze Entschuldigung, mein Fehler. Zumindest wenn man ein wenig Respekt für den Gegenüber mitbringt. Schwamm drüber.

Auch Menschen in Führungspositionen machen Fehler. Da sei ihnen was rausgerutscht, heißt es oft. Meist lügen sie jedoch einfach frech. „Ich habe noch keinen einzigen Sklaven in Katar gesehen“, erklärte Franz Beckenbauer 2013, als es um die Stadionbauten in Katar ging. Solch vermeintliche Unwissenheit ist keine Seltenheit

VW-Chef Herbert Diess etwa erklärte jüngst gegenüber der BBC, dass ihm die Arbeits- und Umerziehungslager für circa 1,5 Millionen muslimische Uiguren in der chinesischen Provinz Xinjiang nicht bekannt seien. Genau in dieser Provinz betreibt VW jedoch ein Werk. Diese Art von Lügen dient dem Selbstschutz. Das ist ja wenigstens menschlich, möchte man sagen, wenn auch falsch.

Anders sieht es aus, wenn jemand nicht nur wissentlich lügt, sondern ein menschenfeindliches Weltbild offenbart. Nicht als Ausrutscher, sondern in einer vorbereiteten Rede. So wie jetzt im Fall von Schalkes Aufsichtsratsvorsitzendem Clemens Tönnies.

File:2010-06-03 Arena AufSchalke 20.jpg

Der Sportfunktionär hatte bei einer Veranstaltung als Reaktion auf den Klimawandel gefordert, man müsse zwanzig Kraftwerke in Afrika finanzieren, anstatt höhere Steuern einzuführen. „Dann würden die Afrikaner aufhören, Bäume zu fällen, und sie hören auf, wenn es dunkel ist, Kinder zu produzieren.“ Laut dem anwesenden Reporter erntete Tönnies dafür Applaus.

Quelle      :           TAZ        >>>>>             weiterlesen


Grafikquellen      :

Oben       —         DFB-Pokal 2018/19, 1. Hauptrunde: 1. FC Schweinfurt 05 gegen FC Schalke 04 0:2 (0:1)

No Facebook.svg This file has been released under a license that is incompatible with the license terms of Facebook. Thus it is not allowed to upload this file on Facebook. The use of this file on Facebook is a Copyfraud and copyright infringement.
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.

Abgelegt unter Feuilleton, International, Nordrhein-Westfalen | Keine Kommentare »

Radschnellweg Ruhrgebiet

Erstellt von DL-Redaktion am 7. August 2019

Eine Fahrradautobahn mitten durchs Ruhrgebiet 

MH-Radschnellweg RS1 Bahnbrücke.jpg

Von Andreas Wyputta

Ausgebremst – „der  schöner Wunschzettel“, sagt eine Planerin. Warum sich der Bau des Radschnellwegs Ruhr verzögert.

Holger Kesting sitzt in seinem Eiscafé „Radmosphäre“ und wartet auf Gäste. Direkt vor seiner Tür liegt der „Radschnellweg Ruhr“, aber besonders viele Radler*innen sind an diesem Tag nicht unterwegs. „Ich bin mit falschen Versprechen hergelockt worden“, sagt der 49-Jährige.

Mitten im sozialen Brennpunkt Essen-Altendorf hat die Stadt investiert: Alte Zeilenbauten wurden abgerissen, der Niederfeldsee künstlich angelegt. Hier liegt Kestings Eisdiele in einem schicken Neubau. „Trotzdem fehlt mir die Kundschaft, sagt er. „Der Radweg ist doch nur ein kurzes Teilstück – eine Sackgasse.“

Seit 2010, als das ganze Ruhrgebiet Kulturhauptstadt war, träumt die Region von diesem „rs1“ genannten Radschnellweg durchs Revier – dem ersten in ganz Nordrhein-Westfalen. Die bestbesuchte Veranstaltung damals war das Projekt „Still-Leben“ gewesen. An einem Julisonntag wurde die Autobahn 40 für Autos einfach dicht gemacht.

Radschnellweg RS1.png

In Richtung Dortmund waren Hunderttausende auf Fahrrädern unterwegs – und konnten erfahren, wie viel Raum und Vorrang Blechlawinen sonst eingeräumt wird. Die A40 verbindet die Städte Duisburg, Essen, Bochum und Dortmund auf kürzestem Weg. Wer wollte, konnte plötzlich in 60 Minuten von Bochum nach Mülheim radeln, Benutzung des Ruhrschnellweg-Tunnels in Essen inklusive.

101 Kilometer lang

„Wir haben gedacht: So etwas brauchen wir immer – eine Fahrradautobahn mitten durchs Revier“, erzählt Martin Tönnes, Chefplaner im Team des Regionalverbands Ruhrgebiet (RVR). Der RVR versucht seit Jahrzehnten, die 53 Städte zu einer „Metropole Ruhr“ zusammenzubringen. 2012 gab es eine erste Förderzusage für den rs1, 2014 bestätigte eine Studie die Machbarkeit. Kernaussage: Schon 2020 könne der 101 Kilometer lange rs1 fertig sein.

Doch ein Jahr vor dem anvisierten Fertigstellungstermin existiert nur eine 13 Kilometer lange Vorzeigestrecke zwischen Essen und Mülheim, an der auch die „Radmosphäre“ des Gastronomen Kesting liegt. Aber Radschnellweg-Standard – also Asphalt, vier Meter breite, getrennte und markierte Fahrbahnen, Beleuchtung, Winterdienst, kombiniert mit einem abgetrennten, zwei Meter breiten Fußweg – gibt es nur auf einem im Mai eröffneten 1,2 Kilometer kurzen Teilstückchen.

Schon die Modellstrecke zeigt allerdings, wie wichtig gut ausgebaute Radwege für die Verkehrswende sind: Wer will, kann erhaben über die Trasse der teilweise stillgelegten Rheinischen Bahn radeln. Auf dem alten, nicht mehr genutzten Bahndamm läuft der rs1 vom Essener Universitätsviertel Richtung Westen frei von lautem, stinkenden Autoverkehr mehrere Meter über der Stadt. Und in Richtung der Mülheimer Hochschule Ruhr West wird es hinter Kestings „Radmosphäre“ richtig grün.

Auf weiten Teilen der Strecke aber fehlt noch der Asphalt. Gefahren wird auf „wassergebundener Decke“ – also kleingemahlenem, gewalztem Schotter, der im Sommer staubt und im Winter matschig ist. Auch von der Beleuchtung ist noch nicht viel zu sehen. Immerhin: 2021 soll ein „Upgrade“ auf Radschnellweg-Standard folgen. „Der rs1 ist eines der wenigen Infrastrukturprojekte, gegen das nicht protestiert wird“, freut sich RVR-Planungschef Tönnes. „Stattdessen fragen die Leute: Wann geht’s endlich weiter?“

Endet abrupt im Nichts

Denn tote Gleise gibt es auch westlich in Richtung Duisburg und östlich in Richtung Bochum. Trotzdem ist in Essen in unmittelbarer Nähe der Uni, an der vierspurigen, vielbefahrenen Gladbecker Straße, Schluss. Die alte, noch zugewachsene Bahntrasse endet an einer meterhohen Mauer. Der Radweg läuft verschwenkt noch ein paar hundert Meter weiter durch das ab 2010 neu entstandene Universitätsviertel bis zum Viehofer Platz – und endet auch dort im Nichts.

„Hallo, wo geht’s denn hier weiter“, fragt Wilfried Uck. Der 68-Jährige aus Mülheim nutzt den Sommertag für eine Radtour – und ist nach 13 Kilometern in der Betonwüste am Viehofer Platz gestrandet. „Absolut enttäuscht“ ist er, als er hört, dass er hier nur unter allergrößten Schwierigkeiten in Richtung Bochum weiterkommt. Zwar hat die Stadtverwaltung eine Radstrecke zum Weltkulturerbe Zeche Zollverein ausgeschildert – von dort geht es schon heute weiter auf einem durchgehend asphaltierten Radweg bis fast in die Bochumer Innenstadt.

RS1 Radschnellweg Ruhr in Mülheim 1.jpg

Doch von dem bequemen, sicheren, autofreien und nicht zu verfehlenden Damm der Rheinischen Bahn ist bis Zollverein nichts zu sehen. Stattdessen schlägt die Stadt einen Schleichweg vor, der von Nichteingeweihten kaum zu finden ist. Zweimal müssen vier- bis sechsspurige Ausfallstraßen überquert werden, danach geht es über schmale, mit Schlaglöchern überzogene Wege durch Kleingartenanlagen Richtung Zollverein. Es ist, als wolle Essen Radler*innen um jeden Preis klarmachen: Du bist nichts – und der motorisierte Verkehr alles.

Quelle         :       TAZ           >>>>>            weiterlesen


Grafikquellen         :

Oben     —     2019 – Radschnellweg RS1 an der Alten Bahnbrücke / Stadtviadukt in Mülheim an der Ruhr.


2. ) von Oben       —   Radschnellweg RS1

Abgelegt unter Energiepolitik, Kommunalpolitik, Nordrhein-Westfalen, Sozialpolitik | Keine Kommentare »

Freitag, der 13.

Erstellt von DL-Redaktion am 7. August 2019

Das System Tönnies stoppen!

File:Toennies Fleisch.jpg

Quelle        :         Scharf  –  Links

Von Bündnis gegen die Tönnies-Erweiterung

Bundesweite Aktionen gegen Tönnies, zentrale Demonstration in Rheda-Wiedenbrück.

Kurz nachdem die aktion./.arbeitsunrecht bekannt gab, dass Tönnies zur Zielscheibe des Aktionstags am 13. September 2019 wird, demontierte sich der „König der Schweine“ selbst. Vor der Kreishandwerkerschaft Paderborn-Lippe vertrat er offen rassistische Positionen und machte dadurch deutlich, wie eng Rassismus, Kapitalismus und damit die Ausbeutung von Mensch, Tier und Natur zusammenhängen. Die aktion gegen arbeitsunrecht und das Bündnis gegen die Tönnies-Erweiterung organisieren die Kampagne für den Schwarzen Freitag gemeinsam.

Campaignerin Jessica Reisner erläutert die Strategie: „Es gilt den Konzern dort zu treffen, wo es weh tut. Das sind Supermarkt-Regale und Stadion-Imbisse. Wir wollen Kunden, Einzelhändler und Fußball-Clubs animieren, auf Tönnies-Produkte zu verzichten. Tönnies skrupellos produziertes Billig-Fleisch steckt hinter den Aldi-Marken Tillman‘s und Landdiele. Ihm gehören die Marken Böklunder, Gutfried, Hareico, Redlefsen und weitere Marken der Zur Mühlen Gruppe

Für das Bündnis gegen die Tönnies-Erweiterung ergänzt Camila Cirlini: „Die zentrale Kundgebung findet in Rheda-Wiedenbrück statt. Auftakt ist um 15 Uhr am Bahnhof. Regionale Vorbereitungstreffen und erste Aktionen sind bereits in zahlreichen anderen Städten angekündigt. Gewerkschaften, Umwelt- und Tierrechtsverbände, Bürgerinitiativen, antifaschistische Gruppen und aktive Fußballfans sind aufgefordert, die Aktionen zu unterstützen.“

Michael Pusch vom Bündnis gegen die Tönnies-Erweiterung verweist auf die Auswirkungen der Fleischindustrie auf das Klima: „Eine Woche nach unserem Aktionstag beginnt der globale Streik für Klimagerechtigkeit. Die industrielle Fleischproduktion gehört zu den Hauptverursachern der Klimakatstrophe. Der Kampf für Klimagerechtigkeit lässt sich also nicht vom Kampf gegen die skrupellose Ausbeutung von Menschen und gegen die grausamen Qualen der Tiere trennen.“

Weitere Infos:

Twitter-Hashtag: #Fr13Toennies

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen      :

Oben      —         Rheda-Wiedenbrück, Tönnies Fleischwerk im Stadtteil Rheda. Aufgenommen am 14. Januar 2006 von Daidalus.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.


Unten        —          Camila Cirlini (l.) und Michael Pusch (r.) vom Bündnis gegen die Tönnies-Erweiterung mit Elmar Wigand, Pressesprecher der aktion ./. arbeitsunrecht; Foto: privat

entnommen :  Scharf –  Links

Abgelegt unter APO, Arbeitspolitik, Medien, Nordrhein-Westfalen | Keine Kommentare »

Besetztes Haus in Köln

Erstellt von DL-Redaktion am 1. August 2019

DB schmeißt obdachlose Frauen raus

Alte Wagenfabrik Scheele, Vogelsanger Straße 321, Köln-9639.jpg

Aus Köln Anett Selle

Kölner*innen hatten für obdachlose Frauen ein leerstehendes Haus der Deutschen Bahn besetzt – und sie wollten es kaufen. Nun wurde es geräumt.

 „Meine Söhne wissen noch nicht, dass ich Hausbesetzerin geworden bin“, sagt die 79-jährige Erika Henning. Sie sitzt auf einer Kunstledercouch und räufelt ihren Rocksaum von den Knien auf die Oberschenkel. Draußen sind 35 Grad und durch die offenen Fenster kommt keine Brise. Vor der Couch steht ein Holztisch mit Kerzenständer, daneben eine alte Schirmlampe. Das Bett ist eine Matratze in der Ecke.

Sie schaut sich im Zimmer um und lächelt mit Zahnlücken. „Es ist ein so schönes Haus. Hohe Decken. Laminat – das ist vom Saubermachen her leicht. Fließendes Wasser. Toilettenspülung. Ich kann eine Tür zumachen und meinen Körper ausruhen. Alles ist so schön.“ Das war vor einer Woche.

Henning gehörte zu einer Gruppe obdachloser Frauen – die meisten über 70 –, die in Köln anderthalb Wochen lang in einem vormals leerstehenden Haus lebten. An diesem Mittwoch hat die Polizei das Haus geräumt, auf Drängen des Eigentümers, der Deutschen Bahn.

Das Haus steht in Köln-Ehrenfeld, Vogelsanger Straße 230. Die „Elster“, wie die Frauen es nannten, hat zwei Obergeschosse und einen Keller, Strom und Heizung, Gas und fließendes Wasser. Seit Jahren steht es leer. Bis am 19. Juli eine Gruppe von Kölner*innen das Haus besetzte.

Nicht an die Besetzer*innen verkaufen

Die Besetzer*innen sind lose organisiert, einige gehören zum Autonomen Zentrum Köln oder zur sozialistischen Selbsthilfe Mülheim, andere zu einer Gruppe, die sich Frauen der 1006 nennt. Es sind obdachlose Frauen, die in der Vergangenheit – angefangen bei der Bergisch-Gladbacher Straße 1006 – selbst Häuser besetzten. Auch das Haus in der Vogelsanger Straße soll anderen obdachlosen Frauen zur Verfügung stehen. Der Plan ist, das Haus von der Bahn zu kaufen.

Doch die Bahn, genauer ihre Tochter DB Immobilien, will das Haus zwar verkaufen, aber nicht an die Besetzer*innen und ihre Unterstützer*innen.

Aus aktuellen Statistiken der Landesregierung geht hervor, dass die Obdachlosigkeit in Nordrhein-Westfalen binnen eines Jahres um fast 40 Prozent gestiegen ist. „Wohnungslosigkeit ist nach Hunger das schlimmste Zeichen von Armut“, sagte Sozialminister Karl-Josef Laumann (CDU). In Köln bauen Bürger*innen für obdachlose Mitmenschen inzwischen Wohnkästen aus Spanplatten. Die Stadt Köln hat rund 6.000 Menschen als wohnungslos erfasst. Die tatsächliche Zahl dürfte höher liegen. Nach Angaben der Stadt ist vor allem die Zahl der wohnungslosen Frauen gestiegen.

42 Jahre lang hat Erika Henning gearbeitet und alleinerziehend drei Söhne großgezogen. Ihr ältester Enkel ist 27 Jahre alt und studiert in Weimar. Zweimal hat sie Krebs überlebt. Dann keine Wohnung gefunden, trotz Rente. Mit 77 wurde sie obdachlos. In den zwei Jahren ihrer Obdachlosigkeit hat Erika Henning in Bahnhöfen geschlafen. Mehrfach sei sie bestohlen und geschlagen worden, auch in Notunterkünften. „Ich bin 1940 geboren: Ich musste mich immer durchbeißen“, meint sie nur.

„Wir helfen uns gegenseitig, das war die Idee“, sagt eine 22-jährige Kölnerin, die die obdachlosen Frauen schon länger unterstützt. Sie nennt sich Sascha Fink und war eine von vielen Unterstützer*innen, die Betten und Matratzen organisierten, Lebensmittel heranschafften und sich um Verhandlungen mit der Deutschen Bahn bemühten.

Oben Wohnen, unten Beratung

„Frauen, die obdachlos waren oder sind, sprechen andere Frauen an und helfen“, erläutert Fink die Idee für die neue Nutzung der Vogelsanger 230. „Wenn du eine wohnungslose Frau bist, konntest du einziehen.“ Ziel war es, in der „Elster“ ein feministisches soziales Zentrum zu schaffen. Oben Wohnen, unten Platz für Frauenberatungsstellen. Zwei Kölner Initiativen, denen gerade die Räume gekündigt wurden, sollten mit einziehen.

Quelle      :      TAZ        >>>>>        weiterlesen


Grafikquelle        :      File:Alte Wagenfabrik Scheele, Vogelsanger Straße 321, Köln-9639.jpg

Alte Wagenfabrik Scheele

Abgelegt unter Deutschland, Köln, Nordrhein-Westfalen, Schicksale | Keine Kommentare »

DIE LINKE als Arzt –

Erstellt von DL-Redaktion am 25. Juli 2019

 am Krankenbett des kapitalistischen Systems?

Flag of Die Linke

Politiker ohne Dreck am Stecken zeigen ein Gesicht ?

Quelle      :      Scharf  –  Links

von Jürgen Aust *

Als die Mitglieder der Bremer LINKEN auf ihrem Sonder-Parteitag nach einer kurzen Debatte über den mit SPD und Grünen ausgehandelten Koalitionsvertrag abstimmten, kam aufgrund des Abstimmungsergebnisses eine nahezu euphorische Stimmung auf: die Delegierten hatten mit 71% dem Koalitionsvertrag zugestimmt und damit die Tür für eine erste „rot-grün-rote“ Landesregierung im Westen weit aufgestoßen. Diese Entscheidung wurde nunmehr auch durch einen Mitgliederentscheid bestätigt, der zwar mit einer Zustimmung von 78,5 % relativ deutlich ausfiel. Allerdings waren von 620  Mitgliedern nur 580 Mitglieder stimmberechtigt, weil 40 Briefe wegen veralteter Adressen nicht zugestellt werden konnten. Beteiligt hatten sich an der Abstimmung dann 349 Mitglieder, von denen 266 für den Koalitionsvertrag stimmten, während 67 und somit 19,8 % dagegen votierten. Setzt man die 266 Ja-Stimmen ins Verhältnis zu den 580 stimmberechtigten Mitgliedern, dann relativiert sich das Abstimmungsergebnis mit lediglich 46 % doch ziemlich deutlich.

Im Vorfeld der Bremer Wahl stimmte die Bremer Spitzenkandidatin, Christina Vogt, die Partei bereits auf eine neue Regierungskoalition mit den Worten ein: „Wir haben ein hohes Interesse an einer progressiven Regierung. Wir bereiten uns ernsthaft darauf vor und sind bereit, Verantwortung zu übernehmen. Bremen ist eine Folie für die gesamte Bundesrepublik.“ Und der Parteivorsitzende Bernd Riexinger erklärte bereits unmittelbar vor der Wahl: „Ich erwarte, dass wir zum ersten Mal in einem westlichen Bundesland in eine linke Regierung eintreten.“

Zu den politischen und ökonomischen Ausgangsbedingungen

Bremen gehört seit vielen Jahren zu den Bundesländern, in denen Armut und Arbeitslosigkeit auf Rekordniveau liegen. Nach dem aktuellen Arbeitsmarktbericht (Juni 2019) liegt Bremen bei der Arbeitslosigkeit im Vergleich mit allen anderen Bundesländern prozentual auf dem letzten Platz. Im Wahlprogramm der Bremer LINKEN heißt es u.a., dass Bremen das Bundesland mit der „höchsten Kinderarmut“ sei. Gleichzeitig habe Bremen aber bundesweit mit ca. 10.000 Millionär*innen prozentual die höchste Zahl an Einkommens- bzw. Vermögensmillionären.

Bremen hat seit 2011 unter einer grünen Finanzsenatorin einen harten Spar- und Konsolidierungskurs hinter sich. Ein auf Bundesebene eingerichteter „Stabilitätsrat“ hatte, vergleichbar mit dem Kurs der Troika in Griechenland, Bremen eine „Verwaltungsvereinbarung“ aufoktroyiert, die eine umfangreiche Liste von Sparmaßnahmen vor allem im Personal- und Sozialbereich enthielt. Im Gegenzug erhielt Bremen eine jährliche Konsolidierungshilfe von 300 Mio. €, um das eigentliche Ziel dieser Rotstiftpolitik zu erreichen, nämlich 2020 unter Einhaltung der Schuldenbremse keine neuen Schulden mehr machen zu müssen. Dieser Sparkurs war u.a. damit verbunden, dass Bremen einen jährlichen Sanierungsbericht vorlegen musste, der einen Katalog von Grausamkeiten enthielt: allein in 2019 soll danach ein Einsparvolumen von 538 Mio. € und in 2020 ein solches von 476 Mio. € generiert werden. Dass mit diesem Austeritätskurs alles andere als eine fortschrittliche Wirtschafts- und Sozialpolitik realisiert werden kann, dürfte auf der Hand liegen.

Zur sozialen Lage in Bremen

In Bremen liegt die Hartz IV-Quote seit vielen Jahren deutschlandweit prozentual an der Spitze aller Bundesländer. Aktuell sind in Bremen 72.386 Hartz IV-Bezieher*innen im Alter von 15 – 64 Jahren und 31.197 Kinder und Jugendliche von 0 – 14 Jahren, also insgesamt ca. 103.500 Menschen im Hartz IV-Bezug registriert, was angesichts von ca. 585.000 Einwohnern ein ungewöhnlich hohes Ausmaß von armutsbetroffenen Menschen darstellt. Diese Armutsverhältnisse kommen insbesondere auch auf dem Wohnungsmarkt zum Ausdruck. Hatte das Land Bremen in den 90er Jahren noch ca. 79.000 Sozialwohnungen, führte der Niedergang des Sozialen Wohnungsbaus dazu, dass der Bestand an Sozialwohnungen bis 2017 auf lediglich ca. 8.300 Sozialwohnungen zusammengeschmolzen war. Parellel zu dieser Entwicklung haben die Mietpreise sich nahezu explosionsartig in den letzten Jahren nach oben entwickelt. Allein in den letzten 10 Jahren sind die Mieten im Land Bremen um 32% (!) gestiegen, während die sog. Angebotsmieten von 2004 bis 2018 sogar ein Plus von 43,2% zu verzeichnen haben.  Für Menschen bzw. Haushalte mit geringem Einkommen ist es deshalb immer schwieriger, eine für sie bezahlbare Wohnung zu finden, während die Mietbelastungsquote für rund ein Viertel alle Haushalte bei 40% und mehr liegt. Ein im Auftrag der Sozialsenatorin erstelltes Gutachten kam zum Ergebnis, dass 41% aller Haushalte einen erhöhten Bedarf nach bezahlbarem Wohnraum haben, was allein in der Stadt Bremen ca. 123.000 (!) Haushalten entspricht.

Das Wahlprogramm und was daraus geworden ist

Das Wahlprogramm der Bremer LINKEN „Wem gehört die Stadt?“ hatte die Latte für einen möglichen Regierungswechsel relativ hoch gehängt. Es finden sich sogar unter der Überschrift „Alternativen zum Kapitalismus stützen und stärken“ Aussagen wie: „Eine entscheidende Frage gesellschaftlicher Veränderung ist und bleibt die Frage des Privateigentums am Produktionskapital. Eine soziale, friedliche, umweltgerechte, demokratische Gesellschaft erfordert, dass die ökonomische Macht derer, die an Armut, Ausbeutung, Naturzerstörung, profitorientiertem Wachstum, Rüstung und Kriegen verdienen, zurückgedrängt und überwunden wird.“ Realer Anspruch oder doch eher Symbolpolitik?

Um feststellen zu können, ob die Bremer LINKE zentrale Forderungen ihres Wahlprogramms einlösen konnte, sollen die Ergebnisse daran gemessen werden, was insbesondere bei dem, was die LINKE immer gerne mit linkem „Alleinstellungsmerkmal“ beschreibt, nämlich ihren  Forderungen zu Hartz IV, Arbeitslosigkeit und den mit dem Bereich „Soziale Gerechtigkeit“ zusammenhängenden Positionen, sich im Koalitionsvertrag wiederfindet. Um es vorweg zu nehmen: die Ergebnisse sind mehr als ernüchternd, was der langjährige Fraktionsvorsitzende der Bremer LINKEN, Peter Erlansson, in einem TAZ-Interview mit den Worten umschreibt: „Der Koalitionsvertrag ist noch schlimmer, als ich befürchtet habe.“

Im einzelnen:

I. Hartz IV

In ihrem Wahlprogramm erklärt die Bremer LINKE, dass das Modell Hartz IV arbeitsmarktlich gescheitert sei. Seine wesentlichen Bestandteile wie eine soziale Sicherung auf Armutsniveau, permanenter Druck, etc. „haben eine katastrophale Wirkung nicht nur auf die Betroffenen, sondern auch auf den Arbeitsmarkt.“ Deshalb formuliert sie weiter, dass „wir kämpfen für eine bundesweite vollständige Abschaffung aller Sanktionen.“ Sie fordert deshalb für Bremen eine „Zurückdrängung“ der Sanktionen und insbesondere im „Rahmen der Zusammenarbeit“ keine Sanktionen gegenüber Jugendlichen auszusprechen sowie das Ausschöpfen aller Ermessensspielräume, nicht auf Sanktionen zurückzugreifen.

Sie fordert außerdem, dass die Wohn- und Energiekosten (Strom, Wasser, Heizung) in tatsächlicher Höhe anerkannt werden müssen, um Zwangsumzüge durch Kostensenkungsverfahren auszuschließen. Außerdem fordert sie, das Absperren der Versorgung mit Strom, Gas und Wasser gesetzlich zu untersagen und durch Einrichtung eines Härtefallfonds in Bremen Energiesperren zu verhindern.

Schließlich will sie (Landes-) Programme für Zielgruppen einsetzen, die keine oder wenig Chancen auf Förderungen nach dem SGB II haben:  Alleinerziehende mit Kindern unter 3 Jahren, Aufstocker*innen, altere Beschäftigte und Erwerbslose, die bereits erfolgreich in geförderter Beschäftigung.

II. Arbeit in Bremen (Kap. Wirtschafts- und Strukturentwicklung)

Auch in diesem wesentlichen Politikfeld legt das Programm die Latte erfreulich hoch, wie beispielhaft diesen Themen zu entnehmen ist:

1) So will die LINKE den „Landesmindestlohn“ auf 12,63 € anheben, also auf eine Höhe, die nach 45 Erwerbsjahren in Vollzeit eine Rente oberhalb der Grundsicherung (aktuell 814 €) liegt. Damit will sie gleichzeitig ein deutliches Signal gegen den in Bremen ausufernden Niedriglohnsektor setzen.

2) Sie will die Ausweitung der Tariftreue nicht nur wir bisher im Bausektor, sondern auf alle öffentlichen Aufträge, also auch auf Dienstleistungen und Beschaffung ausweiten.

3)  Sie will, dass die öffentliche Hand in Bremen grundsätzlich auf Leiharbeit verzichtet (mehr als 4.600 Leiharbeiter*innen waren 2016 für den Senat beschäftigt).

4) Sie fordert weiterhin, dass das Bremische Personalvertretungsgesetz auch für alle Honorarkräfte, Lehrbeauftragte und vergleichbare Berufsgruppen ausgeweitet wird.

5)  Und sie fordert eine „Landesausbildungsumlage“, um dem Skandal den Boden zu entziehen, dass in Bremen jährlich 700 bis 1.000 Schüler*innen die Schule verlassen, ohne in eine weitere schulische oder berufliche Ausbildung zu gehen.

Der Koalitionsvertrag löst diese Vorgaben nicht annähernd ein

Es soll zunächst keinesfalls bestritten werden, dass die Bremer LINKE auf dem sozialpolitischen Terrain einige positive Akzente im Koalitionsvertrag setzen konnte. Statt vieler soll herausgestellt werden, dass die Situation der Alleinerziehenden auf dem Arbeitsmarkt nachhaltig verbessert werden soll, dass entschiedene Maßnahmen zur Veringerung der Kinderarmut ergriffen werden sollen, dass das Stadtticket für von Armut betroffene Menschen auf 25 € reduziert werden soll oder dass die Sozialwohnungsquote auf 30 % erhöht werden soll. Doch eine linke Regierungsbeteiligung sollte sich insbesondere daran messen lassen, was sie auf keinen Fall mittragen sollte, also ob sie ihre programmatischen Positionen bzw. die sog. roten Haltelinien nicht verwässert, sondern bewahren konnte.

1. Im Bereich Hartz IV und Armutsbekämpfung verlässt der Koalitionsvertrag leider nicht die neoliberale Hartz IV-Logik, sondern knüpft u.a. bei der Bekämpfung der Langzeitarbeitslosigkeit an den bisherigen neoliberal ausgerichteten Programmen LAZLO und PASS an, die die Vorgängerregierung von SPD und Grünen aufgelegt hatten. Diese Programme beruhten auf befristeten (geringfügig entlohnten) Arbeitsverhältnissen, waren grundsätzlich sanktionsbewehrt und hatten von ihrer zahlenmäßigen Dimension her allenfalls Placebo-Effekte. Der Koalitionsvertrag sieht bei ca. 20.000 Langzeitarbeitslosen in Bremen (Stand 30.06.2019) nicht mehr als 1.500 Beschäftigungsverhältnisse vor, was bei der Bekämpfung der Langzeitarbeitslosigkeit nur der bekannte Tropfen auf dem heißen Stein sein dürfte. Zumal ein wesentlicher Bestandteil dieses Programms das seit dem 01.01.2019 von der GroKo beschlossene „Teilhabechancengesetz“ ist, was nur die bereits seit sieben Jahren im Hartz IV-System arbeitslos registrierten Menschen erfasst und den größten Teil der Langzeitarbeitlosen im Regen stehen lässt.

2.  Eine der auf bundes- und Landesebene zentralen Forderungen zur Bekämpfung von Hartz IV, Ein-Euro-Jobs als eine moderne Form von Sklavenarbeit bedingslos abzuschaffen, sucht man im Koalitionsvertrag leider völlig vergeblich (und erstaunlicherweise auch im Wahlprogramm).

3. Die im Wahlprogramm als eine der Kernforderungen formulierte Forderung nach Bekämpfung der Sanktionen findet sich im Koalitionsvertrag lediglich als Absichtserklärung wieder, ohne dass die Koalitionsparteien sich auf eine entschiedene Absage an die Sanktionspolitik verständigt hätten. Es finden sich allenfalls moderate Positionen wieder, die eine Absenkung der Zahl der Sanktionen enthalten, insbesondere im Bereich der U 25-Jährigen.

4.  Auch die für eine glaubhafte Armutsbekämpfung im Wahlprogramm erhobene Forderung, bei Energiesperren einen Härtefonds einzurichten, sucht man im Koalitionsvertrag vergebens. Da Energiesperren eine besondere Form von sozialpolitischer Kannibalisierung darstellen, wird die neue Koalition in diesem Bereich offensichtlich die menschenunwürdige Politik der Vorgängerregierung fortsetzen.

5. Last but not least:  die für die Verelendung eines großen Teils der im Hartz IV-System erfassten Menschen (in Bremen und Bremerhaven beträgt die aktuelle Zahl ca. 103.500 Betroffene) ursächliche Nichtanerkennung der tatsächlichen Mietkosten findet sich entgegen den Forderungen im Wahlprogramm im Koalitionsvertrag mit keinem Wort wieder. Menschenverachtende Zwangsräumungen oder wachsende Verschuldung sind dadurch vorprogrammiert.

6. Im Bereich Beschäftigungs- und Wirtschaftsentwicklung legt die Bremer LINKE gemeinsam mit ihren Koalitionären ein Bekenntnis zur Förderung einer „starken Sozialpartnerschaft als Voraussetzung guter Arbeit“ ab, womit im Koalitionsvertrag bereits deutliche Weichen gestellt wurden, keine die Kapitalseite zu stark belastenden, also eher schonende Forderungen zu erheben. Deshalb sind wesentliche Positionen des Wahlprogramm in diesem für linke Politik wesentlichen Handlungsfeld nahezu ausgeblendet:

a) Der im Wahlprogramm mit 12,63 € geforderte Landesmindestlohn wird im Koalitionsvertrag auf 11,13 € abgeschmolzen mit einer Delegation an die Landesmindestlohnkommission, den Mindestlohn „zeitnah anzupassen.

b)  Zur notwendigen Enschränkung prekärer  Beschäftigung findet sich im Koalitionsvertrag zwar die Bereitschaft, auf sachgrundlose Befristungen auch weiterhin zu verzichten, allerdings sollen Befristungen mit Sachgrund lediglich auf ein Minimum reduziert werden. Was sich zunächst einmal positiv anhört, stellt jedoch in der Praxis das Haupteinfalltor für die ausufernde Befristungspraxis dar. Dies betrifft in Bremen insbesondere die Bereiche Universität, Schulen oder die Bremer Lagerhaus-Gesellschaft (BGL). Im gesamten Bereich der öffentlichen Hand sind über 4.600 Beschäftigte in Leiharbeit, so dass zu deren Austrocknung sicherlich andere Maßnahmen erforderlich sind, als die Zahl lediglich zu „minimieren“.

c) Ein nahezu dunkles Kapitel findet sich im Koalitionsvertrag unter der Überschrift „Mobile Beschäftigung, Migration und Integration“, wenn es dort u.a. heißt, dass „wir zur Verhinderung der missbräulichen Inanspruchnahme von Sozialleistungen die Zusammenarbeit der operativen Behörden (insbesondere Jobcenter, Agentur für Arbeit, Polizei, Zoll, Arbeitsschutz) fördern und ausweiten“ werden. Dies ist im Kern ein Teil der staatlichen Repressionspolitik à la Seehofer und es sollte sich für eine LINKE grundsätzlich verbieten, auf diesen Repressionszug aufzuspringen.

d)  Um Massenarbeitslosigkeit zu bekämpfen, bedarf es unter verschärften neoliberalen Verhältnissen unabdingbar eines groß dimensionierten öffentlichen Beschäftigungsprogramm, mit dem nicht nur Placebo-Effekte generiert werden, sondern das tatsächlich den Anspruch hat, Arbeitslosigkeit ernsthaft zu bekämpfen. In Bremen (einschließlich Bremerhaven) sind offiziell 38.042 Arbeitslose registriert, wodurch aber die tatsächliche Arbeitslosigkeit verharmlost wird. Einschließlich der in der Kategorie „Unterbeschäftigung“ erfassten Arbeitslosen liegt die Arbeitslosigkeit in Bremen bei 53.442 arbeitslosen Menschen, wovon 42.210 Personen länger als ein Jahr arbeitslos sind (Stand 30.06.2019). Der Koalitionsvertrag signalisiert nicht annähernd, wie man diesem Krebsübel des kapitalistischen Systems zu Leibe rücken will.

Bremen unter dem Diktat der Schuldenbremse

Mit dem Koalitionsvertrag hat DIE LINKE sich der sog. „Schuldenbremse“ unterworfen, wenn es dort im Kapitel „Finanzrahmen“ u.a. heißt: „Wir verpflichten uns, ab dem Jahr 2020 unsere Haushalte grundsätzlich ohne neue Kreditaufnahme aufzustellen, sowie es das Grundgesetz und unser Landesrecht in der Verfassung und im Ausführungsgesetz zur Schuldenbremse vorschreiben.“ Mit diesen Vorgaben akzeptiert die Bremer LINKE (wie bereits die LINKE in Berlin, Thüringen und Brandenburg) die wesentliche Säule neoliberaler Haushaltspolitik, die im Bereich der Staatsausgaben darauf ausgerichtet ist, ein Instrument zur Diskreditierung des Staates bzw. des öffentlichen Dienstes und zu einer marktradikalen Politik der Privatisierung und Deregulierung zu erhalten. Es herrscht eigentlich in der linken Diskussion bisher weitestgehend Einigkeit, dass eine Schuldenbremse mit dem Ziel der Senkung der Staatsausgaben ökonomischer und haushaltspolitische Schwachsinn ist, da sie dem Staat die Hände bindet, in notwendige gesellschaftliche Bereiche zu investieren und insbesondere den zunehmenden sozialen Verwerfungen entgegenzusteuern. Eine Linke, die sich diesem Diktat unterwirft, diskreditiert damit nahezu sämtliche in ihrem Wahlprogramm erhobenen Forderungen, da der Kampf gegen Armut und Massenarbeitslosigkeit mit nahezu strangulierten Haushalten nicht ansatzweise Erfolg haben kann. Und diese Selbstaufgabe hat die Bremer LINKE gewissermaßen im vorauseilenden Gehorsam im Koalitionsvertrag bereits unterzeichnet, wenn es im „Finanzrahmen“ weiter heißt: „In der Fortschreibung der Finanzplanung 2020 werden wir die folgenden jährlichen Steigerungsraten zur Grundlage machen: Personal 2,5 Prozent, Sozialausgaben 1,7 Prozent, Investitionsausgaben 2 Prozent und konsumtive Ausgaben 2,5 Prozent.“ Doch mit diesen minimalen Steigerungsraten, insbesondere im Sozialbereich, lässt sich nicht annähernd der immer wieder beschworene Politikwechsel erreichen, sondern der bisherige neoliberale Kurs wird mit hoher Wahrscheinlichkeit unter einer anderen Farbenkombination fortgesetzt.

Neoliberale Politik mit menschlicherem Antlitz

Vor diesem Hintergrund stellt sich für DIE LINKE einmal mehr die Frage, ob mit linker Regierungsbeteiligung in neoliberalen Zeiten überhaupt ein Richtungs- bzw. Politikwechsel möglich ist. Für einen Teil der Repräsentanten der LINKEN stellt sich das Problem seit vielen Jahren offensichtlich überhaupt nicht, da die grundsätzliche Orientierung auf eine Regierung mit linker Beteiligung perse bereits einen Politikwechsel beinhaltet. So der Fraktionsvorsitzende Dietmar Bartsch in seinem euphorischen Statement: „Das erste Mal Regierungsverantwortung im Westen rückt nahe. Die Bremer LINKE kann stolz sein, weil das ein bundespolitisches Signal ist.“  Er wurde umgehend von der Parteivorsitzenden Katja Kipping sekundiert: „Bremen kann ein Signal für den Bund werden. In einem Jahr wird die GroKo Geschichte sein. Wir wollen, dass die nächste Regierung eine progressive Politik macht.“  Und auch die kommentierende Linke signalisiert mit starken Worten: „Bremen: ein Herkulesprojekt für eine progressive Koalition,“  übertiteln die Redakteure des „SozialismusMagazin“, Joachim Bischoff und Bernhard Müller, ihren Beitrag zur Bremenwahl. Der Bremer Landessprecher, Felix Pithan, erklärt die kommende Entwicklung bereits vorwegnehmend: “ „Für mich ist der Koalitionsvertrag die Grundlage für einen Politikwechsel im Land Bremen.“ Und selbst Sahra Wagenknecht als Kritikerin des Kurses der Parteiführung stimmt in diesen Chor bereitwillig ein: „Nach Jahren wachsender Ungleichheit und hemmungsloser Bereicherung der oberen Zehntausend braucht Deutschland dringend eine Regierung, die sich um mehr sozialen Ausgleich bemüht. An einer solchen Regierung würde sich DIE LINKE auch im Bund beteiligen.“

Linke Repräsentant*innen, die im Vorfeld bereits derartige Vorschusslorbeeren verteilen, haben sich offensichtlich inzwischen von den Traditionslinien einer sozialistischen Linken, die den Kapitalismus überwinden will, weitestgehend verabschiedet. Denn ähnliche Entwicklungen gab es bereits Ende des 19. Jahrhunderts, als der Sozialist Millerand in das französische Kabinett eintrat und Rosa Luxemburg diesen „Verrat“ an der sozialistischen Sache massiv kritisierte: „In der bürgerlichen Gesellschaft ist der Sozialdemokratie ihrem Wesen nach die Rolle einer oppositionellen Partei vorgezeichnet, als regierende darf sie nur auf den Trümmern des bürgerlichen Staates auftreten.“ In der frühen SPD rechtfertigten zwei ihrer ideologischen Köpfe wie Eduard Bernstein und Georg von Vollmar eine Regierungsbeteiligung der SPD mit einer Methode der „stückweisen Einführung des Sozialismus in die bürgerliche Gesellschaft“ und phantasierten von einem „friedlichen Hineinwachsen in den Sozialismus mittels Sozialreformen“, so dass unmittelbar nach der Novemberrevolution der Weg der SPD für eine Regierungsbeteiligung unter einer weiterhin monarchistischen Ausrichtung vorgezeichnet war. Dass Noske und die gesamte SPD-Führung dann mit Hilfe der Reichswehr die revolutionären Kräfte im Blut erstickte, war eine nahezu zwingende Folge dieser Kollaboration mit der herrschenden Klasse.

An diesen frühzeitigen Illusionen, die im späteren Verlauf der Geschichte von der Wirklichkeit eindeutig widerlegt wurden, hat sich bis zur heutigen Zeit nahezu nichts geändert. Der Weg der SPD nach 1945 ist ein Beleg für die Einschätzung von Wolfgang Abendroth: „Politische Intelligenz haben die integrationistischen Reformisten, die sich kapitalistischen Denkschemata unterwerfen, niemals besessen.“ Dasselbe Schicksal haben die italienischen und französischen kommunistischen Parteien erlitten, die sich ebenfalls in das Abenteuer einer linken Regierungsbeteiligung begaben und grandios scheiterten. Beide Parteien haben sich nach den gescheiterten Regierungskoalitionen nahezu pulverisiert.

Und auch der Weg der PDS und später der LINKEN beweist, dass sie aus diesen Erfahrungen offenbar nichts gelernt haben. Denn weder die PDS noch später DIE LINKE haben bei ihren Regierungsbeteiligungen ihren proklamierten Anspruch, einen Politikwechsel einzuleiten, auch nicht annähernd einlösen können. Weder in Mecklenburg-Vorpommern, noch in der Berliner Koalition von 2001 bis 2011, noch aktuell in Brandenburg oder Thüringen lässt sich ernsthaft behaupten, dass die neoliberale Entwicklung gestoppt bzw. umgekehrt worden sei. Die Konzerne schalten weiterhin, wie sie wollen, und am Beispiel Brandenburg können wir feststellen, dass die LINKE sogar bereit ist, sich aufgrund ihrer Zustimmung zum neuen Polizeigesetz in den staatlichen Repressionsapparat einbinden zu lassen.

Wenn eine linke Regierungsbeteiligung unter bürgerlichen bzw. neoliberalen Verhältnissen überhaupt sinnvoll sein sollte, dann nur als Ausdruck und Ergebnis einer breiten Widerstands- und Protestbewegung, die eine linke Regierung gewissermaßen „vor sich hertreibt“ und ihr im öffentlichen Raum den notwendigen Resonanzboden verschafft. Alles andere ist frommer Kinderglaube und bahnt für die LINKE den Weg zu einer reformistischen Partei. Da aber diese Politik seit vielen Jahren bereits von der SPD im Interesse der herrschenden Besitz- und Machteliten vertreten wird, wird DIE LINKE für diese Rolle nicht gebraucht, was offensichtlich u.a. ihre Stagnation bei den Wahlergebnissen in der letzten Zeit ausmacht.

* Jürgen Aust ist Mitglied im Bundessprecher*innen-Rat der Antikapitalistischen Linken und im Landesvorstand der LINKEN.NRW Sprecher für Arbeitsmarktpolitik

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle    :      Flag of Die Linke

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Überwachung Polizei Aachen

Erstellt von DL-Redaktion am 24. Juli 2019

Infos aus privaten Accounts fließen in die Polizeiarbeit ein

Screenshot des Twitter-Accounts der Polizei Aachen. (Filter/Bearbeitung:

Quelle       :         Netzpolitik. ORG.


Bei der Klima-Aktion „Ende Gelände“ im Juni passierte etwas Seltsames: Ein Twitter-Account mit dem Namen „Mister X“ postete zum wiederholten Male einen Tweet der Polizei Aachen – bevor dieser auf dem offiziellen Account erschien. So enttarnte sich ein Account, der mutmaßlich Proteste beobachtet. Die Polizei Aachen erklärte damals, ihr Tweet sei irrtümlicherweise mit dem persönlichen Account eines Mitarbeiters veröffentlicht worden.

Eine Informationsfreiheitsanfrage beim Polizeipräsidium Aachen gibt nun weiteren Einblick. Hierbei wiederholt die Polizei, dass es sich um einen Account eines Mitarbeiters handele. Der offizielle Polizei-Account sei hingegen aufgrund eines Erlasses aus dem Innenministerium vom 30. September 2016 erstellt worden. Eine Regelung, wie und ob private Accounts genutzt werden dürfen, sei in diesem Erlass nicht enthalten.

Private Nutzung wichtig für Social-Media-Polizisten

Die Polizei begründet, warum private Accounts für die Polizeiarbeit wichtig seien:

Den Mitarbeiterinnen und Mitarbeitern, die im Bereich ’social media‘ bei der Polizei Aachen tätig sind, obliegen besondere Anforderungen und Kompetenzen. Aus diesem Grunde ist auch die private Nutzung von Twitter und anderen sozialen Medien für diese Mitarbeiter von hoher Bedeutung.

Dass sie Informationen für ihre Arbeit nutzen, die sie über ihre privaten Accounts erhalten, gehöre dazu. Die Rechtsgrundlage steckt laut Polizei in § 9 Abs. 1 Nr. 1 des Polizeigesetzes NRW. Der besagt, dass die Polizei personenbezogene Daten erheben darf, wenn sie für ihre Aufgabenerfüllung notwendig sind.

Blick AC Dom von St Jakob.JPG

„Die Informationen, die der Mitarbeiter oder die Mitarbeiterin über seinen oder ihren Account erlangen, können damit aufgrund der genannten Rechtsgrundlage durch die Polizei genutzt werden.“ Im Polizeipräsidium Aachen gebe es zudem eine Dienstanweisung „Soziale Netzwerke“, die aber die Nutzung privater Accounts von Mitarbeitern nicht ausdrückliche regele. Explizit sei aber festgelegt, dass der offizielle Account der Polizei Aachen nicht privat genutzt werden dürfe.

Monitoring mit privaten Accounts rechtlich unproblematisch

Die Nutzung von privaten Accounts von Mitarbeitern der Polizei zum reinen Monitoring auf Twitter sei „rechtlich unproblematisch“, sagt Ulf Buermeyer, Richter beim Landgericht Berlin und Vorsitzender der GFF, gegenüber Das sei vergleichbar mit einer „Internet-Streife“. Problematisch würde es nur, wenn die Polizei gezielt Desinformation über solche Accounts verbreite, was im Fall Aachen allerdings nicht passierte.


Grafikquellen      :

Oben     —          Screenshot des Twitter-Accounts der Polizei Aachen. Quelle —    (Filter/Bearbeitung:


Unten       —    Wie gut das der olle Vandale Karl  nichts mehr mit bekommt.

This is a photograph of an architectural monument., no. 0

Abgelegt unter Kriegspolitik, Nordrhein-Westfalen, Politik und Netz, Überregional | Keine Kommentare »

Thema: Prekäre Arbeit

Erstellt von DL-Redaktion am 22. Juli 2019

A-typische Beschäftigung verharrt auf hohem Niveau

Quelle      :        Scharf  –  Links

Von Gewerkschaftsforum Dortmund

Quote in westdeutschen Ländern um bis zu 12 Prozentpunkte höher als im Osten.

Die Zahl der atypischen Beschäftigungsverhältnisse in Deutschland verharrt auf hohem Niveau. Besonders stark betroffen sind nach wie vor Frauen in Westdeutschland, die aus familiären Gründen oft in Teilzeit oder Minijobs arbeiten, zudem jüngere Beschäftigte, geringer Qualifizierte und Beschäftigte ohne deutschen Pass. Dementsprechend unterscheiden sich die Quoten in Ost- und Westdeutschland erheblich, und sie haben sich in den vergangenen Jahren noch auseinanderentwickelt: In den ostdeutschen Bundesländern liegt der Anteil atypisch Beschäftigter nach den aktuellen Zahlen überall unter 18 Prozent, in Brandenburg sogar unter 15 Prozent. Im Westen reicht sie von knapp 18 Prozent in Hamburg bis 23 Prozent und mehr in Baden-Württemberg, Rheinland-Pfalz, dem Saarland und Bremen. Das zeigt eine neue Auswertung des Wirtschafts- und Sozialwissenschaftlichen Instituts (WSI) der Hans-Böckler-Stiftung.

Teilzeit, Befristung und Leiharbeit waren von Anfang der 1990er-Jahre bis zur Finanzkrise auf dem Vormarsch. Seit 2010 ist der Anteil dieser atypischen Arbeitsverhältnisse an der sogenannten Kernerwerbstätigkeit – darin sind etwa Auszubildende, Schüler, Studierende oder jobbende Rentner nicht enthalten – wieder ein wenig gesunken und verharrte zuletzt bei rund 21 Prozent. 1991 waren es erst knapp 13 Prozent, auf dem Höhepunkt 2007 22,6 Prozent, geht aus der neuen WSI-Analyse hervor. Bei ihrer Untersuchung stützen sich Dr. Eric Seils und Dr. Helge Baumann auf Sonderauswertungen des Statistischen Bundesamtes. Auf dieser Basis haben die Forscher detaillierte Werte für 2017 berechnet – dem aktuellsten Jahr, für das derzeit Daten vorliegen.

Die WSI-Studie zeigt: Atypische Beschäftigung verteilt sich keineswegs gleichmäßig auf Bevölkerungsgruppen und Regionen. Zwei Drittel des Zuwachses seit der Wiedervereinigung geht auf die Ausweitung der Teilzeitbeschäftigung unter Frauen in Westdeutschland zurück. Dementsprechend sind bundesweit 30,5 Prozent aller kernerwerbstätigen Frauen atypisch beschäftigt, wobei Minijobs und Teilzeitarbeit dominieren. Unter den Männern haben 12,2 Prozent einen atypischen Job. Bei ihnen spielen Leiharbeit und befristete Beschäftigung eine vergleichsweise große Rolle. Das ergibt insgesamt eine durchschnittliche Quote von 20,8 Prozent im Jahr 2017 (siehe auch die Grafiken in der Studie; Link unten).

Schaut man auf den Durchschnitt beider Geschlechter, stecken vor allem jüngere Beschäftigte in atypischen Jobs. Unter den 15-24-Jährigen gilt dies für 30,9 Prozent. Wesentlicher Grund: Berufsanfänger erhalten häufig erst einmal nur einen befristeten Vertrag. Die Quote geht dann in der Altersgruppe zwischen 25 und 34 Jahren auf 22 Prozent zurück, sinkt danach weiter leicht, um in der Altersgruppe 55 Plus wieder etwas anzusteigen. Allerdings sind die Trends unter Männern und Frauen zeitweilig unterschiedlich: Bei weiblichen Beschäftigten steigt die Quote in der Phase der Familiengründung zwischen 35 und 44 Jahren zunächst wieder kräftig an.

Überdurchschnittlich häufig atypisch beschäftigt sind Arbeitnehmerinnen und Arbeitnehmer ohne deutschen Pass. Der Anteil reicht von 25,3 Prozent unter Ausländerinnen und Ausländern aus den „alten“ EU-15-Ländern bis zu 35,3 Prozent unter Menschen, die aus Staaten außerhalb der EU stammen. Während die Zahl atypisch Beschäftigter ohne deutsche Staatsangehörigkeit in den vergangenen Jahre um knapp 500.000 zugenommen hat, ging sie unter deutschen Frauen (-447.000) und Männern (-183.000) um insgesamt 630.000 zurück.

Auch der Bildungs- und Berufsabschluss beeinflusst die Wahrscheinlichkeit, atypisch beschäftigt zu sein. Während 36,6 Prozent der Arbeitnehmerinnen und Arbeitnehmer ohne anerkannte Berufsausbildung befristet, in Teilzeit oder Leiharbeit tätig sind, liegt die Quote bei Beschäftigten mit abgeschlossener Lehre oder Berufsfachschule bei 20,7 Prozent. Am niedrigsten ist sie unter Menschen mit Hochschulabschluss: 14,3 Prozent.

Regional steht das Bundesland Bremen mit gut 26 Prozent atypischer Beschäftigung an der Spitze. Es folgen das Saarland, Rheinland-Pfalz, Baden-Württemberg und Nordrhein-Westfalen mit Quoten zwischen knapp 23 und 24 Prozent. Niedersachsen und Hessen verzeichnen Anteile von rund 22 Prozent, Bayern knapp 20 Prozent. Interessant: Sowohl in Bremen als auch in Bayern geben männliche Beschäftigte den Ausschlag: Ihre Quote atypischer Beschäftigung ist in dem norddeutschen Stadtstaat weit überdurchschnittlich (20,4 Prozent), während sie im Freistaat bei lediglich knapp neun Prozent liegt.

Generell deutlich niedriger sind die Quoten in Ostdeutschland, wo Frauen seit langem weitaus häufiger in Vollzeit arbeiten und die öffentliche Kinderbetreuung stärker ausgebaut ist. Den bundesweit niedrigsten Wert weist Brandenburg mit 14 Prozent auf. Zudem ist die atypische Beschäftigung zuletzt im Osten spürbar gesunken, während sich im Westen nur wenig verändert hat. Daher ist die Differenz zwischen ostdeutschen (durchschnittliche Quote 16,3 Prozent 2017) und westdeutschen (21,8 Prozent) Bundesländern mit aktuell 5,5 Prozentpunkten deutlich größer als Mitte der 1990er (gut 1 Prozentpunkt) oder 2000er (rund 3,5 Prozentpunkte) Jahre.

Dass die atypische Beschäftigung im gesamtdeutschen Durchschnitt in den letzten Jahren zumindest leicht zurückgegangen ist, führen die WSI-Wissenschaftler auf die vergleichsweise gute Konjunktur zurück, die wieder vermehrt Normalarbeitsverhältnisse entstehen ließ. Zudem gehen Frauen in jüngster Zeit etwas seltener Teilzeitbeschäftigungen mit sehr geringer Stundenzahl nach. Dennoch betonen Seils und Baumann, dass das aktuelle Niveau der atypischen Beschäftigung weiterhin hoch sei. Daher raten sie, „den Trend zu längeren Arbeitszeiten teilzeitbeschäftigter Frauen durch politische Maßnahmen zu flankieren“ Ein weiterer Ausbau der Kinderbetreuung sei ein Baustein dazu. Wenn mehr Frauen ihre Arbeitszeit ausweiteten, vergrößere das zum einen ihre wirtschaftliche Unabhängigkeit, auch im Rentenalter. Zum anderen ließe sich damit auch die prognostizierte Verknappung von Arbeitskräften dämpfen.

Quelle: Hans Boeckler Stiftung 

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle       :          Ver.di-Senioren 1. Mai 2015 Hamburg

Abgelegt unter Arbeitspolitik, Gewerkschaften, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Träumen ist Arbeit

Erstellt von DL-Redaktion am 17. Juli 2019

Sterbende Dörfer,  die Krise des Kapitalismus,


Ein Schlagloch von Georg Diez

Sterbende Dörfer, Klimawandel, die Krise des Kapitalismus, die Proteste der Gilets jaunes – die existenziellen Fragen unserer Zeit hängen zusammen.

Ich sah den Turm der Kathedrale beim Abstieg durch die bewaldeten Hügel rings um Pra­delles, eine braune Spitze, die aus dem Nest brauner Steine herausragte, eines der schönsten Dörfer des Landes, wie es offiziell heißt, ein Cevennendorf mit viel Vergangenheit, aber wenig Zukunft, wie sich herausstellte.

Was braucht es, dachte ich, als ich auf das Dorf zulief, um so eine gemeinsame Anstrengung zu unternehmen, solche eine Kirche zu bauen, über viele Jahrzehnte hinweg? Was braucht es, um eine gemeinsame Geschichte zu schaffen, die so lange hält, die den Einzelnen übersteigt und die Gemeinschaft, das Städtchen, das Dorf trägt? Heute hängt an jedem zweiten oder dritten Haus ein Schild aus schmutzigem Papier, À Vendre, zu verkaufen.

Pradelles stirbt, es stirbt langsam und vor aller Augen, es stirbt an einer Zeit, die sich radikal verändert hat, keine Krankenversorgung, kein Zug oder Bus, kaum Läden, die Schule wird wohl bald schließen, weil es nicht genug Kinder gibt; es ist der Teufelskreis von Dörfern in ganz Frankreich, in ganz Europa, ein politisches Problem, wie nicht nur die Proteste der Gilets jaunes gezeigt haben, weil die Legitimation des demokratischen Systems in Frage steht, wenn es einfach nicht mehr funktioniert für die Menschen.

Die Spaltung von Stadt und Land ist mehr und mehr eine politische Herausforderung für viele westliche Staaten, und das hat damit zu tun, dass die Voraussetzungen fehlen, die ein Leben auf dem Land möglich machen. Es hat aber auch damit zu tun, dass überhaupt die Vorstellung fehlt, was ein anderes, ein neues, ein inklusives, transformatorisches, alternatives Leben auf dem Land sein könnte.

Ein Dorf wie Pradelles stirbt, anders gesagt, auch deshalb, weil den Menschen hier eine Idee fehlt, so etwas wie ein Traum, wie aus dem Vorhandenen etwas Neues entstehen könnte. Der Schriftsteller Robert Louis Stevenson, der hier vor 140 Jahren vorbeikam und dessen Pfad ich für eine gute Woche folgte, beschreibt das Pra­delles seiner Zeit als eingebettet in eine „feine, belebte, atmende, rustikale Landschaft“; heute sieht man niemanden, nicht auf den Feldern, aber auch kaum in dem Dorf, das sich wie in sich selbst zurückgezogen hat, wie in Trauer.

Conques,Pradelles... ( nov. 2012) 161.JPG

Es ist die Abwesenheit eines Traums, glaube ich, die mit zu dieser Traurigkeit beiträgt; und der Mann, der mir im Dorf mit einem Packen Zettel entgegenkam, schien den gleichen Gedanken zu haben. Eine Freundin von ihm, sagte er, sei vor einer Weile wieder hierhergezogen, das Dorf, aus dem sie stammt, und sie habe kaum glauben können, wie leer, schwach und ohne Energie es sei – deshalb wollten sie einen Workshop veranstalten, an dem die Einwohner von Pradelles gemeinsam träumen sollen und die Gesellschaft dieses kleinen Dorfes neu erschaffen.

Ich musste bei dem Wort Traum an einen Artikel des britischen Politikers Ed Miliband im Guardian denken, in dem er beschrieb, warum bei der Klimakatastrophe Albtraumszenarien nicht weiterhelfen und es notwendig ist, „Träume zu malen“. Er greift dabei den Green New Deal auf, den die junge amerikanische Kongressabgeordnete Alexandria Ocasio-Cortez bekannt gemacht hat – eine umfassende Umwandlung der Gesellschaft, die ökologische und sozialen Herausforderungen gemeinsam angeht, Artensterben und Ungerechtigkeit, Extremwetter und extremer Reichtum, eine staatliche Großanstrengung, vergleichbar mit einer Mobilisierung im Kriegsfall, aber das ist auch die Dringlichkeit dieses Augenblicks.

Quelle         :       TAZ          >>>>>         weiterlesen


Grafikquellen         :

Oben      —         Pradelles, view toward south-east (Naussac Lake and southern end of the Margeride Mtn.)

Unten      —      Le poilu de Pradelles # Haute-Loire (43) .

Abgelegt unter Europa, Kommunalpolitik, Kultur, Umwelt | Keine Kommentare »

Polizist auf Lebenszeit

Erstellt von DL-Redaktion am 17. Juli 2019

talk of the town aus NRW

Police in front of a motorway junction at Ende Gelände 28-10-2018 01.jpg

Von Daniel Kretschmar

Ausscheidende Polizeibeamte bekommen in NRW künftig einen sogenannten Ruhestands-ausweis. Nur ein Symbol? Ja, aber kein gutes für die demokratische Gesellschaft.

Wie in jedem anderen Beruf, so endet auch für Polizeibeamte der Dienst bei Erreichen des Pensionsalters. Abgabe von Waffe, Uniform und Dienstausweis, ein Händedruck, das war’s. Eben noch mit Sonderrechten ausgestattete Repräsentant*in des staatlichen Gewaltmonopols gewesen und plötzlich auf dem Altenteil. Vom Ort der Autorität hinabgeworfen in die Sphären des Gewöhnlichen, den Alltag der Untertanen, sind sie des Sinns, der Macht und ihrer Insignien beraubt. Zeit, ade zu sagen oder genauer: a. D. Keine Platzverweise mehr für jugendliche Randalierer, keine jovialen Fahrradkontrollen, keine Festnahmen und Dienstbesprechungen, sondern nur noch eine tiefe emotionale Leere.

Diesen bedrückenden Moment erträglicher zu machen hat sich nun das Land Nordrhein-Westfalen auf die Fahnen geschrieben. Seit dieser Woche erhalten ausscheidende Beamte einen sogenannten Ruhestandsausweis. Die Idee ist nicht neu, die Bundespolizei praktiziert das bereits seit 2015, im Saarland wurde der Ausweis 2006 eingeführt. NRW-Innenminister Herbert Reul erklärt den Sinn des Dokuments als „Ausdruck einer Haltung: Einmal Polizei, immer Polizei“. Besondere Rechte sind mit dem Papier nicht verbunden, es solle jedoch die Kontaktaufnahme mit Polizeidienststellen erleichtern. Man darf wohl annehmen, dass Ex-Beamte sich auch bisher schon zu erkennen geben, wenn sie mit den Aktiven zu tun bekommen, aber o. k., ein amtlich gestempelter Berechtigungsnachweis ist den Deutschen eben heilig.

Reul erläutert den größeren Zusammenhang: „Der Ruhestandsausweis verkörpert eine besondere Form des Treueverhältnisses – ein Treueverhältnis, das in keinem Gesetz steht. Ein Treueverhältnis nicht im juristischen Sinne, sondern in Gestalt eines starken Zusammengehörigkeitsgefühls.“ Ach ja, die „Polizeifamilie“, jetzt auch mit Clubausweis, und zwar lebenslänglich.

Herbert Reul DS7 2796 PK groß.jpg

Materiell tut Herbert Reul ja ohnehin alles, was er kann, um seine Treue gegenüber der Polizei zu beweisen. Erinnert sei an die Abschaffung der Kennzeichnungspflicht für die Beamten in NRW. Dieses wichtige Instrument öffentlicher Kontrolle der Polizeiarbeit schien Reul „sachlich nicht begründet“. Dagegen ließe sich der Ruhestandsausweis vielleicht als Petitesse verbuchen, als alberne Sentimentalität. Der Ausweis ist aber nicht nur ein kostengünstiges Zeichen der Wertschätzung für frühere Staatsbedienstete, sondern scheckkartengroßes Symbol für ein sehr viel größeren und nicht ganz ungefährlichen Phänomens. Jenes „Treueverhältnis, das in keinem Gesetz steht“, das der Innenminister da beschwört, statt es einer kritischen Überprüfung zu unterwerfen, wird angelegentlich etwas prosaischer schlicht Korpsgeist genannt.

Quelle       :          TAZ       >>>>>          weiterlesen


Grafikquellen      :

Oben     —          Die Polizei vor einer Auffahrt auf eine Autobahn bei einer Ende Gelände Demonstration.


Unten        —      Herbert Reul am Freiherr vom Stein-Gymnasium Leverkusen anlässlich des Europatages 2015

Abgelegt unter Nordrhein-Westfalen, P.CDU / CSU, Regierung, Überregional | Keine Kommentare »

Aufruf Journalisten-Verband

Erstellt von DL-Redaktion am 14. Juli 2019

Der Polizei weniger nachplappern

Police in front of a motorway junction at Ende Gelände 28-10-2018 03.jpg

Das Volk bezahlt die Macht – welche sich aber vor dem Mächtigeren verbeugt !

Von Michael Kees

Redaktionen nutzen regelmäßig Informationen der Polizei, ohne sie zu überprüfen. Wegen der Berichterstattung über Ende Gelände gibt es daran Kritik.

Bei Straftaten oder Gefahrenlagen sind Jour­na­lis­t*innen häufig auf Angaben der Polizei angewiesen. Oft behandeln Redaktionen deren Infos als sogenannte privilegierte Quelle – das heißt, dass die Angaben keiner zweiten Prüfung unterzogen werden. Das kritisiert jetzt aber der Deutsche Journalisten-Verband (DJV). Der Verband hat dazu aufgerufen, „Meldungen und Informationen der Polizeibehörden in allen Fällen kritisch zu hinterfragen“.

Ein Aufruf, der Gewicht hat, denn der DJV ist mit rund 33.000 Mitgliedern die größte Interessenvertretung für Journa­list*innen in Deutschland. Die Frage, wie Redaktionen mit Polizeimeldungen umgehen sollen, ist dabei keine neue. Immer wieder gibt es Kritik an einseitigen oder falschen Informationen der Polizei und an den Medien, die diese Informationen ungeprüft verbreiten.

Anlass für die Stellungnahme des DJV sind Berichte über die Ende-Gelände-Proteste im Juni. Die Polizei Aachen sprach nach dem Demowochenende von 16 Polizist*innen, die verletzt worden seien. Der DJV kritisiert, dass einige Medien diese Meldung einfach übernommen hätten. Denn die Polizei machte lange keine Angaben dazu, wie sich die Einsatzkräfte überhaupt verletzt hatten.

Auf Nachfrage eines WDR-Journalisten stellte sich heraus, dass von vier Polizist*innen, die ihren Dienst beenden mussten, nur zwei durch „Fremdeinwirkung“ verletzt wurden. Auf der anderen Seite beklagte das Bündnis Ende Gelände ein übermäßig hartes Vorgehen der ­Polizei. An sich war die Verletztenzahl der Polizei Aachen richtig, aber sie zeichnete ein unvollständiges Bild. Wie neutral kann die Polizei sein, wenn sie sich selbst gegen Vorwürfe verteidigen muss?

Stopped Ende Gelände Demonstration 27-10-2018 05.jpg

„Es war einmal“. Gab es nicht Zeiten da „alle Macht vom Volk“ ausging ? Das war aber bevor die Wirtschaft das Sagen in die Händen gelegt bekam. Also vor Merkel-Kohl-Schröder-Hitler? Heute lässt nur noch ein schlechtes Gewissen die Welt erzittern?

„Die Polizei ist ausnahmslos der Wahrheit verpflichtet“, sagt Victor Ocansey, Pressesprecher des Landesamts für Ausbildung, Fortbildung und Personalangelegenheiten der Polizei Nordrhein-Westfalen. Ocansey weist darauf hin, dass es Ziel der Polizei sei, gründlich und möglichst schnell zu informieren – auch „einsatzbegleitend“. Noch während ein Einsatz läuft, würden oft Presseanfragen gestellt und Falschmeldungen verbreitet, die man korrigieren müsse.

Aufgabe der Medien ist die Kontrolle der Polizei

Quelle          :         TAZ          >>>>>          weiterlesen


Grafikquellen       :

Oben        —         Die Polizei vor einer Auffahrt auf eine Autobahn bei einer Ende Gelände Demonstration.

Abgelegt unter Kultur, Medien, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Der Kampf geht weiter…

Erstellt von DL-Redaktion am 12. Juli 2019

Pilotabschluss im Einzelhandel NRW


Quelle      :         Scharf  –  Links

Von Herbert Schedlbauer

Der im Einzelhandel seit zwei Monaten geführte Arbeitskampf in Nordrhein-Westfalen ist beendet. Überraschend schnell einigte man sich in der vierten Tarifrunde. Erneut vereinbarte die Dienstleistungsgewerkschaft ver.di mit dem Handelsverband NRW eine zweijährige Laufzeit. Die Allgemeinverbindlichkeit der Entgelttarifverträge (AVE) wurde von der Kapitalseite vom Tisch gefegt.

Löhne und Gehälter steigen für die Beschäftigten, die bis zur Gehaltsgruppe der Verkäuferin im letzten Berufsjahr (2579,- Euro in Vollzeit) eingruppiert sind, um 3 Prozent. Für alle Beschäftigten in höheren Entgeltgruppen gibt es einen Festbetrag von 77,50 Euro brutto. Ab 1. Mai 2020 kommen weitere 1,8 Prozent dazu. Ausbildungsvergütungen werden zwischen 45 Euro und 60 Euro und in 2020 von 50 Euro und 80 Euro jeweils zu Beginn der Ausbildungsjahre erhöht. Der jetzige Abschluss muss noch von der großen Tarifkommission bestätigt werden. Gefordert hatte ver.di 6,5 Prozent mehr für alle, mindestens 163,- Euro und 100,- Euro mehr für Azubis! Eine Laufzeit von zwölf Monaten.

Im jetzigen Ausstand zeigte sich, wie geschlossen der Handelsverband gegen ver.di und die dort organisierten Belegschaften vorging. Bereits seit dem Jahr 2000 versuchen die Waren- und SB-Häuser sowie alle Discounter sich von Flächentarifen zu verabschieden. Mal ist es Karstadt, mal Real oder Kaufhof, in diesem Jahr war es Rewe und Edeka. Sie alle werden in den nächsten zwei Jahren bei dem Versuch einer Tarifflucht in Haustarifverträge nicht lockerlassen. Befürchtet werden muss auch, dass bei einer zukünftigen AVE neue Tätigkeitsmerkmale für Verkaufs- und Warenauffüllkräfte vereinbart werden.

Die Warenhauskonzerne führen von oben einen unerbittlichen Klassenkampf. Die vor zwanzig Jahren begonnene Tarifflucht ist mit die Ursache für die existierenden Armutslöhne und eine massive Arbeitsplatzvernichtung. Ver.di führt dagegen einen nicht widerspruchsfreien Kampf. Einerseits ist das Ziel, neben mehr Lohn und Gehalt, zum Flächentarifvertrag zurück zu kommen, richtig und notwendig. Denn würde eine Allgemeinverbindlichkeit wieder erreicht, müssten auch Online Versandhändler höhere Löhne zahlen. Amazon entlohnt bis jetzt nach Logistiktarif. Der liegt noch unter dem Flächentarif des Einzel- und Versandhandels. Von einer AVE würden rund drei Millionen Beschäftigten im Einzelhandel bundesweit profitieren.

Anderseits zeigt sich eine zunehmende Kritik in einigen Tarifkommissionen. Dort und in anderen Gremien wird unter ehrenamtlichen Funktionären diskutiert, ob und wie weit überhaupt eine Steigerung der Reallöhne und eine Laufzeit von 12 Monaten, nur mit Warnstreiks, durchsetzbar ist. Auch die fehlende Einsicht der Gewerkschaft, die Tarifkämpfe fachbereichsübergreifend zu organisieren, spielt dabei eine Rolle. Mehrere Anträge werden sich deshalb auf dem ver.di Bundeskongress im Herbst in Leipzig damit beschäftigen. Inhalt ist dabei die gemeinsame Solidarität und Mobilisierung über die Fachbereiche hinaus bei Streiks.

Das wird auch dringend notwendig. Denn mit dem einheitlichen Auftreten der Unternehmer haben diese beim jetzigen Abschluss in NRW durchgesetzt, dass in Sachen Flächentarif für die nächsten 24 Monate Ruhe herrscht. Der ver.di Illusion, die Tarifflucht über die Politik per Gesetz zu verbieten, können die Einzelhändler in Ruhe entgegensehen. Die Lobbyarbeit der Kapitalisten in diesem Staat hat dank Bundesregierung noch immer bestens funktioniert.

Wollen ver.di und die anderen DGB-Gewerkschaften dem etwas entgegensetzen, werden sie sich wieder in Richtung Klassenorganisationen der Arbeiter und Angestellten bewegen müssen. Bleibt es bei der Sozialpartnerschaft, bedeutet dies eine weitere Lähmung im Kampf um mehr Lohn und bessere Arbeitsbedingungen. Tarifkämpfe auf gleicher Augenhöhe, wenn es die in der Geschichte der Bundesrepublik jemals gegeben haben sollte, kann es aufgrund der ökonomischen Abhängigkeit der Beschäftigten nicht geben.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle      :         Bilder im Supermarkt

Urheber Ralf Roletschek (User:Marcela)
(Weiternutzung dieser Datei)
Own work, attribution required (Multi-license with GFDL and Creative Commons CC-BY 2.5)

Abgelegt unter Gewerkschaften, Nordrhein-Westfalen, Positionen, Überregional | Keine Kommentare »

Polizeigewalt-Ende Geländer

Erstellt von DL-Redaktion am 11. Juli 2019

„Natürlich kommt es zu Fehlern“

Ende Gelände crossing wall infront of motorway 06.jpg

Bekommen die Schlägertruppen des Staates ihren Strom Frei Haus ?

Von Anett Sell, Köln

Felix K. sagt, ein Polizist habe ihm bei den Protesten von Ende Gelände den Schädel gebrochen. Die Aachener Polizei erklärt, jede Anzeige werde geprüft.

 „Letzte Woche war ich dreimal im Krankenhaus. Erst haben sie gesagt, der Bruch müsse operiert werden: Augenlid aufschneiden und den Bruch schienen. Jetzt meinten sie, die OP sei zu gefährlich und der Bruch heile vielleicht von selbst. Wegen des Auges soll ich in drei Wochen noch mal kommen. Der Zahnarzt meinte, es könnte sein, dass meine oberen Schneidezähne absterben. Die reagieren zurzeit verzögert auf Kälte – aber das könne auch an der Schwellung liegen.“

Felix K. ist 35 Jahre alt und hat einen Schädelbasisbruch. Die Verletzung habe ihm ein Polizist zugefügt, als er am 22. Juni an einer Aktion von Ende Gelände im Rheinischen Braunkohlere­vier teilnahm, sagt K. Rund 6.000 Kli­ma­aktivist*innen hatten damals nach Angaben von Ende Gelände den Tagebau Garzweiler und die Bahnschienen zu zwei Braunkohlekraftwerken besetzt. Die Polizei Aachen erklärt, sie habe Tausende Beamt*innen im Einsatz gehabt. Einer von ihnen, sagt K., habe ihm den Schädel gebrochen.

„Ich hatte den Zeitpunkt verpasst, um in den Tagebau zu kommen, und war auf dem Rückweg. Zu den Polizisten hab ich gesagt, ‚Ich geh jetzt, ich geh jetzt‘“, berichtet K. der taz. „Die waren aber nicht offen für Kommunikation.“ Einer habe ihn in Disteln geschubst und, als er einen Weg heraus gesucht habe, „den gepanzerten Polizeihandschuh in die Schläfe gedroschen“.

Laut Ende Gelände hat die Polizei fünf Menschen so verletzt, dass sie ins Krankenhaus kamen. K. war einer davon. Die Polizei gibt insgesamt 16 Poli­zis­t*innen an, die verletzt wurden oder sich selbst verletzten – etwa durch Umknicken oder Stürze. Die Beeinträchtigungen seien überwiegend so leicht gewesen, dass die Betroffenen ihre Arbeit fortsetzen konnten. In vier Fällen sei vermerkt worden, dass die Verletzung im Zusammenhang mit einer Widerstandshandlung aufgetreten sei.

Ende Gelände wirft der Polizei vor, „Menschen grundlos verprügelt“ zu haben. Eine Sprecherin der Polizei Aachen sagt der taz: „Die Polizei hat in unserem Rechtsstaat die gesetzliche Legitimation zur Ausübung von Zwang und damit auch Gewalt, um polizeiliche Maßnahmen durchzusetzen.“ Die rechtlichen Voraussetzungen müssten natürlich vorliegen. „Die Polizei ist gesetzlich dazu verpflichtet, falls ein Fehlverhalten von Beamtinnen oder Beamten festzustellen ist, die entsprechenden Konsequenzen folgen zu lassen.“

„Das generelle Gewaltverbot gilt auch für die Polizei“

Police in front of a motorway junction at Ende Gelände 28-10-2018 01.jpg

Als ich noch an der Hand meines Vaters ging stellte er mir den Ordnungshüter in unserer Straße vor. Da sprach die Gesellschaft noch von Polizisten und Wachmänner als Respektspersonen. Heute werden sie abfällig Bullen genannt. Ob dieses wohl einzig ihrer Hörigkeit gegenüber korrupten PolitikerInnen geschuldet ist?

Welche Konsequenzen das in der Regel sind, damit beschäftigt sich Tobias Singelnstein. Der Professor für Kriminologie an der Ruhr-Universität Bochum sowie Strafrechtler führt aktuell eine der größten Studien zu Körperverletzung im Amt, sogenannter Polizeigewalt, durch, die es in Deutschland bislang gegeben hat. Sein Team sei in kontinuierlichem Austausch mit allen Ebenen der Polizei, mit führenden Beamten wie mit Polizist*innen in Einsatzhundertschaften: „Beamte kommen auf uns zu und berichten ihre Erfahrungen, auch Beamte, die selber zu Tätern geworden sind.“

Aus den Statistiken der Staatsanwaltschaften geht hervor, dass jährlich 2.100 bis 2.500 Verfahren gegen Polizist*innen angestrengt werden, denen rechtswidrige Gewaltanwendung vorgeworfen wird. 2017 – das sind die aktuellsten Zahlen – lag die Anklagequote unter zwei Prozent. Der Anteil an Verfahren, die eingestellt würden, sei „praktisch nirgendwo so hoch wie in diesem Bereich“, sagt Singelnstein.

Quelle        :        TAZ       >>>>>        weiterlesen

Ministerin über Ende Gelände

Populismus statt Politik

Sie hat die Haare schön und trat schon mit 15 Jahren in die CDU ein, da sie die „Birne“ verehrte

Ein Kommentar von Malte4 Kreutzfeldt

Bei Protesten gegen Braunkohle-Abbau sind Klimaschützer über zwei Felder gelaufen. Julia Klöck­ner hat sich nun empört darüber geäußert.

Hurra! Endlich nimmt CDU-Landwirtschaftsministerin Julia Klöck­ner die Sorgen der Bauern im Rheinland ernst und spricht sich mit klaren Worten gegen die landwirtschaftlichen Schäden durch Klimawandel und Tagebaue aus …

Ach nein, sorry: gegen die landwirtschaftlichen Schäden durch Gegner von Klimawandel und Tagebauen. Denn die haben etwas Skandalöses getan: Bei ihren Protesten gegen die Klima- und Landschaftszerstörung, die mit dem Abbau der Braunkohle einhergeht, sind sie doch tatsächlich über ein Petersilien- und ein Karottenfeld gelaufen. Landwirtschaftliche Ressourcen zu zerstören sei ein „elitäres, ignorantes Verhalten“, zürnte Klöckner in einer Pressemitteilung und bescheinigte den Klimaaktivisten ein „Glaubwürdigkeitsproblem“.

Quelle     :         TAZ        >>>>>        weiterlesen


Grafikquelle        :

Oben     —        Ende Gelände Aktivisten überqueren einen Wall vor einer Autobahn um auf die dahinterliegende Hambachbahn zu kommen. Die Polizei hält einen Teil auf.

2.) von Oben    —     Die Polizei vor einer Auffahrt auf eine Autobahn bei einer Ende Gelände Demonstration.


Unten        —       Julia KlöcknerBundestagsbüro Julia Klöckner

Picture of Julia Klöckner, Member of the German Bundestag (CDU/CSU parlamentary group)

Abgelegt unter APO, Köln, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Zurück zur sozialen Frage

Erstellt von DL-Redaktion am 8. Juli 2019

Es fehlt die positive Erzählung

Die Linke Grundrecht Grundeinkommen BGE Berlin 2013.jpg

Gastbeitrag von Dana Moriße und Manuel Huff  –  Mitglieder des Landesvorstandes der LINKEN in Nordrhein-Westfalen.

Anstatt die Grünen nachzuahmen, sollte die Linkspartei die Verteilungsgerechtigkeit in den Mittelpunkt rücken.

Das Ergebnis der Linkspartei bei der zurückliegenden Europawahl stellt eine Zäsur dar und sollte so etwas wie der letzte Warnschuss sein, die strategische und inhaltliche Ausrichtung grundlegend zu überdenken. Mit 5,5 Prozent erreichte Die Linke ihr historisch schlechtestes Ergebnis und konnte selbst von einer massiv gestiegenen Wahlbeteiligung von 48,1 Prozent auf 61,4 Prozent in keiner Weise profitieren. Dabei ist besonders dramatisch, dass sie bei den Erwerbstätigen kaum noch punkten kann. Von den im Bundestag vertretenen Parteien schneidet in dieser Bevölkerungsgruppe lediglich die FDP noch schlechter ab. Bei der Betrachtung dieser Zahlen wäre bei einer Partei, die ihre Existenz stets eng mit der Geschichte der Arbeiterbewegung verknüpfte, eine Schockstarre zu erwarten.

Doch stattdessen sind in weiten Teilen der Partei Analysen zu finden, die das Ergebnis relativieren, bis hin zu Aussagen des Parteivorsitzenden Bernd Riexinger, der Rechtsruck sei vorerst gestoppt. Angesichts des verbesserten Wahlergebnisses der AfD mit einer Verdopplung der absoluten Stimmen auf 4,1 Millionen Menschen ist das eine bemerkenswerte Feststellung.

Weil die Grünen bei der EU-Wahl mit 20,5 Prozent zweitstärkste Kraft in Deutschland wurden, gibt es nun zudem den Ruf innerhalb der Linkspartei, doch endlich die Ökologie als das zentrale Thema der Partei zu deklarieren. Auf diesem Feld ist jedoch wenig zu holen. Die Linke braucht sich hierbei programmatisch nicht hinter den Grünen zu verstecken. Wahlprüfsteine von BUND Jugend oder „Fridays For Future“ zur Europawahl legten sogar eher eine Wahl der Linken nahe. Doch egal, wie gut die Partei hier aufgestellt ist: Klimaschutz wird den Grünen zugeschrieben. Das soll nicht bedeuten, dass man das Thema vernachlässigen sollte, aber hier wäre das Anerkennen der Realität angebracht.

Wer jetzt den Grünen hinterherlaufen will, dem wollen wir entgegenhalten, dass es einen unausweichlichen Zusammenhang zwischen der Zerstörung der Umwelt sowie der Klimakatastrophe und dem Kapitalismus gibt. Sicherlich war Umwelt- und Klimaschutz die zentrale Frage bei der Wahlentscheidung. Doch dicht dahinter rangierten soziale Sicherheit und Friedenssicherung. Also zwei Themen, bei denen Die Linke ihre Kernkompetenzen verortet. Dennoch verliert die Partei an Zustimmung.

Kampf um das Klassenbewusstsein

Wer sich außerhalb linker Kreise bewegt, bekommt schnell mit, warum Die Linke einen schweren Stand hat. Sie wird als eine Partei wahrgenommen, die sich hauptsächlich um Partikularinteressen kümmert. Die große Mehrheit fühlt sich von der Linkspartei nicht angesprochen. Selbst von den eigenen Wählern trauen ihr nur acht Prozent zu, die Probleme lösen zu können. Der Versuch großer Teile der Partei, über Identitätspolitik möglichst viele kleine Gruppen anzusprechen, ist gescheitert. Die Idee, diversen Minderheiten zu ihren gesellschaftlichen Rechten zu verhelfen, ist menschlich nachvollziehbar und ehrenwert. In der Praxis führte sie jedoch immer zu Ausgrenzungserfahrungen eben jener Gruppen, die nicht Bestandteil in der jeweiligen Debatte sind.

UmFairteilen-Demonstration in Erfurt (8043080919).jpg

Dies sorgt dafür, dass sich ein Großteil unserer früheren Wählerklientel mittlerweile so weit von uns abgewendet hat, dass selbst eine im Kern rassistische und neoliberale Partei wie die AfD als Alternative wahrgenommen wird. Um nicht falsch verstanden zu werden: Die Linke war stets eine pluralistische Partei, die genau daraus ihre Stärke sowie Ausstrahlungskraft schöpfen konnte. Eben diese Heterogenität macht es jedoch umso notwendiger, ein verbindendes Element in den Mittelpunkt politischer sowie strategischer Ausrichtung zu stellen.

Quelle        :       Der Freitag        >>>>>         weiterlesen


Grafikquellen      :

Oben      —        More than 2.000 people rallying for a Basic Income on the BGE-Demonstration on September 14, 2013 in Berlin

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Das „Epos der Demokratie“

Erstellt von DL-Redaktion am 29. Juni 2019

Politisches Erdbeben in Istanbul

File:İmamoğluJune2019CampaignSilivri (6).jpg

Quelle      :         untergrundblätte ch.

Von Alp Kayserilioğlu / Max Zirngast

Die regierende AKP und ihr Bündnispartner MHP stecken bei den erneuerten Bürgermeisterwahlen in Istanbul vom 23. Juni eine heftige Niederlage ein. Warum die klassischen Taktiken der AKP diesmal nicht zogen und wovor revolutionäre Linke auf der Hut sein müssen: Eine Analyse.

Die Neuwahl des Bürgermeisteramts von Istanbul am 23. Juni 2019 endete mit einem Erdrutschsieg für den Kandidaten der Opposition, Ekrem Imamoğlu von der Republikanischen Volkspartei (CHP). Laut vorläufigen Ergebnissen wuchs der ursprüngliche Abstand zwischen Imamoğlu und dem Regimekandidaten Binali Yıldırım von 13.000 Stimmenunterschied bei der ersten Wahl vom 31. März auf erstaunliche 806.426 Stimmen an. Während am 31. März die Auszählung der Stimmen für Imamoğlu 48,8 Prozent gegenüber 48,55 Prozent für Yıldırım ergab, ist der Unterschied nun auf 54,21 Prozent der Stimmen gegenüber 44,99 Prozent der Stimmen angewachsen.

Das Ergebnis stellt somit eine vernichtende Niederlage für das Regimelager dar. Das letzte Mal, als ein solch extremes Umschlagen des Wahlverhaltens und überhaupt der Stimmung im Lande stattfand, war bei den Parlamentswahlen vom 7. Juni 2015, bei denen die AKP erstmalig seit ihrem Bestehen eine empfindliche Niederlage einstecken musste. Dabei wurden die Neuwahlen für Istanbul gerade deshalb eingeräumt, um, so Erdoğan, eine Wiederholung eines Ereignisses ähnlich des damaligen Wahldesasters auszuschließen. Was ist diesmal schiefgelaufen aus Perspektive des Regimes?

Das politische Kalkül der Neuwahlen

Wie wir stets hervorheben, befindet sich die Türkei in einer Hegemoniekrise, in der der herrschende Block einen Faschisierungsprozess in Gang setzt, um die kriselnde soziale und politische Ordnung wieder zu stabilisieren. Dabei schaffen sie es aber nicht, gesellschaftlichen Unmut und Opposition auszutrocknen, im Gegenteil: mit jedem neuen Faschisierungsschub verschärfen sich diese. Bei solch fragilen Bedingungen können Wahlen zu einem großen Risiko für den Machtblock werden – und zwar nicht nur in Hisicht auf verändertes Wahlverhalten, sondern im Sinne eines Umschwungs der allgemeinen Stimmung. Tatsächlich wurde vom Regime ja auch die Möglichkeit „unerwünschter“ Ergebnisse bei den Lokalwahlen im März 2019 als einer der Grund dafür angegeben, die eigentlich im November 2019 stattfindenden Präsidentschafts- und Parlamentswahlen auf den Juni 2018 vorzuziehen.

Dennoch waren die Lokalwahlen vom 31. März von großer Bedeutung, da sie zugleich als eine Wahl über den politischen Kurs der Faschisierung oder, um es einmal im Regime-Jargon auszudrucken, als eine Wahl über die „Fortexistenz des Staates“ begriffen wurden. Trotz weitflächiger Repression und Drohgebärden signalisierten die Ergebnisse der Wahlen vom 31. März einen Stimmungsumschwung: Die herrschende Allianz aus der Partei für Gerechtigkeit und Aufschwung (AKP) und Partei der Nationalistischen Bewegung (MHP) unter dem Namen Cumhur Ittifakı (Volksallianz) verlor alle Großstädte an den Hauptoppositionsblock Millet Ittifakı (Allianz der Nation), bestehend aus CHP und der MHP-Abspaltung Gute Partei (IYI) – inklusive der umkämpften Hauptstadt Ankara und dem Zentrum Istanbul. Wie Wähler*innenanalysen aufzeigen konnten, waren es dabei vor allem AKP-Wähler*innen, die zu Hause blieben, sowie kurdische Wähler*innen der explizit von der Allianz der Nation ausgeschlossenen linken, pro-kurdischen Demokratischen Partei der Völker (HDP), die für Imamoğlu wählten, die das Wahlergebnis entschieden.

Noch in der Wahlnacht ließ Erdoğan in mehreren Reden durchklingen, dass er das Ergebnis eventuell anerkennen würde. Er verwies darauf, dass die gewählten Bürgermeister*innen der Opposition sowieso nicht einfach so regieren könnten, da die Volksallianz die Mehrheit in den jeweiligen Munizipalräten hielte. Jene Bürgermeister*innen seien deshalb „lahme Enten“. Andere Fraktionen innerhalb des Regimes lehnten jedoch die Wahlergebnisse in Istanbul vehement ab und sprachen von weitflächigem Betrug und dergleichen. Sie erkannten die Gefahren, die auch schon allein mit „lahmen Enten“ einhergehen würden: Die Opposition hätte dann die Möglichkeit, teils jahrzehntelange Netzwerke der Korruption, Misswirtschaft und Vetternwirtschaft und die stadtplanerischen Desaster Erdoğans beziehungsweise der AKP aufzudecken; sowie die Möglichkeit, den riesigen Apparat der Großstadtverwaltung zu nutzen, um bürgernahe Politik zu machen und sich damit mittelfristig als eine Alternative zu präsentieren. Diesen Stimmen war bewusst, dass all dies vor allem sehr schnell zu einem allgemeinen Stimmungsumschwung von deprimierter Angst hin zu kämpferischem Optimismus führen könnte.

Die AKP reichte zuerst Anträge zu einer Neuauszählung von nur einem Teil der Wahlurnen und später aller Wahlurnen in Istanbul ein. Als all dies das Ergebnis nicht wesentlich änderte, reichte sie einen außerordentlichen Antrag zu Annullierung und damit der Anberaumung von Neuwahlen für Istanbul ein. Dennoch brauchte es mehr als einen ganzen Monat, bis die Entscheidung darüber mit Beschluss der Höchsten Wahlbehörde (YSK) vom 6. Mai Realität wurde. In der Zwischenzeit war Imamoğlu schon für 18 Tage als amtierender Bürgermeister tätig gewesen. Dass das Regime nicht einmal mehr „lahme Enten“ tolerieren kann, zugleich aber mehr als einen ganzen Monat braucht, um eine Wahl zu annullieren, zeigt auf, wie inflexibel einerseits, wie unsicher andererseits ihre Macht geworden ist.

Das Interregnum

Als Erdoğan noch wenige Tage vor der Entscheidung der YSK, die Wahlen tatsächlich im Sinne von Erdoğan zu annullieren, für eine Neuwahl argumentierte, klang er noch recht optimistisch: Er verwies ganz explizit auf den 7. Juni 2015 und sagte, dass sie ja auch damals den Gang der Ereignisse umdrehen konnten. Weil die Periode nach jenem 7. Juni eine Serie an IS-Bombenattentaten, massiven Repressionen, einen rücksichtslosen Krieg in mehrheitlich kurdischen Städten und letztlich tausenden Toten mit sich brachte, gingen Kommentator*innen wie wir davon aus, dass auch diesmal die Gewaltspirale eskalieren würde.

Istanbul collage 5j.jpg

Allerdings blieb es relativ ruhig – bis auf den Versuch eines organisierten Mobs am 22. April, den CHP-Vorsitzenden Kemal Kılıçdaroğlu zu lynchen. Bis auf eine vergleichsweise begrenzte und noch fortdauernde Militäroperation in die Kandilberge im Irak kam auch die Kriegsoption nicht auf den Tisch: Obwohl das Regime seit geraumer Zeit sehr klar artikuliert, dass es auch in die restlichen Teile Nordsyriens/Rojavas einmarschieren will, die sich in der Kontrolle der PYD und der SDF befinden, kam kein grünes Licht für eine solche Invasion seitens Russlands und vor allem seitens der USA. Zu einem Alleingang traute sich die Türkei bisher nicht.

Es ist plausibel anzunehmen, dass eine Gewalt- und Repressionsspirale ähnlich der nach dem 7. Juni 2015 schlicht deshalb nicht einsetzte, weil das Regime nicht mehr die Macht dazu hatte und die Kräfteverhältnisse heute andere sind. Die multiplen Krisen haben sich seitdem verschärft: Die Beziehungen mit den USA sind stark angeschlagen, die ökonomische Krise in ihren alltäglichen Auswirkungen ist viel gravierender geworden und der Unmut auch innerhalb der AKP- und MHP-Basis ist zwischenzeitlich so weit verbreitet, dass die Entscheidung zur Wahlannullierung weitestgehend als illegitim aufgefasst wurde und öffentliche Umfragen ergaben, dass viele Volksallianz-Wähler*innen am 23. Juni anders wählen würden. Dazu kamen Gerüchte, wonach die unterschiedlichen Fraktionen innerhalb der AKP wegen des Umgangs mit den Wahlresultaten einander an die Haare gingen – wobei dieser Konflikt manchmal sogar öffentlich wahrnehmbar über die Medien ausgetragen wurde.

Unter solchen Bedingungen schaffte es das Regime nicht, die Initiative zu übernehmen und nach vorne zu preschen wie in ähnlichen Situationen der letzten Jahre. Erdoğan hielt sich überraschenderweise gleich ganz zurück aus dem Wahlkampf, angeblich, weil ihm seine Berater*innen zu verstehen gaben, sein aggressives und polarisierendes Auftreten habe negative Auswirkungen gehabt. Mit hoher Wahrscheinlichkeit wollte er sich und seine Partei dadurch auch von Yıldırıms Anwärterschaft auf das Bürgermeisteramt distanzieren, um so der Wahlwiederholung einerseits einen Anstrich der „Normalität“ zu geben und andererseits sich und seine Partei vor Schaden zu schützen für den Fall, dass Yıldırım nicht gewinnen würde.

Die AKP schaffte es somit nicht, die Wahlkampagne so zu führen, wie sie es aus den Jahren zuvor gewohnt war. Sie konnte die Initiative nicht ergreifen und machte einen schwachen und verwirrten Eindruck. Die Opposition nutzte die Situation aus und konnte das Narrativ glaubwürdig vertreten, dass ihr das Bürgermeisteramt illegitimerweise genommen wurde. Die letzten Versuche der AKP, den Trend umzukehren – alle Wahlforschungsinstitute kamen zum Ergebnis, dass Yıldırım verlieren würde – waren verzweifelt und halbgar: Zum einen wurde seitens der AKP zum ersten Mal nach 17 Jahren an der Macht ein TV-Duell zwischen dem eigenen Kandidaten und dem Oppositionskandidaten zugelassen. Während das Duell dazu dienen sollte, den „Normalitäts“-Anstrich zu stärken und in Teilen die AKP als „Opfer“ böser Machenschaften darzustellen, ging diese Rechnung nicht auf. Wenige Tage vor den Wahlen kehrte Erdoğan zudem doch wieder zurück auf die Bühne, in gewohnter extrem aggressiver Manier gegenüber der Opposition.

In letzter Minute wurde dann noch der verzweifelte Versuch gemacht, die „kurdische Karte“ auszuspielen: Eine leicht mehrdeutige Botschaft des inhaftierten kurdischen Führers Abdullah Öcalan an die HDP, in der er dieser empfahl, sich auf den Aufbau eines eigenständigen demokratischen Poles zu konzentrieren und „unparteiisch“ zu bleiben, wurde von der regimetreuen Presse als Aufruf Öcalans an die Kurd*innen lanciert, Imamoğlu nicht zu wählen. Erdoğan und Bahçeli meinten sogar, einen „Machtkampf“ zwischen Öcalan und dem Rest der kurdischen Bewegung ausmachen zu können. Als klar wurde, dass sich Öcalans Botschaft hauptsächlich auf strategische Perspektiven konzentrierte und er explizit deutlich machte, dass die HDP selber entscheiden müsse, welche Haltung sie zu den Wahlen einnimmt, gerieten die Regimekräfte in Panik. Alle diese letzten Aktionen nutzten im Endeffekt nichts.

Der Wind dreht sich

Der frische Wind des Wandels, der sich in den Ergebnissen vom 31. März ausdrückte, braute sich am 23. Juni zu einem gewaltigen Sturm zusammen, der das Regime kräftig durchschüttelte. Es bedarf noch detaillierterer und ausführlicherer Untersuchungen zum Wähler*innenverhalten und zur Wähler*innenstromanalyse, aber einige Aspekte können jetzt schon hervorgehoben werden: Imamoğlu erhöhte seinen Stimmenanteil in de facto allen Bezirken um zwischen drei und zehn Prozent. Das zeigt, dass die Abwendung von der AKP mehr oder weniger alle Wähler*innenschichten umfasst, da auch die Wahlbeteiligung nur geringfügig gestiegen war. Imamoğlu gewann letztlich 28 der 39 Bezirke in Istanbul, Yıldırım nur 11.

Am 23. März war Yıldırım noch in 23 Bezirken vorne gelegen und İmamoğlu nur in 16! Der Anstieg der Stimmen in CHP-Hochburgen wie Beşiktaş, Kadıköy oder Şişli liegt sicherlich an der höheren Wahlbeteiligung in diesen Bezirken, was darauf schließen lässt, dass desillusionierte Wähler*innen mobilisiert werden konnten; der Anstieg in konservativ-religiösen Bezirken wie Fatih, Üsküdar oder Eyüpsultan deutet jedoch auf eine massive Abwendung der Basis von der AKP hin. Eine Mikroanalyse einer Hand voll Wahllokale in einigen Vierteln von Fatih, in denen islamische Gemeinschaften dominieren, die der AKP treu verbunden sind, zeigt, dass Imamoğlu selbst dort Stimmen zulegen konnte. Andererseits zeigt der Stimmenzuwachs in Bezirken mit einem großen kurdischen Bevölkerungsanteil, dass die Kurd*innen bei dieser Wahl vielleicht sogar noch resoluter für Imamoğlu gestimmt haben.

Das „Epos der Demokratie“

Anders als die meisten Wahlen in den letzten Jahren war die Wahlwiederholung in Istanbul rasch zu Ende – und zwar ohne wesentliche Zwischenfälle. Während an vielen Orten noch Stimmen gezählt wurden, trat Binali Yıldırım mit der Aufhebung des Verbots, über die Wahlergebnisse zu berichten, vor die Mikrofone und erklärte knapp und kühl, Imamoğlu habe die Wahl gewonnen und er gratuliere diesem dafür. Bahçeli und Erdoğan taten es ihm bald darauf mit kurzen Twitter- Statements gleich. Diese ersten kurzen Statements mögen noch nicht den wirklichen Zugang Erdoğans zu dieser Niederlage reflektieren und es ist durchaus möglich, dass er bald noch andere Töne anschlagen wird.

Er insinuierte unlängst, dass Imamoğlu die Bürgermeisterschaft wieder aberkannt werden könnte, da dieser angeblich den Gouverneur der Schwarzmeerprovinz Ordu beleidigt habe. Vermutlich aber wird er wieder auf die Linie nach dem 31. März einschwenken und die Oppositionsbürgermeister als „lahme Enten“ abkanzeln: Schon in den letzten Tagen vor der Wahl sprach er wieder davon, dass die Wahl bloß „symbolisch“ sei und Imamoğlu als Bürgermeister bloßer „Vitrinenschmuck“ wäre. Höchstwahrscheinlich wird Erdoğan versuchen, die Spielräume der oppositionellen Bürgermeister durch die vom Regime dominierten Stadträte einzuschränken und eventuell Gesetze zu entwerfen, die sowohl diese Räte wie auch seine Präsidentschaft in Hinblick auf die Verwaltung von Städten stärken werden.

Allerdings ist die Ausgangslage eine ganz andere als noch nach dem 31. März. Nach dem Wahldebakel ist Erdoğans Stellung geschwächt, er hat signifikant an Charisma eingebüßt und seine Gegner*innen und vermeintlichen Verbündeten sind in Lauerstellung, um sich noch mehr Macht zu holen. Das Auseinanderbröckeln der AKP dürfte sich jetzt ebenfalls rasch beschleunigen – die Gründung einer oder sogar mehrer Parteien von AKP-Abtrünnigen scheint bereits eine beschlossene Sache und nur mehr eine Frage der Zeit zu sein.

Dagegen gilt Imamoğlu als der große Hoffnungsträger im Kampf gegen Erdoğan. Seine versöhnlerische, inklusive politische Rhetorik stellte sich bei den Lokalwahlen als Erfolgsfaktor heraus. In seiner Siegesrede wandte er sich auch betont an Erdoğan und erklärte seine Bereitschaft, enge Verbindungen und Zusammenarbeit zwischen lokalen und zentralen Verwaltungsinstitutionen zu schaffen, um Lösungen für die drängenden Probleme Istanbuls und des Landes zu finden. Er drohte aber auch, dass er sich an die Bevölkerung wenden würde, wenn er mit „politischen Initiativen zur Beschränkung“ seiner Bürgermeisterschaft konfrontiert wäre. Alle Parteien außer der HDP, darüber hinaus auch die meisten Mainstream-Journalist*innen fabulierten noch am Wahlabend vom „Epos der Demokratie“ und der „langen Tradition der türkischen Demokratie“, die wieder der ganzen Welt gezeigt habe, dass die Türkei demokratisch sei.

Es steckt eine tiefere politische Bedeutung hinter diesem offensichtlichen Versuch, die momentane politische Situation von Hegemoniekrise, Faschisierungsprozess und massenhafter Unzufriedenheit zu „normalisieren“. Wir haben schon mehrfach betont, dass die Hauptoppositionskräfte, das heißt in erster Linie – aber nicht ausschließlich – die Kräfte, die in der Allianz der Nation verbündet sind, die Kräfte der Restauration sind. Angesichts der tiefen Krise repräsentieren und organisieren sie diejenigen Kräfte, die staatliche Institutionen und die neoliberale Hegemonie wieder stabilisieren und die Unzufriedenheit der breiten Bevölkerung in „akzeptable“, das System nicht gefährdende Bahnen lenken wollen.

Die Fundamente von Staat und Kapital sollen nicht gefährdet, eine Radikalisierung der Unzufriedenheit und des Widerstandes verhindert werden. In dem Maße jedoch, in dem das Regime angesichts der sich vertiefenden Krise immer unflexibler wird und die Kräfte der Restauration ihre respektive Position angesichts der steigenden Unzufriedenheit verbessern können, im dem Maße werden sie geradezu dazu gezwungen, eine deutlichere und resolutere Haltung einzunehmen wie derzeit im Rahmen der Kommunalwahlen. Während die Kräfte der Restauration einerseits das oppositionelle Potential in der Gesellschaft zu mobilisieren versuchen, appellieren sie zugleich an das Regime, sie in den Machtblock zu integrieren. Das Gerede vom „Epos der Demokratie“, der „Inklusion aller“ und dem „Ende der Polarisierung“ zielen darauf ab, den Konflikt der Blöcke zu entschärfen und gleichzeitig die oppositionellen und widerständigen Regungen in der Bevölkerung zu integrieren und zu befrieden.

Eine Bresche in der Belagerung?

Das „Epos der Demokratie“ besteht in erster Linie aus einem weiteren Zerfall des Regimes und dem Aufstieg der Kräfte der Restauration. Dieses „Epos“ lässt jedoch in letzter Instanz die politische Einheit und Kohärenz vermissen, die notwendig wäre, um die folgenden drei strukturellen Probleme zu lösen:

Erstens wird sich die ökonomische Krise weiter vertiefen und dabei weiterhin ernste soziale Probleme mit sich ziehen. Der Kampf um die Verteilung der Kosten der Krise zwischen den verschiedenen gesellschaftlichen Klassen wird ein Hauptterrain des politischen Kampfes darstellen. Kein Teil des „Epos der Demokratie“ hat – jenseits der üblichen neoliberalen Plattitüden – einen klaren Plan, um sich diesem Problem zu stellen. Ein radikaleres, transformatives Programm steht sowieso außer Diskussion. Die ökonomische Krise wird der mangelhaften Rechtsstaatlichkeit und Transparenz, der Erosion der demokratischen Institutionen und dergleichen mehr zugeschrieben, womit der Fokus von den zugrundeliegenden Klassenverhältnissen auf Oberflächenphänomene gelenkt wird. Auch innerhalb der HDP gibt es verschiedene Stimmen und einige davon haben sich in diese Reihen des Status quo eingereiht und sich vom radikaleren Programm aus 2015 verabschiedet.

Zweitens bildet das „Präsidialsystem“ den bisherigen Gipfelpunkt einer bestimmten Entwicklung: Alle Formen der Kontrolle von Machtausübung sind zunichte gemacht worden und grundlegende Freiheiten und Rechte werden massiv beschnitten. Eine politische Kultur des Autoritarismus schreitet voran und alle gesellschaftlichen Schichten sind von der offenen Repression in Beschlag genommen. Wenn es im Zuge dieser Wahlen einen „Epos der Demokratie“ zu erzählen gäbe, dann bestünde dieser aus dem Widerstand der demokratischen Kräfte gegen das Regime und den Prozess der Faschisierung. Ein politischer Diskurs, der diese Realität verschleiert und das „Präsidialsystem“ und wofür es steht kaum mehr erwähnt – und das ist genau das, was dieses Gerede eigentlich beabsichtigt –, entlarvt sein Desinteresse an einer genuinen Demokratisierung.

Drittens stellt die „kurdische Frage“ die Achillesferse des „Epos der Demokratie“ dar. Die taktische Allianz, die CHP, IYI und die HDP angesichts des relativ friedlichen Kontexts der Lokalwahlen zusammenbrachte, wird höchstwahrscheinlich im Kontext einer militärischen Operation im In- oder Ausland erneut auseinanderfliegen. Im Zentrum der Politik in der Türkei steht ein Paradox: In der momentanen Lage der Kräfteverhältnisse und Allianzen sind sowohl das Regime, wie auch die restaurative Opposition auf die politische Unterstützung der Kurd*innen angewiesen, um zu gewinnen. Aber keines der beiden Lager hat Interesse an einem substantiellen Friedensprozess, der nämlich ein Programm zur radikalen Transformation und Demokratisierung der Grundfesten der Republik Türkei beinhalten müsste.

Angesichts dieser Konstellation dürfen Sozialist*innen und Revolutionär*innen nicht nur Gehilfen der restaurativen Opposition werden, ihre Funktion wäre dann einzig auf das Einsammeln linker Stimmen reduziert. Während einige linksradikale Organisationen in Abstraktion zu wichtigen konkreten Kämpfen verbleiben und ihre bekannte Unfähigkeit, konkrete politische Konjunkturen zu verstehen, zum Ausdruck bringen, gibt es andererseits innerhalb der Linken in der Tat eine Tendenz zum Parlamentarismus und zur Selbstauflösung in einer diffusen „demokratischen Front“. Eine Integration in eine solche „demokratische Front“ – dominiert von den Kräften der Restauration und wofern ohne einen klaren eigenen Standpunkt hinsichtlich der Notwendigkeit unabhängiger Organisierung der popularen und revolutionären Kräfte – ist dazu verdammt, in einer Niederlage der genuin popular-demokratischen Kräfte zu enden.

Die Aufgabe der Linken ist es, die Möglichkeiten, die auf Grundlage der derzeitigen Situation entstehen, zu nutzen und sich auf den Aufbau unabhängiger popularer Organisationen und ihrer eigenen Alternativen zum Status Quo zu konzentrieren. Dabei sollte die Linke Möglichkeiten des Ausschlachtens von Widersprüchen zwischen den Herrschenden nicht ignorieren und auch Wege für potentielle Allianzen mit den jeweiligen Basen der herrschenden Parteien und der Parteien der Restauration nicht in den Wind schlagen.

In seiner Geschichte hat Istanbul viele stolze Namen geführt. Der vielleicht schönste ist der-i sa’adet, das Tor zur Glückseligkeit. Dieses Tor in eine Bresche in der faschistischen Belagerung des Landes zu verwandeln und gleichzeitig eine popular-revolutionäre Alternative zum kapitalistischen Restaurationsprojekt zu schaffen, ist die historische Aufgabe der Revolutionär*innen. Die Bedingungen für einen Sprung nach vorne sind wieder einmal reif.

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-ND 3.0) Lizenz.


Grafrikquellen      :

Oben    —         Der neue Bürgermeister von Istanbul, Ekrem Imamoğlu von der Republikanischen Volkspartei (CHP), auf Wahlkampftour in Silivri, Juni 2019. / CeeGee (CC BY-SA 4.0


2.) von Oben      —     Collage of Istanbul (improved version of Istanbul collage 5g.jpg.)

Abgelegt unter Asien, Kommunalpolitik, Opposition, Positionen | Keine Kommentare »

Postenkampf in Brüssel

Erstellt von DL-Redaktion am 29. Juni 2019

Warum nennen wir die EU nicht gleich Deutsch-Europa?

File:Emmanuel Macron and Angela Merkel (Frankfurter Buchmesse 2017).jpg

Dieses ist kein Ausschnitt aus der Fernsehserie : „Der Bauer und das liebe Vieh“ !!

Eine Kolumne von

Lange galt, dass die Franzosen in Brüssel alles Mögliche besetzen. Mittlerweile sind wir Deutschen dabei, Anspruch auf so ziemlich alle Posten in der EU zu erheben. Ein gefährlicher Trend.

Wir Deutschen haben es in Europa nicht immer einfach. Seit zwanzig Jahren gibt es den Euro, und wir haben kein einziges Mal den Chef der Europäischen Zentralbank (EZB) gestellt. Und den letzten deutschen Präsidenten der EU-Kommission gab es irgendwann Ende der Sechzigerjahre. Da gab es noch nicht mal Handys. Höchste Zeit, den Zustand zu beheben.

So oder so ähnlich klingt, was unsere Kanzlerin mit patriotischem Pathos ausgegeben hat: dass bei der für Sonntag geplanten Gipfel-Entscheidung wenigstens einer der beiden gerade zu besetzenden Topposten an einen Deutschen gehen muss. Was anhand oben erwähnter Fakten natürlich auch zwingend erscheint.

Jetzt wollen wir unserer Kanzlerin bei den Gipfel-Verhandlungen nur Gutes wünschen. Könnte allerdings sein, dass nicht jeder in Europa uns anno 2019 noch so richtig zu bemitleiden bereit ist. Um es vorsichtig auszudrücken. Und nicht zu Unrecht.

Gut möglich, dass der eine oder andere beim Brüsseler Feilschen daran erinnert, warum die Deutschen bislang noch keinen Euro-Chef gestellt haben. Immerhin war das der Deal, weil ja die Euro-Notenbank schon nach Bundesbank-Vorgaben konzipiert war, der Sitz in die deutsche Stadt Frankfurt am Main gelegt worden war – und der erste EZB-Präsident zwar nicht Deutscher war, dafür war der Niederländer von einem Deutschen währungspolitisch aber kaum unterscheidbar. Hätte er einen deutschen Pass gehabt, hätte man die Sache gleich Bundesbank für alle nennen können.

Der damalige Kanzler Helmut Kohl ließ zur Sicherheit trotzdem noch dafür sorgen, einen Deutschen zum Chefvolkswirt der EZB zu machen – Otmar Issing. Der wiederum bestimmte für acht Jahre die Strategie der Bank mit. Und auf ihn folgte, raten Sie mal: ein Deutscher. Hatten wir erwähnt, dass in diesen Ur-Eurojahren bei der EU-Kommission ein Deutscher die Generaldirektion für Wirtschaft leitete – die, die über die Politik von Regierungen wachte?

Als bei der EZB der Niederländer Wim Duisenberg ging, folgte ein Franzose, also Jean-Claude Trichet, der allerdings eher als so eine Art deutschester Franzose gehandelt wurde, wenn es um Geldpolitik ging. Ähnlich wie sich in Italien der zwischenzeitliche EU-Wettbewerbskommissar Mario Monti als deutscher Italiener veralberte.

Phänomenale Deutschenvermehrung in Spitzenpositionen

Jetzt könnte man sagen, dass das alles ja schon eine Weile her ist – sodass jetzt mal ein Deutscher EU-Kommissionschef oder EZB-Präsident werden muss. Möglich sogar, dass die Deutschen damit locker durchkämen – wenn es nicht in der Zwischenzeit eine geradezu phänomenale Deutschenvermehrung in etlichen anderen Spitzenpositionen gegeben hätte – und zwar seit Beginn der Eurokrise. Weil die Deutschen das Geld geben. Oder so.

  • Von einem Deutschen wird seit Jahren der riesige Euro-Rettungsfonds ESM gemanagt: Klaus Regling, der qua Amt möglicherweise wichtigste Mann in der kommenden Krise. Das ist der, der lange Jahre die EU-Wirtschaftsabteilung geführt hat.

Werner Hoyer 2017.jpg

  • Bei der Europäischen Investitionsbank (EIB) steht mit Werner Hoyer ebenfalls einer aus Deutschland an der Spitze.
  • Die Chefin des Europäischen Bankenabwicklungsfonds ist: eine Deutsche – Elke König.
  • Und der Präsident des Europäischen Rechnungshofs heißt Klaus-Heiner Lehne – aus dem Land, nach dem sein Name klingt.

Anderswo besetzten die Deutschen mittlerweile die noch wichtigeren Positionen in zweiter Reihe, unkt der langjährige französische Brüssel-Korrespondent Jean Quatremer:

  • Als oberster Beamter der EU gilt der Generalsekretär der Kommission: Martin Selmayr, aus Sie-wissen-schon.
  • Im EU-Parlament heißt der Generalsekretär Klaus Welle.
  • Und die Generalsekretärin beim Europäischen Auswärtigen Dienst ist Helga Schmid. Germany.
  • Die wichtigste Fraktion im Europaparlament wird derweil seit Jahren von einem Landsmann geleitet, das Parlament lange Zeit von einem gewissen Martin Schulz.
  • Selbst der Noch-Kommissionschef Jean-Claude Juncker aus dem schnuckeligen Luxemburg wäre das nicht geworden, so Quatremer, wenn er nicht von der deutschen Kanzlerin dort hingeschickt worden wäre.

Quelle     :   Spiegel-online            >>>>>        weiterlesen


Grafikquellen       :

Oben     —        Emmanuel Macron and Angela Merkel (Frankfurter Buchmesse 2017)

Source Foire du Livre de Francfort 2017
Author ActuaLitté

This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on by the administrator or reviewer Majora, who confirmed that it was available on Flickr under the stated license on that date.


Unten      —        Werner Hoyer, President, European Investment Bank, EIB

Abgelegt unter Europa, Kriegspolitik, Nordrhein-Westfalen, Positionen | Keine Kommentare »

Klimaproteste Deutschland

Erstellt von DL-Redaktion am 25. Juni 2019

So gut sortiert wie nie

Ende Gelände Demonstration 27-10-2018 02.jpg

Aus Aachen, Viersen und Hochneukirch

von Martin Kaulund Katherina Schipkowski

 Es ist Samstag, 13.09 Uhr, als es an diesem Wochenende dann ausnahmsweise doch einmal unübersichtlich wird: Hunderte Menschen biegen plötzlich auf einer Landstraße in Nordrhein-Westfalen, zwischen Lützerath und Immerath, links ab ins freie Feld. Alle rennen nun so schnell sie können – stolpern, aufstehen –, erst über Sand, dann durch ein Kornfeld und einen Kartoffelacker, zur Tagebaukante hin, in Garzweiler. Ein paar Dutzend Polizisten, wie verloren in der Menge, versuchen zu fangen, was zu fangen ist, aber sie fangen nicht viel. Diese Erstürmung dauert 16 Minuten.

Am Horizont, gleich da vorne, liegt der Tagebau Garzweiler, eines der größten Braunkohlefördergebiete Europas, und schon rutschen die ersten Besetzerinnen und Besetzer hinab. Sie schlittern einen sandigen, steilen Abhang hinunter. Sie haben ihr Ziel erreicht

So eine Hektik, so eine Bewegung: Sie ist zur Ausnahmesituation geworden in einem Protestambiente, in dem fast jede Bewegung inzwischen wohlkalkuliert ist. Über eintausend Menschen erstürmten am Wochenende den Tagebau in Garzweiler, Hunderte blockierten über Stunden und Tage die nahe gelegenen Schienengleise am Kohlekraftwerk Neurath und am rund 40 Kilometer entfernten Hambacher Forst.

Zehntausende gingen zuvor in Aachen und Hochneukirch für ein rasches Ende der Kohleförderung und eine effektivere Klimaschutzpolitik auf die Straßen. Es waren wieder viele Bewegungsrekorde dabei, eine Neugeburt der Anti-Kohle-Bewegung in Deutschland und vor allem: Ausdruck einer Veränderung.

Eine Wachstumsgelegenheit

Die radikale Umweltbewegung ist einfühlsam geworden über die Jahre, erwachsen, etabliert und heute wohl so organisiert wie nie zuvor. Wäre diese Bewegung ein Mensch, dann ein Elternteil. Hätte sie eine Küche, dann eine saubere. Jetzt hat diese Bewegung Nachwuchs bekommen: Die Schülerinnen sind da und die Schüler, die Kinder von Fridays for Future, die in weniger als einem Jahr schafften, was radikale Kraftwerks- und Tagebaubesetzer seit über zehn Jahren versuchen: dass ganz Deutschland über Klimawandel redet.

„Lio“ nennt sich der 18-jährige Junge mit Lockenkopf, der in einem Zirkuszelt im Protestcamp Viersen, 20 Kilometer entfernt vom Tagebau Garzweiler, so wirkt, als wachse er gerade einen ganzen Meter. Er steht kerzengerade und nimmt seine Sache sehr ernst, als er jungen Schülerinnen und Schülern wie ein Lehrer an einer Schautafel erklärt, wie sie gemeinsam nach Aachen kommen am Freitag, zur großen Fridays-for-Future-Demonstration und wie es sich anstellen lässt, dass das Zugticket für sie nur 9,20 Euro kostet statt 18,70 Euro.

„Lio“ ist zum ersten Mal bei einer solch großen Sache dabei und man merkt es ihm an. Links und rechts von ihm finden Protesteinführungen statt und Strategiediskussionen. Das ist ja das Besondere hier: Radikale Umweltschützer aus ganz Europa sind gekommen, aus Italien, Spanien, Frankreich und Großbritannien, viele von ihnen langjährig erprobt in allen möglichen Formen des zivilen Ungehorsams – aber dies ist jetzt ihre Chance: Der Erfolg der jungen Schülerbewegung, die am Freitag in Aachen rund 40.000 Menschen auf die Straße brachte, ist auch für die kapitalismuskritische Linke eine Wachstumsgelegenheit.

Quelle      :          TAZ           >>>>>           weiterlesen

Protestbewegung gegen Braunkohle

Jetzt kommt die Abrechnung

Ende Gelände - controll at Düren trainstation.jpg

Von Bernd Müllender, Köln

Die Aktivisten von Ende Gelände werfen der Polizei unverhältnismäßige Gewalt vor. Gegner machen im Netz indes Stimmung mit einem gefakten Müll-Bild.

Als die letzten der 40.000 Kids von Friday for Future Aachen am Sonntag wieder verlassen hatten, staunten alle nicht schlecht: den Abfall selbst weggeräumt; vorbildlich, hieß es von der Stadt. Im Internet aber wurde ein Bild verbreitet mit tonnenweise Müll am Straßenrand der Demostrecke. Die üblichen Empörungsreflexe kamen prompt: Dreckskids, Schweinerei. Indes: Das Bild war geklaut und stammte vom letzten Rosenmontagszug. Tataaa.

Am Montag sind die HetzerInnen im Netz wieder steilgegangen, kaum dass die Initiative „Ende Gelände“ ihre Besetzungen im Braunkohlerevier Garzweiler beendet hatte. Schimpfe über Müll, zertrampelte Felder mit ungezählten Opfern rheinischer Möhrchen und Zuckerrüben, dazu angeblich viele zurückgelassene weiße Demo-Anzüge, das Markenzeichen der Ende-Gelände-Leute. Bauer Willi Kremer-Schillings aus Rommers­kirchen beklagt sich auf seiner Homepage, ProtestiererInnen seien „über ein abgeerntetes Petersilienfeld gewandert“, nennt das „unfassbar!“ und klagt allgemein: „Asoziale Klimagegner latschen durch Äcker.“ Was nur sind „Klimagegner“?

Kathrin Henneberger, Sprecherin von Ende Gelände, zur taz: „Wenn es Schäden gegeben hat, sollen sich Bauern und Bäuerinnen direkt bei uns melden. Ernteausfälle erstatten wir. So haben wir das schon immer gehalten.“ Gleichzeitig twitterte die Polizei von „zahlreichen Flurschäden auf Feldern ortsansässiger Landwirte“, diese mögen Strafanzeige erstatten. Henneberger sagt: „Die wissen genau, dass wir das selbst regeln. Aber die Polizei will lieber alle jeck machen.“

Quelle      :        TAZ          >>>>>        weiterlesen


Grafikquellen     :

Oben     —     Demonstration von Ende Gelände vom Protestcamp südlich von Düren geplant/angemeldet nach Morschenich.

Abgelegt unter Deutschland, Kriegspolitik, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

Herbeigesehnter Bürgerkrieg

Erstellt von DL-Redaktion am 24. Juni 2019

 Eine historische und aktuelle Spurensuche.

Björn Höcke - Juni 2015.JPG

Von David Bebnowski und Dominik Rigoll

Was hat Höckes AfD mit der Hannibal-Affäre und dem Lübcke-Mord zu tun? Eine historische und aktuelle Spurensuche.

Im Jahr 1952 flog eine Gruppe von Veteranen der Wehrmacht und der Waffen-SS auf, die in den hessischen Wäldern für den „Tag X“ einer sowjetischen Invasion trainierte. Die Polizei beschlagnahmte Waffen, antikommunistisches Propagandamaterial, aber auch Proskriptionslisten mit den Namen von Sozial- und Christdemokraten, die dem Widerstand gegen den Natio­nal­sozialismus angehört hatten. Die aufgeflogene Gruppe war davon ausgegangen, dass diese am „Tag X“ mit den Sowjets kooperieren würden.

Die sogenannte Partisanenaffäre wurde nicht als ein großer Skandal wahrgenommen, obwohl der hessische Ministerpräsident eine breite Debatte darüber einforderte. Der Staatsanwalt Fritz Bauer, der gegen einen der Paramilitärs ermittelte, musste den Fall an die Bundesanwaltschaft abgeben. Der Bundesgerichtshof bescheinigte der Gruppe, die „freiheitliche demokratische Grundordnung“ zu schützen. Tatsächlich hatte sie im Dienst der CIA gestanden, deren „Stay Behind“-Einheiten rechtsoffenen Berufssoldaten in den Jahren vor der Bundeswehrgründung einen Job und einen Lebensinhalt boten.

Recherchen der taz ergaben, dass in der Bundesrepublik auch gegenwärtig ein bewaffnetes rechtes Untergrundnetzwerk existiert, das sich auf den „Tag X“ vorbereitet. Mehrere Mitglieder daraus sollen Listen mit politischen Gegnern erstellt haben, gegen sie wird gegenwärtig ermittelt. Erneut scheinen die Paramilitärs von den Geheimdiensten zumindest geduldet zu werden. Als Kopf gilt André S., ein inzwischen ehemaliger Soldat des Kommandos Spezialkräfte, der über gute Verbindungen zum MAD verfügt, zu der für die Kontrolle „extremistischer“ Umtriebe in der Truppe zuständigen Behörde.

Der Deckname von André S. ist Hannibal. Franco A., der Soldat, der 2017 wegen Terrorismusverdacht verhaftet wurde, weil er Mordanschläge auf Linke geplant haben soll, um sie dann möglicherweise Islamisten in die Schuhe schieben zu können und so eine Gewaltspirale in Gang zu setzen, bewegte sich in Hannibals Netzwerk. Er war unter anderem Mitglied in einer Chatgruppe, die Hannibal gegründet hatte.

Wie schon im Fall der Partisanenaffäre ermittelt nun auch in der Hannibal-Affäre die Bundesanwaltschaft. Tatsächlich geben nicht nur die seit den 1990er Jahren erstarkte rechte Gewalt, sondern auch die in der Szene grassierenden Zukunftsszenarien Anlass, die Sache ernst zu nehmen. Bücher mit beschwörenden Titeln wie „Zurüstung zum Bürgerkrieg“ malen das Szenario eines von den „globalistischen“ Eliten gesteuerten oder geduldeten „großen Austauschs“ der Bevölkerungen Europas durch Mi­gran­ten an die Wand.

Der Effekt dieser Fiktion ist die Annahme einer Notwehrsituation: In einem Clash am „Tag X“ sieht sich die extreme Rechte als letzte abendländische Bastion zum gewaltsamen Widerstand legitimiert.

Der Fall erinnert an Franz Oppenhoff

Manche besonders konsequente Rechte, die den Bürgerkrieg nicht abwarten können, fangen schon jetzt damit an und praktizieren ihren ganz persönlichen „Tag X“. Der mit Fantasieorden behangene Anders Breivik ist so ein Typ, aber wohl auch Stephan E., der mutmaßliche Mörder von Walter Lübcke.

Der Mord an dem CDU-Politiker steht in einer langen Reihe rechter Terrorakte, die im März 1945 mit der Ermordung des ersten von den Amerikanern eingesetzten Aachener Bürgermeisters, Franz Oppenhoff, begann. Wie Lübcke war auch Oppenhoff ein Konservativer und Christ, der partout nicht das tat, was Nazis von seinesgleichen erwarten. Wie Lübcke wurde auch Oppenhoff vor seinem eigenen Haus mit einer Schusswaffe „hingerichtet“.

Denkmal Oppenhoffallee.jpg

Den Mord an Oppenhoff besorgte ein Kommando, das aus SS-Männern, Polizisten, einem Hitlerjungen und einer BDM-Führerin bestand, die über Ortskenntnisse verfügte. Es ist zu hoffen, dass es im Mordfall Lübcke keine Absprachen zwischen rechten Aktivisten und rechtsoffenen Angehörigen der Sicherheitsapparate gab. Ob Lübckes Name etwa auch auf einer der Listen stand, die bei dem Bundeswehrsoldaten Franco A. gefunden wurden, wissen wir nicht.

 Unwahrscheinlich ist es leider nicht, denn herbeigesehnt wird der Bürgerkrieg inzwischen nicht mehr nur von ausgewiesenen Rechtsextremisten wie dem ­Mörder von Christchurch oder der „Identitären Bewegung“, sondern auch in einem Gesprächsband, den Björn Höcke letzten Sommer vorgelegt hat – im selben Verlag, der auch Alexander Gaulands „Anleitung zum Konservativsein“ vertreibt.

Höcke kommuniziert in dem Buch quasi auf mehreren Tonspuren gleichzeitig. Wer etwas Bedeutungsvolles hören möchte, wird die richtigen Klänge vernehmen. Einerseits ist das Buch voll von Absagen an Gewalt, gerade auch gegen Migranten, während als eigentlicher Feind der linke oder liberale „Gutmensch“ gezeichnet wird. Andererseits umreißt Höcke ein „großangelegtes Remigrationsprojekt“ zur „geordneten Rückführung der hier nicht integrierbaren Migranten in ihre ursprünglichen Heimatländer“.

Besonders ins Auge fallen zudem jene Stellen, in denen er darüber sinniert, wie wahrscheinlich doch ein künftiger bürgerkriegsähnlicher Konflikt sei, angesichts der „millionenfachen Invasion von Fremden nach Europa“ und des „Totalversagens der politischen Klasse“.

Quelle      :        TAZ         >>>>>         weiterlesen


Grafikquellen       :

Oben      —       Björn Höcke im Gespräch am Tag der offenen Tür im Thüringer Landtag am 13. Juni 2015

Abgelegt unter Deutschland, L. Thüringen, Nordrhein-Westfalen, P.AfD | Keine Kommentare »

Spahns U-Boot-Politik

Erstellt von DL-Redaktion am 24. Juni 2019

Die Kunststücke des Herrn Spahn

EPP Helsinki Congress in Finland, 7-8 November 2018 (30828525517).jpg

Wie der Gesundheitsminister konservative Werte zerstört

von Michael Kanert

Manchmal kann man den Eindruck haben, dass Jens Spahn, wenn er morgens ins Büro geht, einfach die Tür verwechselt. Denn gleich neben dem Bundesgesundheitsministerium steht der Berliner Friedrichstadtpalast. Dort werden prächtige Revuen aufgeführt mit Tanz und Musik und atemberaubenden Effekten. Derzeit auf der Bühne: der Herr Minister.

„In 10 bis 20 Jahren werden wir den Krebs besiegt haben“, ruft er ins Mikrofon. Erster Applaus, das Eis ist gebrochen. Dann seine 300-Millionen-Nummer. Spahn zaubert diese Summe direkt in die Taschen von Krankenhaus-Vertretern in der ersten Reihe. Das Publikum ist begeistert, denn niemand hat etwas gesehen, weil Spahn die Geldscheine geschickt in einem 200-seitigen parlamentarischen Papierberg versteckt hat. Jetzt hält es auch die Apotheker nicht mehr auf ihren Sitzen. „Wir auch“, skandieren sie. Und noch während Jens Spahn sein Autogramm schwungvoll auf einen 150-Millionen-Scheck schreibt, dreht er sich in rasendem Tempo plötzlich um die eigene Achse und schleudert bunte Sprechblasen in die Menge: „Brexit“, „Fettabsaugen“, „Schüler-Demo“, „Abtreibung“. Zugegeben, dieses imaginierte Theater ist ein schräges Bild – und durchaus auch etwas ungerecht, wenn man auf manch sinnvolle Initiative des Bundesgesundheitsministers schaut. Aber warum kommen einem solche Bilder in den Kopf, wenn man an Jens Spahn denkt?

Den Satz mit dem Krebs hat Jens Spahn tatsächlich im Februar gesagt.[1] Allerdings erntete er dafür keinen Applaus, sondern Buhrufe aus dem Fachpublikum. „Unverantwortlich“, kritisierte die Deutsche Stiftung Patientenschutz[2] und von der „Süddeutschen Zeitung“ gab es medizinischen Nachhilfeunterricht. „Krebs ist nicht eine Krankheit. Er summiert tausend verschiedene Krankheiten. Jeder Krebs hat andere molekulare Signaturen und weist andere Zeichen der Bösartigkeit auf.“[3] Doch Jens Spahn jongliert ungeniert weiter mit medizinischen Fachbegriffen und Zahlen. Nächstes Thema: Fettabsaugen. „Bis zu drei Millionen Frauen leiden täglich darunter, dass die Krankenkassen ihre Therapie nicht bezahlen“, behauptete der Gesundheitsminister schon im Januar. Angeblich leiden alle diese Frauen an einer krankhaften Verteilung des Fettgewebes (Fachbegriff: Lipödem).[4] Diese Krankheit kann starke Schmerzen hervorrufen und ist nicht zu verwechseln mit den Fettpölsterchen, die durch zu viel Couch und Chips entstehen. Jede zehnte Frau in Deutschland wird von den Krankenkassen im Stich gelassen? Wenn das stimmt, kann dagegen offenbar nur einer helfen: Jens Spahn. Der erwünschte Eindruck ist klar: Hier agiert ein tatkräftiger Politiker, der wirklich zupackt, um Mitbürgerinnen in Not zu helfen.

Spahns Plan: Er will selbst bestimmen, welche Behandlung die gesetzlichen Krankenkassen bezahlen müssen – ohne Kontrolle durch das Parlament oder ein kritisches medizinisches Fachgremium. Dann will er den drei Millionen Frauen das sogenannte Fettabsaugen bezahlen (Fachbegriff: Liposuktion). Tatsächlich aber gibt es diesen Medizin-Skandal gar nicht in der behaupteten Form. Jens Spahn hat nur ein paar Nullen durcheinandergewirbelt. Vermutlich leidet nicht jede zehnte Frau an einem Lipödem, sondern höchstens jede hundertste, möglicherweise sogar nur jede tausendste. Die falsche Millionen-Zahl wurde vor Jahren in einem medizinischen Fachbuch veröffentlicht, ist aber von der Autorin widerrufen worden – weil sie nach ihren eigenen Angaben auf einer „mangelhaften Doktorarbeit“ beruhte.[5]

Wie aber verhält es sich mit dem Fettabsaugen im Einzelfall, als Nothilfe durch den zupackenden Minister? Mit gutem Grund entscheiden in Deutschland weder die Krankenkassen noch Minister darüber, welche Behandlung von den Kassen bezahlt werden darf oder muss. Darüber wacht ein besonderes Gremium, das mit den gegenläufigsten Interessengruppen besetzt ist: der Gemeinsame Bundesausschuss. Dort sitzen Vertreter der Ärzte, Krankenhäuser und Krankenkassen. Auch die Vertreter von Patienten und die Hersteller von Medizin-Produkten können Anträge auf Zulassung stellen und müssen vor einer Entscheidung gehört werden. Der Gemeinsame Bundesausschuss erteilt nur dann eine Zulassung, wenn genügend wissenschaftliche Studien vorliegen, die Nutzen und Risiken der Behandlung erforscht haben.

Obwohl das Fettabsaugen nach Angaben von Ärzten seit Jahren erfolgreich gegen Lipödeme praktiziert wird, ist die Studienlage erstaunlich dünn. Der Gemeinsame Bundesausschuss hat daher bislang keine Zulassung erteilt. Er gab aber sogar selbst eine Studie in Auftrag, die noch nicht abgeschlossen ist. Das Bundessozialgericht bestätigte mehrfach, dass sich der Gemeinsame Bundesausschuss damit rechtmäßig verhalten hat. Daher ist das Thema „Fettabsaugen“ kein Anlass für Spahnsche Alarmmeldungen. Es ist – im Gegenteil – ein Beispiel dafür, dass das bestehende Kontrollsystem der Krankenversicherung für neue Behandlungsmethoden passabel funktioniert. Dennoch unternimmt Spahn derzeit bereits den dritten Anlauf, um den Bundestag von einer Machtverschiebung zu seinen Gunsten zu überzeugen.

Zugegeben, der direkte Zugriff auf die riesigen Geldströme des Gesundheitswesens ist reizvoll. In Deutschland wird jeden Tag (!) mehr als eine Milliarde Euro für die Gesundheit ausgegeben, überwiegend durch staatliche Einrichtungen. Ein erheblicher Teil der staatlichen Milliarden stammt gar nicht aus Steuergeldern. Es sind die Arbeitnehmer, Rentner, die kleinen Selbstständigen und die Arbeitgeber, die mit ihren Sozialversicherungsbeiträgen die Krankenkassen finanzieren. Deshalb wird diesen Beitragszahlern seit jeher ein besonderes Mitbestimmungsrecht gegeben. Durch die – oft unterschätzten – Sozialwahlen werden die Vertreter bestimmt. Sie sitzen im Verwaltungsrat und wählen den Vorstand jeder kleinen Ortskrankenkasse genauso wie beim einflussreichen Spitzenverband der gesetzlichen Krankenversicherung in Berlin.

Jedem wirklich Konservativen muss bei diesem Modell – eigentlich – das Herz höher schlagen: Der Bürger ist keiner anonymen Staatsbürokratie ausgeliefert. Er kann Eigenverantwortung übernehmen. Das System der gesetzlichen Krankenversicherung wird dadurch auch besser in der Gesellschaft verwurzelt. Die Vertreter von Arbeitgeberverbänden oder Gewerkschaften bringen ihre Sicht ein. Sie sind Vermittler für Verbesserungsvorschläge oder Kritik an verkrusteten Strukturen. Umgekehrt liefern sie in ihre Verbände auch die Rückmeldung, dass manche zunächst unverständliche Verfahrensweise doch ihren guten Grund hat. In der Praxis könnten die gewählten Vertreter durchaus noch selbstbewusster auftreten, damit zum Beispiel die Verwaltung der Krankenkassen bürgerfreundlicher gestaltet wird und nicht den Sparplänen externer Unternehmensberater ausgeliefert ist. Jens Spahn aber geht genau den umgekehrten Weg. Er bläst zum Angriff auf die Selbstverwaltung und fängt beim unbequemen Spitzenverband der Krankenkassen an. Dort sollen künftig nur noch hauptamtliche Mitarbeiter im Verwaltungsrat sitzen, um – so heißt es im Gesetzentwurf – eine „Professionalisierung“ zu erreichen. Man könnte an eine kleine Anleihe bei FDP-Chef Christian Lindner denken, der ja auch den Klimaschutz allein den „Profis“ überlassen will.

Wie Jens Spahn sich den Umgang mit „seinen“ Profis vorstellt, lässt eine Passage aus seiner neuen Biographie erahnen.[6] Dort wird eine E-Mail des Personalrats aus dem April 2018 zitiert: In „gefühltem Minutentakt“ habe Spahn gleich nach seinem Amtsantritt das Ministerium umgebaut. Und alle neuen Mitarbeiter hätten irgendwann vorher schon mal mit Spahn zusammengearbeitet: „Der Personalrat fragt sich, ob die persönliche Nähe zum Minister die neue Interpretation des Hauses bei der ‚Bestenauslese‘ ist.“

Die Profi-Freunde des Jens Spahn

Fehlt Jens Spahn der innere Kompass bei der Abgrenzung von öffentlichem Amt und persönlichen Beziehungen? Kurzer Blick zurück: 2006 war Jens Spahn bereits ein einflussreicher Bundestagsabgeordneter als Obmann der CDU im Gesundheitsausschuss. Da gründete er mit seinem ehemaligen Büroleiter und einem Bekannten namens Max Müller eine Gesellschaft bürgerlichen Rechts, welche die Beratungsagentur „Politas“ verwaltete. Der „Focus“ berichtete später, dass „schwerpunktmäßig Klienten aus dem Medizin- und Pharmasektor“ beraten wurden.[7] Spahn sprach dagegen nur allgemein von „Kunden aus unterschiedlichen Branchen“. Obwohl die Firma die meiste Zeit gar keine Gewinne ausgeschüttet haben soll, ließ Spahn vier Jahre verstreichen, bis er seine Anteile verkaufte. Durch den Verkauf wollte er „den Eindruck eines möglichen Interessenkonflikts vermeiden“. Die Beteiligung war eine „Dummheit“, wird Spahn in seiner Biographie zitiert. Was aber hat er daraus gelernt? In seiner Zeit als Staatssekretär im Finanzministerium hat er sich mit 15 000 Euro an einer Firma beteiligt, die eine Software zur Erstellung von Steuererklärungen entwickelte. Nach öffentlicher Kritik sah er in seiner Beteiligung zwar „kein Problem“[8], verkaufte aber wenige Tage später seine Anteile und zahlte auch die 3000 Euro staatliche Zuschüsse zurück, die er im Zusammenhang mit seiner Investition erhalten hatte.[9]

Wie es bei dieser Art Dummheiten so ist – richtig dumm wird es, wenn sie einen später wieder einholen. Max Müller, der Geschäftspartner aus der „Politas“-Zeit, ist inzwischen „Chief Strategy Officer“ im Vorstand der Versandapotheke DocMorris. Und damit wird die aktuelle Beziehung zwischen ihm und dem Bundesgesundheitsminister ganz amtlich. DocMorris pocht auf ein Urteil des Europäischen Gerichtshofs. Danach muss Deutschland der Versandapotheke die Möglichkeit einräumen, Arzneimittel in Deutschland billiger zu verkaufen, als es die örtlichen Apotheker tun.

Zeichnung: Jens Spahn sagt "Hartz 4 bedeutet nicht Armut"; in seiner Hand ein Bündel Scheine (Monatsgehalt), im Hintergrund sind Dienstwagen und freies Zugfahren angedeutet.

Jetzt ist der Gesundheitsminister in der Zwickmühle: Setzt er das Urteil um, werden alle Apotheker sagen: „Der hilft ja nur seinem alten Kumpel.“ Im Internet werden solche Verschwörungstheorien bereits geäußert. Tut er es nicht, riskiert die Bundesrepublik heftige Strafzahlungen, weil sie gegen Europarecht verstößt. Elf Mal traf sich die Leitungsebene des Gesundheitsministeriums Ende des vergangenen Jahres mit Vertretern der heimischen Apothekerverbände in der Vorbereitung für ein neues Apothekengesetz. Mit den Krankenkassen, die am Ende alles bezahlen müssen, war in diesem Zeitraum kein einziges Treffen dokumentiert.[10] Spahn mäandert seitdem mit den verschiedensten Entwürfen: Erst hieß es 375 Mio. Euro zusätzlich an die Apotheker für besonders wertvolle „Dienstleistungen“ und nur ein begrenzter Spielraum für Rabatte von DocMorris, dann wieder: kein Spielraum für Rabatte von DocMorris, dafür aber nur 150 Mio. Euro für die deutschen Apotheker. Die Europäische Kommission will Spahn mit einem juristischen Hütchen-Trick bezaubern: Offiziell soll der Bundestag den Paragraphen des Arzneimittelgesetzes aufheben, der gegen das Europarecht verstößt. Im selben Atemzug soll aber eine gleichwertige, nur etwas verklausuliertere Regelung im Sozialgesetzbuch wieder eingeführt werden. Das Bundeswirtschaftsministerium hat den Trick mit den unterschiedlichen Gesetzes-Hütchen bereits durchschaut und warnt in einer ungewöhnlich deutlichen Stellungnahme vor einer „offenen Konfrontation gegenüber dem Europäischen Gerichtshof und der Europäischen Kommission“.

Diffuse Wertüberzeugungen

Quelle        :         Blätter          >>>>>           weiterlesen


Grafikquellen       :

Oben      —       7 November 2018

Abgelegt unter Gesundheitspolitik, Nordrhein-Westfalen, P.CDU / CSU, Regierung | Keine Kommentare »

DIE LINKE. erneuern

Erstellt von DL-Redaktion am 18. Juni 2019

„Bewegungslinke“ diskutierte  in Düsseldorf

Quelle         :    Scharf  –  Links

Von Edith Bartelmus-Scholich

Für das Wochenende 15./16. Juni  hatte die „Bewegungslinke“ zu einem Ratschlag eingeladen. Auf der offenen Veranstaltung trafen sich ca. 150 Mitglieder des  linken Flügels der Partei DIE LINKE. Vorbereitet und gestaltet hatten den Ratschlag die InitiatorInnen der 2018 begonnenen Sammlung „Bewegungslinke“ ( ).

Der Ratschlag diente der Vorstellung der „Bewegungslinken“ und der inhaltlichen Verständigung mit Parteilinken, die sich (noch) nicht zugehörig fühlen. Die Debatten erfreuten durch ein ansprechendes theoretische Niveau und eine untadelige Diskussionskultur. Die TeilnehmerInnen waren überwiegend jüngere Menschen darunter sehr viele Frauen.

Zunächst stellte die „Bewegungslinke“ ihre Kritik an der Partei DIE LINKE. und ihre Vorschläge zur Veränderung der Partei dar. In Impulsen wurde herausgearbeitet, dass in der Partei DIE LINKE Verunsicherung um sich greift. Dies betrifft nicht nur die Bewertung der ökologischen Frage,  sondern auch das Zutrauen in die Partei und ihre Möglichkeiten Politik zu gestalten und Gesellschaft zu verändern insgesamt. Verschärfend wirken sich der gesellschaftliche und politische Rechtsruck sowie der Niedergang der SPD und das Schwinden auch nur der rechnerischen Möglichkeit  einer rot-rot-grünen Koalitionsregierung im Bund aus. Die Verunsicherung geht so weit, dass Einzelne in der Vergangenheit schon Werbung für andere Projekte gemacht haben. Angesichts dieser Ausgangslage stellt die „Bewegungslinke“ die Frage,  was für eine Partei braucht es um wirkmächtig zu werden.

Die „Bewegungslinke“ wünscht sich DIE LINKE. als ein nützliches Werkzeug der Lohnabhängigen in den täglichen – nicht nur betrieblichen – Kämpfen. Das verlangt, dass die Partei bewegungsorientiert und organisierend eine verbindende, emanzipatorische Klassenpolitik verstetigt. Die Arbeitsweise der Partei soll sich grundlegend verändern: Weg vom „Sitzungssozialismus“, hin zu partizipativen, kämpferischen Aktionsformen. Die Machtfrage soll DIE LINKE. dabei durchaus stellen, aber parlamentarismuskritisch  jenseits von  Regierungsbeteiligung. Die Basisbewegung der Vielen ist der Schlüssel zur Verschiebung der Kräfte- und Machtverhältnisse. ( )

Die Vorstellungen von einer verbindenden Klassenpolitik umfassen einmal, den Ansatz Kämpfe zu verbinden und Identität und Klasse, die im Individuum zusammenfallen, nicht etwa auseinanderzureißen. Klassenpolitik soll dabei als Praxis begriffen werden, in der sich über die gemachte Erfahrung das Klassenbewusstsein herausbildet. Darüber hinaus gilt es nicht nur Kämpfe zu verbinden, sondern auch Alltagsrollen.

In Workshops wurden einzelne Fragestellungen von den TeilnehmerInnen bearbeitet. Herausragend besucht waren dabei der von Raul Zelik geleitete Workshop zur Eindämmung der Parlamentarisierung der Partei sowie der Workshop „Wie passen Klassenpolitik und Klimabewegung zusammen?“. Zu diesen beiden Themenkreisen besteht offenbar in der Partei DIE LINKE großer Diskussionsbedarf.

Insgesamt war der Ratschlag eine inspirierende Veranstaltung von der Hoffnung und Mut machende  Signale ausgegangen sind. Die angeschnittenen Themen sollten regional aufgegriffen werden, damit der Kreis der „Erneuerer“ sich verbreitert.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle       :

Medienmarathon 2005 in München, Startblock B

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »


Erstellt von DL-Redaktion am 17. Juni 2019

Gemeinderäte wählten die Bürgermeister in Spanien: Kommunistin gewinnt in Barcelona!

(Ada Colau) 2019. La transformació de la presó de la Trinitat.jpg

Quelle     :    Scharf  –   Links

Von Siegfried Buttenmüller

Am gestrigen Samstag den 15 Juni 2019 traten in Spaniens Kommunen die neu gewählten Gemeinderäte zur erste Sitzung zusammen, vor allem um die neuen Oberbürgermeister zu wählen. Die Wochen seit den Wahlen waren geprägt von Verhandlungen über Bündnisse, da kaum eine Liste irgendwo über absolute Mehrheiten verfügt.

In der mit 1,6 Millionen Einwohner nach Madrid zweitgrößten Stadt Barcelona konnte sich die Kommunistin und Amtsinhaberin Ada Colau-Bolano erneut deutlich durchsetzen.
Das war alles andere als selbstverständlich denn bereits kurz nach den Kommunalwahlen hatte z.B. das Bundesvorstandsmitglied von Die Linke, Raul Zelik, fälschlich gemeldet das Ada Colau-Bolano abgewählt worden sei. Auch die bürgerlichen Medien in Deutschland wurden entsprechend „informiert“ und haben das sehr gerne verbreitet. Auch Linke Medien wie „Neues Deutschland“ und sehr viele Zeitungen in Spanien verbreiteten diese Falschmeldung.

Gestützt wurde diese Behauptung auf die Tatsache, das die Liste der „linksrepublikanischen“ ERC in Barcelona mit Listenführer  Ernest Maragall ganz wenige Stimmen (ca. 4833 bei über 150 Tausend für jede Liste) mehr bekommen hat als die Liste der zum Bündnis Podemos gehörenden Liste der amtierenden Oberbürgermeisterin.

Im Gemeinderat von Barcelona hat die Liste Barcelona en Comú der Oberbürgermeisterin jedoch 10 Sitze, genau wie der ERC von Ernesto Maragall. Als dritte Linke Partei haben die Sozialisten 8 Sitze erreicht. Barcelona en Comú ist jedoch in 6 Stadtbezirken stärkste politische Kraft geworden während der ERC und PSC das nur jeweils in 2 Bezirken geschafft haben, sonstige nur in einem Bezirk. Vor allem aber setzt Barcelona en Comú auf Basisdemokratie und versucht so gut wie möglich die Menschen in den Stadtteilen auf Versammlungen selbst über ihre Belange bestimmen zu lassen und auch dazu zu motivieren. Nach oben hin versucht Barcelona en Comú mit einigem Erfolg und den zur Verfügung stehenden Mitteln den Wohnungsbaukonzernen, Kapital und Bürokratie das Wasser abzugraben und den Menschen damit mehr Mittel zur Gestaltung freizukämpfen. Schulen, Kindergärten, Wohnungen, Einkommen, Gleiche Rechte für Frauen, Unterkünfte für Flüchtlinge und sonstige soziale Forderungen stehen ganz oben auf der Agenda.

Dieser Politik folgen die anderen beiden „Linken“ Parteien wenn überhaupt dann nur widerwillig, stehen jedoch unter Druck der Basisorganisationen und auch von der von Barcelona en Comú geführten Stadtverwaltung. Für den ERC steht hingegen die Abgrenzung von Spanien und auch von den anderen Ländern, der „eigene Staat“, „eigene Sprache an Schulen“ usw. ganz oben auf der Agenda. Die Kommunistin Ada Colau-Bolano aus dem Amt treiben zu können und die Stadtverwaltung der mit Abstand größten Stadt in Katalonien unter Kontrolle bekommen zu können, wäre da eine fette Beute für den ERC gewesen. Die Partei der Sozialisten Kataloniens (PSC) mit 8 Sitzen als dritte große Fraktion in Barcelona steht ebenfalls deutlich Rechts von Barcelona en Comú, ist weniger basisdemokratisch, weniger antibürokratisch und gar nicht antikapitalistisch. Diese Partei hält jedoch nichts vom Separatismus und so gab es keine ernsthaften Gespräche zwischen ERC und PSC. Vielmehr hat sich die PSC als Bündnispartner von Barcelona en Comú Zugeständnisse abtrotzen lassen, um die Oberbürgermeisterin im Amt zu halten. Auch der ERC hatte Barcelona en Comú ein Bündnis angeboten, beanspruchte aber selbst die Führung und vor allem den Oberbürgermeisterposten.

Die Basisorganisationen in den Stadtteilen lehnten dies jedoch entschieden ab und forderten das die Alcaldesa (Oberbürgermeisterin) im Amt bleiben müsse. Ada Colau-Bolano kandidierte somit in der Gemeinderatssitzung erneut für das Amt der Oberbürgermeisterin, hatte jedoch mit den Stimmen der beiden Listen nicht die notwendige absolute Mehrheit. Ernest Maragall hatte auch die einfache Mehrheit im Rat nicht, doch wäre ihm das Amt des Oberbürgermeisters laut Verfassung mit seiner knapp Stimmenstärksten Liste zugefallen, wenn es keine absolute Mehrheit für einen Kandidaten oder eine Kandidaten gegeben hätte. Maragall wurde außer von den Räten des ERC von der Liste des Rechtskonservativen Charles Puigdemont, Junts Catalunia (JC) mit 5 Räten, unterstützt. Zusammen haben die Separatisten jedoch nur noch 15 Stimmen im Gemeinderat von Barcelona statt der 18 bei der letzten Kommunalwahl von 2015. Die „Linken“ der CUP haben ihre 3 Räte verloren und sind nicht mehr vertreten, ansonsten gab es in diesem Lager nur Verschiebungen zugunsten des ERC und JC, mit Xcat verschwand auch die Sammlungsliste der Separatisten aus dem Gemeinderat. Somit führte Ada Colau-Bolano vor der Abstimmung im Gemeinderat mit 18 zu 15 Stimmen vor Ernest Maragal, dieser wäre damit aber Oberbürgermeister geworden da die absolute Mehrheit von 21 Stimmen von keinem erreicht worden wäre. Allerdings ist es klar das die Amtsinhaberin für die restlichen Listen im Gemeinderat das deutlich kleinere Übel ist da sie vor allem gegen den Separatismus sind und erst in zweiter Linie gegen Links. Die Oberbürgermeisterin und ihre Organisation hatte die Sezessionsbewegung nicht unterstützt aber auch die Konservativen wegen ihres Vorgehens und ihrer mangelhaften Dialogbeischaft scharf kritisiert. Somit ist klar das von den restlichen Gemeinderäten keinerlei Unterstützung für Ernest Maragall und die separatistische Bewegung zu erwarten ist und außerdem wurde dieses Lager um 3 Gemeinderäte geschwächt. Die Perspektive dieser nicht antikapitalistischen Richtung ist letztlich das Spanien Jugoslawien in den Untergang und das Chaos folgt, was immer mehr Menschen und auch immer mehr Linke einzusehen scheinen. Kapitalismus kann weder in Spanien oder sonst irgendwo auf der Welt funktionieren und erst recht nicht in einem erst noch neu zu gründenden kapitalistischen Staat wie z.B. Katalonien.

Die meisten kleineren Listen enthielten sich oder stellten eigene Kandidaten auf, ohne das diese eine Chance gehabt hätten. Von der Liste des rechten Sozialdemokraten Manuel Vals enthielten sich 3 Räte und 3 andere Räte Stimmten für Ada Colau-Bolano. Somit hat diese mit 21 Stimmen die absolute Mehrheit im Gemeinderat erreicht und ist für 4 weitere Jahre zur Oberbürgermeisterin von Barcelona gewählt.

Datei:Port of Barcelona from Montjuic.JPG

Die Steigerung von „Wir können es“ (Spanisch Podemos) ist: „Wir tun es“ und in Barcelona machen es Barcelona en Comú und ihre Alcaldesa Ada Colau-Bolano. Es ist dies die Revolutionäre Realpolitik die Rosa Luxemburg immer eingefordert hat und die von der Organisation in Barcelona umgesetzt wird. Es ist der Kampf für Basisdemokratie in der Gesellschaft, der Kampf gegen die privilegierte Bürokratie und der Kampf gegen den Kapitalismus, der nicht mehr über die Interessen der Menschen gestellt wird.

Barcelona wird weiter ein Leuchtfeuer in Richtung antikapitalistischer Weltgesellschaft sein und der Funke greift auf immer mehr Kommunen über, daran arbeitet gerade Ada Colau-Bolano sehr intensiv. „Global denken, lokal Handeln“, dieser Leitspruch der Bewegungen gilt noch immer und in Zukunft erst recht.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquellen     :

Oben      —      Canviem presons per vida. El centre penitenciari de la Trinitat Vella i els entorns es transformaran en un gran espai obert amb habitatge, equipaments i espais veïnals en un dels barris històricament oblidats de la ciutat. La Trini importa.

Diese Datei ist unter den Creative-Commons-Lizenzen „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“, „2.5 generisch“, „2.0 generisch“ und „1.0 generisch“ lizenziert.

Abgelegt unter Europa, Kommunalpolitik, Positionen, Regierung | Keine Kommentare »

Neues von Couchreportern

Erstellt von DL-Redaktion am 14. Juni 2019

Jedem Land die Polit-Serie, die es verdient.

Annegret Kramp-Karrenbauer

Wir haben den traurigdoofen Hajo Eichwald

Von Johanna Roth

Das deutsche Fernsehen kann ja eigentlich weder Politik noch Comedy. Umso erstaunlicher, dass „Eichwald, MdB“ beides vereint – und dann auch noch gut. In der ersten Staffel der Miniminiserie konnte man auf ZDFneo dem Bochumer Bundestagsabgeordneten Hajo Eichwald dabei zusehen, wie er von einer Katastrophe zur nächsten trottelte, und schon da waren die Parallelen zur Wirklichkeit verblüffend. Jetzt kommt endlich die zweite Staffel, auf ZDF, und noch mehr als bei der ersten fragt man sich, wie viele Informanten die Macher denn wohl an zentralen Stellen der SPD-Bundestagsfraktion platziert hatten. Zwar wird in der Serie nicht gesagt, für welche Partei Hajo da eigentlich sitzt, aber groß herausgefordert wird die Fantasie diesbezüglich nicht.

Staffel zwei, geradezu prophetisch, spielt kurz nach einer Bundestagswahl, Hajo Eichwald hat sein Bochumer Revier gerade nochmal so gegen einen 24-jährigen rechtspopulistischen YouTuber verteidigt. Die Fraktion hat sich in eine Große Koalition gerettet, um nicht komplett abzurauschen. Eichwald wittert seine Chance in einem großen Dopingskandal, für den er einen Untersuchungsausschuss anleiert. Vor dem landet er dann bald selbst.

Dazu muss man wissen: Eichwald sitzt nicht auf der Hinterbank, er reitet sie. Und zwar seit Jahrzehnten. Immer, wenn er kurz vorm politischen Durchbruch steht, stolpert er entweder über sich selbst oder seine Mitarbeiter, die es immer gut mit ihm meinen und also sein Untergang sind.

Zwei Vorläufer : Der Rechts-Aussen K.G. Kiesinger und der Runde  Ludwig Erhardt.

Der bitterschwarze Humor erinnert an britische Serien wie „Blackadder“ oder „The Office“, die von der genialen Bescheuertheit ihrer Figuren in ausweglosen Situationen leben. Hajo ist im Grunde ständig damit beschäftigt, Brände, die er selbst gelegt oder indirekt in Auftrag gegeben hat, wieder auszutrampeln. Sein Darsteller Bernhard Schütz ist zudem der wohl einzige, dem man eine Frage wie „Schenkt man da was?“ abnimmt, wenn er darauf hingewiesen wird, dass heute der erste Todestag der Frau eines Fraktionskollegen sei – und dann sogar noch lachen muss.

Quelle      :        TAZ         >>>>>         weiterlesen


Grafikquellen       :

Oben         —         Unterzeichnung des Koalitionsvertrages der 19. Wahlperiode des Bundestages: Annegret Kramp-Karrenbauer


Unten     —        Ludwig Erhard (links) und Kurt Georg Kiesinger (rechts), 25. November 1966

Abgelegt unter Deutschland, Nordrhein-Westfalen, P.CDU / CSU, Regierungs - Werte | Keine Kommentare »

Saar – ’Pest’ oder ’Cholera’ ?

Erstellt von DL-Redaktion am 10. Juni 2019

’Pest’ oder ’Cholera’ für Saarbrücker Bürger:
und zudem ist der gewählte Kandidat nicht demokratisch legitimiert!

Quelle       :     Scharf  –  Links

Von Dr. Nikolaus Götz

Noch bis vor 15 Jahren wurde der Oberbürgermeister der Stadt von Saarbrücken vom Saarbrücker Stadtrat gewählt und das war gut so, damals! Schon bei der „wegen der Bürgernähe eingeführten“ ersten Direktwahl am 5. 9. des Jahres 2004 kehrten die wahlberechtigten Bürger den Kandidaten den Rücken zu und wählten die ’Abstinenz’, die Stimmenthaltung. So lag die Wahlbeteiligung damals bei 38,3%. Jetzt am 9. Juni des Jahres 2019 übertrafen die verantwortlichen politischen ’Strippenzieher’ das Ergebnis noch und wurden mit einer Wahlbeteiligung von 33,3% belohnt. Es muss klar gesagt werden, dass eigentlich in einer funktionierenden Demokratie, ein solches Wahlergebnis eine Schande ist! 67,7% aller Bürger in Saarbrücken, sehen sich nicht durch die von den Parteien präsentierten KandidatenInnen repräsentiert. Hier sei deshalb nochmals an den französischen Demokratietheoretiker Jean Jacques Rousseau erinnert, der die Legitimation im Amt bei einem ’Mehrheitsvotum’ fixiert.

Die Auswahl der Kandidaten um den Job ’Oberbürgermeister’ bei der Vorrunde am 26. Mai 2919, wobei dessen Grundgehalt bei (Besoldungsgruppe B7, Grundgehalt 8.745,43 Euro monatlich) liegt, war auch stark ernüchternd. Wie damals vor 15 Jahren Hecken und Britz überboten sich die aktuellen ’Restkandidaten’ aus CDU und SPD gegenseitig mit ihrem politischen Traumprogramm für Saarbrücken! Die im OB-Amt ergraute SPD Kandidatin Charlotte Britz versprach „100%“ (Siehe: Plakatwerbung), wobei jeder Saarländer weiß: MO=6%, DI=30%, MI=35%, DO=25 und endlich FR=4% SA und SO sind bekanntlich frei! Die Argumentation des Herausforderers von der CDU war in seiner Logik jedoch absolut bestechend, wobei der jungfrische Dreamboy Uwe Conradt erklärte: „Uwe ist Saarbrücker, Uwe kann es, Uwe will es, Uwe bindet Dich ein, Saarbrücken braucht den Wechsel!“ (Siehe Wahlwerbung: Uwe Conradt Oberbürgermeister für Saarbrücken). Nach diesen unverfälschten, typisch treudoof-saarländischen aber inhaltlosen Parolen folgte konsequent die Aufforderung von UWE an die Bürger: „Geh zur Wahl!“ und natürlich: „Wähl Uwe Conradt! Uff! Dieser Aufforderung kamen die „Mehrheit“ der 33,3% (33,3 : 2= 16,65%) oder 50,3% Saarbrücker nach, während sich Frau Britz mit 49,7% geschlagen geben muss. Der Stimmenunterschied zwischen beiden OB-Kandidaten war mit „274“ Wählerstimmen knapp, aber eindeutig (Siehe:!

Doch welch ein Jubel in der Mainstreampresse über dieses ach so blamable Wahlergebnis! Von nur runden 17% der gesamten Wählerschaft wurde dieser Kandidat in Saarbücken bestimmt. Ein neuer Tiefpunkt in der Demokratie ist erreicht! Die Wahl war zwar legal, der gewählte Kandidat hat jedoch keine demokratische Legitimation erreicht! Doch wen interessiert schon die Ansicht von J. J: Rousseau, wenn es um Amt und Würden geht! Und natürlich wird der so Gewählte sein Amt annehmen. Ob es aber für Saarbrücken und die Demokratie nicht besser wäre, das Amt des Oberbürgermeisters wieder aus dem Stadtrat heraus zu vergeben, dieser Rat sei den politisch Verantwortlichen von Saarbücken und dem Saarland wie schon 2004 nochmals gegeben.

Die unter angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons


Grafikquelle         :

Scharf – Links              —       Bildmontage: HF

Abgelegt unter Kommunalpolitik, Medien, Saarbrücken, Überregional | 1 Kommentar »

Einfach Rassismus in Köln

Erstellt von DL-Redaktion am 6. Juni 2019

Polizei fixiert Unschuldige in Köln
Rennende Muslime? Gefährlich!

Hbf Köln Eingangsbereich.jpg

Von Sibel Schick

In Köln wurden zehn Muslime in der Wahrnehmung von Fahrgästen am Bahnhof zur Terrorgefahr. Dabei wollten sie nur ihren Zug erreichen.

Wer kennt das nicht: Es ist Weihnachten, Familienbesuche. Eigentlich hat man keine Lust, aber was muss, das muss. Fertiggemacht, losgefahren, die Zeit aber doch unterschätzt und am Hauptbahnhof muss man rennen, um schnell noch den Zug zu bekommen.

Ja, alle kennen das. Aber nicht alle machen dieselbe Erfahrung, wenn sie es eilig haben. Zumindest nicht in Deutschland. So sperrte am Dienstag die Polizei beide Ausgänge des Kölner Hauptbahnhofs und fixierte zehn „verdächtigte“ Männer auf dem Boden, nur um herauszufinden, dass es keine Terroristen sondern ganz normale Typen waren. In einem Tweet erwähnt die Polizei Köln, dass die Männer „im Laufschritt“ unterwegs waren. Warum soll das Rennen an einem Bahnhof verdächtig sein? Weil es Muslime sind, die rennen und dabei noch weiße Gewänder tragen. Mehr trägt die Polizei zur Begründung nicht vor. Ganz so als wäre es selbsterklärend, worin das „Missverständnis“ liegen könnte.

An jenem Tag handelte es sich um den ersten Tag des Ramadan-Festes am Ende der Fastenzeit in einem der drei Heiligen Monate des Islams. Es ist Tradition, sich an Festtagen schick anzuziehen und Verwandte zu besuchen. In meiner Kindheit war es üblich, dass Kinder „Bayramlık“ geschenkt bekamen – schicke Kleidung extra für die Festtage. Ein Blick auf die betroffenen Männer reicht aus zu verstehen, dass es genau darum ging. Auf dem Foto, das die Bild in ihrer Meldung einbettete, sieht man einen jungen Mann von hinten, der mühsam frisiert, und sauber und frisch angezogen ist. Er trägt eine traditionelle Weste, die man von Festtagen und Hochzeiten kennt.

Estación central de Colonia.JPG

Stellen Sie sich vor: Sie machen sich schick für einen festlichen Besuch und werden gerade deshalb mit Gewalt auf den Boden geschmissen. Es sollen andere Bahnfahrer*innen gewesen sein, die die Polizei alarmierten. Sie sahen also festlich gekleidete Männer und dachten gleich an Terroristen. Wir wissen nicht, wer diese Männer sind. Es ist gut möglich, dass es Deutsche sind. Deutsche, die in Deutschland geboren und aufgewachsen sind, arbeiten gehen, Steuern zahlen.

Rassistische Karikatur

Laut einer Rechnung des Bamf aus 2015 lebten dato circa 4,7 Millionen Muslim*innen in Deutschland, darunter auch Deutsche. Auch