DEMOKRATISCH – LINKS

                      KRITISCHE INTERNET-ZEITUNG

RENTENANGST

Archiv für die 'Nordrhein-Westfalen' Kategorie

Richternd

Erstellt von DL-Redaktion am 3. Dezember 2019

Schöffe am Amtsgericht in Euskirchen

File:1031616 Amtsgericht Euskirchen.jpg

Quelle       :         untergrund-blättle     CH.

Von   Richard Albrecht

Im letzten Jahrzehnt war ich vor einigen Jahren einige Jahre lang ehrenamtlicher Richter. Genauer: (Hilfs-) Schöffe an einem Amtsgericht in der Rheineifel.

Euskirchen, historisch Oiskirchn, ist das Tor der Eifel. Aber nicht alle Euskirchner sind Eifler Toren. Es hat auch dort einige Autoren.

Das dortige Amtsgericht ist baulich neu und liegt zentral für alle, die mit dem Zug oder dem Auto anreisen. In den Kleinen Saal wurde in Handschellen reingebracht ein Angeklagter, den ich gut ein Jahrzehnt vor der Verhandlung einmal beobachtete wie er am Bach Frösche fing und mit dem ich über die Jahre auch zwei, drei Sätze irgendwas sprach.

Was er getan haben sollte Jahre bevor er als Angeklagter befragt wurde fiel unters Jugendstrafrecht.

Merkwürdig war, dass Monate vergingen bevor er nach erster polizeilicher Auffälligkeit vor seinen ersten Richter kam. Ich fragte nach. Der Berufsrichter am Amtsgericht war lange Jahre lang Direktor des nahegelegenen Hauses, in dem ich später 15 Tage als Busse für die angebliche „Beleidigung“ eines Rechtsadvokaten abbüssen sollte. Er liess als Vorsitzender pausieren und erklärte im Beratungsraum wortreich, warum´s so war damit das wirken konnte, was Pädagogik genannt wird.

Ob der – nun – junge Mann, den ich – wieder´n paar Jahre später – noch einmal zwischen Regalen in einem Supermarkt sah und den ich an seinen so hellen wie wachen Augen wiedererkannte, nun schlussendlich wegen seines ersten Altdelikts verurteilt wurde oder auch nicht, kann ich nicht wissen.

Die Verhandlung, an der ich laienrichterlich teilnahm, musste aus formalen Gründen vertagt werden.

Die letzte Gerichtsverhandlung, an der ich, ehrenamtlich überhöht sitzend, teilnahm, war geheim: „aus Gründen“ des Jugendschutzes wurde was „die Öffentlichkeit“ heisst ausgeschlossen.

Der alte Mann war das erste Mal in seinem Leben öffentlich angeklagt. Er fühlte sich unschuldig und schämte sich nicht. Sondern hatte Angst vor seiner Frau. Denn er sollte, so staatsanwaltschaftliche Ermittlungen, von hinten eine Minderjährige begrapscht haben.

Diese erschien gross und prall. Die Gutachterin wissend und eifernd.

Der Mann war nicht nur ein alter, sondern auch ein kleiner Mann. Würde er wie allseits beredt behauptet die Titten nicht nur von hinten, sondern auch von oben begrabscht haben, hätte er auf einer kleinen Leiter oder auf einigen Telefonbüchern der Kreise Bergheim-Düren-Euskirchen stehen müssen.

Als ich dies, ehrenamtlich-richternd und gutachterlich-kritisch, anmerkte – herrschte sekundenlang so kundiges wie beredtes Schweigen.

Was den Vorsitzenden trotz Advokatenprotest nicht hinderte, wie Basta durchzuziehen. Und den kleinen alten Mann, der seine Unschuld beteuerte und den die Angst vor seiner Frau schwitzen machte, zu einer milden Geldstrafe zu verurteilen.

Die Verhandlung wurde weder zur Beratung unterbrochen noch später ausgesetzt.

Diesen Berufsrichter sah ich erst Monate später in anderem Zusammenhang im selben Amtsgericht während meines eigenen, von ihm beförderten, Prozesses wegen angeblicher „Beleidigung“ eines Bonner Rechtsadvokaten ebendort wieder – in der Gerichtskantine, nachdem der gegen mich als Angeklagten veranlasste Prozess wegen Besorgnis berufsrichterlicher Befangenheit vertagt wurde.

Seitdem ward er von mir nimmer gesehen.

Und das war und das ist auch nur gut so.

Diese Kurzerzählung erschien zuerst im Sammelband des Autors HELDENTOD. Kurze Texte aus Langen Jahren (Aachen: Shaker Media, 2011).

—————————————————————-

Grafikquelle          :         Amtsgericht Euskirchen, Sept. 2007

Author Wikoli       —        Source  :  Own work

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Justiz-Kommentare, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »

NRW / Sagel verläßt Linke

Erstellt von DL-Redaktion am 2. Dezember 2019

NRW – Leitlinien und ein Austritt in Bielefeld

Rüdiger Sagel.jpg

Von Sebastian Weiermann, Bielefeld

Der Landesparteitag der LINKEN in Nordrhein-Westfalen hat die Kommunalwahl 2020 vorbereitet.

Für die Linkspartei in Nordrhein-Westfalen ist es nicht leicht, auf sich aufmerksam zu machen. Zwar kommen zu ihrem Parteitag am Wochenende in Bielefeld prominente Bundestagsabgeordnete aus dem Bundesland und mit Özlem Alev Demirel sitzt nun eine fest in der nordrhein-westfälischen LINKEN verankerte Politikerin im Bundestag, aber der Partei fehlt die Präsenz im Landtag.

Ein bisschen Glanz brachte der Parteivorsitzende Bernd Riexinger in den Parteitag. In seiner Rede sprach er sich gegen die AfD und für Solidarität mit der antifaschistischen Organisation VVN-BdA aus. Das neue Vorsitzendenduo der SPD aus Esken und Walter-Borjans kommentierte Riexinger wohlwollend. Es sei zwar fraglich, ob es wirklich eine Erneuerung der SPD gäbe, aber die abstimmenden Mitglieder hätten sich für eine »sozialdemokratischere« Partei ausgesprochen. Das sei kein Grund, von Zusammenschlüssen zu träumen. Die LINKE habe ihren Platz links von der SPD. Sie kämpfe für »demokratischen Sozialismus«. Über Saskia Esken wusste Riexinger noch zu berichten, dass er sie im Jugendzentrum »zum Teil mit politisiert« habe. Das habe offensichtlich nur für die SPD gereicht – aber »immerhin linker Flügel«, wie er anmerkte.

Zentrales Thema des Parteitags war allerdings nicht die SPD, sondern die Vorbereitung auf die Kommunalwahlen, die im September 2020 stattfinden. Dass die Themen dafür in den Städten gesetzt werden, war den Delegierten klar. Aber man wollte mit den »Kommunalpolitischen Leitlinien« einen »Steinbruch« entwickeln, aus dem die Kreisverbände sich bedienen können, wie Landessprecher Christian Leye erklärte. Es sei wichtig, sich auf Landesebene über gewisse Positionen verständige. Man sende damit ein »Signal«, wo man stehe. Die Leitlinien, die er Parteitag beschlossen hat, umfassen mehr als 100 Seiten und bilden das ganze Spektrum der Politik ab. Darin geht es sowohl um größere Fragen, wie der Positionierung der LINKEN gegen Hartz-IV-Sanktionen, als auch um Details, etwa ob man für oder gegen Kunstrasenplätze sei. Diskutiert wurde, ob in den Leitlinien von »Arbeitslosigkeit« oder »Erwerbslosigkeit« die Rede sein solle. Für den ersten Begriff spreche dessen Allgemeingültigkeit, für den zweiten, dass Lohnarbeit damit nicht überhöht würde, worauf die Delegierten sich dann einigten.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Laut und leidenschaftlich wurde es nur selten. Etwa bei der Frage danach, ob der Energiekonzern RWE »verstaatlicht« oder »zerschlagen« werden sollte oder beim Thema Prostitution, bei dem es eine Bandbreite an Positionen gibt, die von einer Liberalisierung bis zum Sexkaufverbot reicht. Man einigte sich auf Grundsätzliches wie Beratungsangebote und die Stärkung von Hilfsmöglichkeiten für die Menschen in der Branche.

Quelle          :          ND         >>>>>           weiterlesen

—————————————————————–

Grafikquellen       :

Oben       —         Rüdiger Sagel

—————————-

Unten        —       Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Eine Schifffahrt, die ist …

Erstellt von DL-Redaktion am 1. Dezember 2019

Die Binnenschifffahrt könnte dabei helfen die Klimaziele zu retten

SophienhafenHalle WSA.JPG

Von Annette Jensen

Die Binnenschifffahrt könnte dabei helfen, die deutschen Klimaziele zu erreichen. Doch die marode Infrastruktur und der Trend zu immer schnelleren Lieferungen erschweren das.

Warten. Am Kai nebenan quietscht seit Stunden ein Kran, der Getreide in ein Schiff schaufelt. Auf der „MS Catharina“ aber ist es still. Ab und zu fegt eine Sturmböe über das flache Schiff und das eingezäunte Gelände im Magdeburger Hafen, auf dem plastikverpackte Rotoren und andere Bauteile für Windräder lagern. Bei diesem Wetter ist es zu gefährlich, 68 Meter lange Flügel zu verladen.

Für Kapitän Klaus Hohenbild, seinen Bruder Karl Georg und seinen Sohn Christoph war das Wochenende am Sonntag schon vorbei. Da sind sie knapp fünf Stunden mit dem Auto von ihrer Heimatstadt Emmerich am Rhein nach Magdeburg an der Elbe gefahren. Sie wollten unbedingt rechtzeitig auf ihrem Schiff sein, wenn der Lkw mit ihrer Ladung eintrifft. Doch jetzt müssen sie erst mal warten.

Zweimal hat Klaus Hohenbild oben am Kai schon nachgefragt. Dann kam der Anruf: Heute nicht. Morgen, vielleicht. Der 65-Jährige brummt und schaut aus dem Fenster. Das Schiff bewegt sich kaum. Vom Sturm merkt man im Bauch der 100 Meter langen „MS Catharina“ so gut wie nichts.

Wenn es nach der Bundesregierung geht, sollen Familie Hohenbild und ihr Schiff dabei helfen, die deutschen Klimaziele zu erreichen. Sie will den Gütertransport von der Straße auf Schienen und Flüsse verlagern. Das Bundesverkehrsministerium unter Andreas Scheuer will die „Attraktivität für Industrie und Logistik steigern“, heißt es im Klimaschutzprogramm.

Denn der Transport auf dem Wasser ist deutlich klimafreundlicher als mit dem Lkw, die in Deutschland gegenwärtig über 70 Prozent des Transports abwickeln. Die Binnenschifffahrt dümpelt bei gerade mal 8 Prozent vor sich hin. Laut Umweltbundesamt werden bei Gütertransporten mit dem Lkw Treib­haus­gase der Menge 103 Gramm pro Tonnenkilometer ausgestoßen, mit der Binnenschifffahrt sind es nur 32 Gramm. Noch in den 1960er Jahren teilten sich Bahn, Laster und Schiff die Transporte zu etwa gleichen Teilen – danach ging es mit der Schifffahrt ab- und mit dem Straßentransport aufwärts. Wie kam die Schifffahrt in die Krise? Und kann man das Ruder wieder rumreißen?

Karl Georg will jetzt etwas tun, um die Wartezeit zu überbrücken. Bekleidet mit Blaumann und ausgebleichtem Stoffhütchen steigt er die steile Treppe in den Maschinenraum hinunter, um dort ein bisschen aufzuräumen und Werkzeuge und Farbtöpfe zu sortieren. Alles ist gut ausgeleuchtet hier, Boden und Bleche sind rot und gelb lackiert, die Rohre grün. Es riecht nach Diesel, obwohl nirgendwo ein Tröpfchen Öl zu sehen ist. Nach einem Kohletransport schrubben sie den Frachtraum sechs bis sieben Stunden lang, bis dort bedenkenlos die nächste Ladung Korn, Dünger, Streusalz oder Windradflügel gelagert werden können. „Schrott transportieren wir nicht. Das gibt zu viele Beulen“, erzählt Karl Georg.

Die drei Hohenbilds hoffen, dass die Fahrt nach Bremen am nächsten Tag beginnen kann. Am Freitag sollen sie dort abladen, anschließend werden die Windradflügel in die Türkei verschifft. Jetzt ist es ist Montag. Sie haben also fünf Tage Zeit, um von Magdeburg nach Bremen zu kommen. Fünf Tage für 385 Kilometer. Das sollte schaffbar sein – oder?

Die Probleme der Schifffahrt

Wartezeiten gehören für Binnenschiffer zum Geschäft. Lade- und Löschzeiten sind Teil der Verträge. Und so werden die Hohenbilds auch für die Verzögerung in Magdeburg ein Ausfallgeld vom Auftraggeber bekommen. Das decke die laufenden Kosten aber kaum, sagt Klaus Hohenbild. Seine Familie ist auch Mitglied in einem Netzwerk, in dem er und seine Kollegen anonym ihre Frachtpreise einstellen, um einem Unterbietungswettbewerb entgegenzuwirken.

„Als ich anfing, war es eine Sensation, wenn eine Schleuse mal zwei Wochen lang nicht funktionierte“, erinnert sich Klaus Hohenbild, während er es sich auf dem Steuer­mannsitz im Führerhaus bequem macht und die Füße hochlegt. Fast 50 Jahre liegt seine Lehrzeit zurück; genau wie sein Sohn Christoph sein Azubi war, so hat auch er auf dem Schiff seines Vaters gelernt.

Klaus Hohenbild holt sein Handy raus, er möchte zeigen, was in der Binnenschifffahrt schief läuft. Auf einem Foto sieht man einen Mann in einem neongelben Anzug, der sich an einem Betonklotz festgekettet hat und an einem Seil zieht. „Das ist im Weser-Datteln-Kanal. Da setzen sie jetzt sogenannte Festmacher ein“, empört er sich. Sein Bruder Karl Georg kichert. Die Innenwände dieser Schleusen sind so marode, dass die Schiffe ihre Taue nicht mehr um die Poller legen dürfen. Obwohl es sich um eine der am meisten befahrenen Wasserstraßen handelt, erließ das Amt vergangenes Jahr auch die Anweisung, dass immer nur ein Schiff auf einmal einfahren darf.

Hohenbild wischt über den Bildschirm und zeigt eine unscharfe Aufnahme: ein winziges Sportboot, das in die über hundert Meter lange Schleusenkammer tuckert. Es ist klein genug, um gemeinsam mit anderen Schiffen durchgeschleust zu werden. Das geht aber nicht – wegen der Anweisung. So entstehen lange Warteschlangen. „Vier, fünf, sechs, sieben Stunden Wartezeit“, sagt Kapitän Hohenbild. Weil die verladende Industrie protestierte, setzt die Schifffahrtsverwaltung jetzt Männer im Dreischichtbetrieb ein, die den Schiffen beim Festmachen helfen. Wie lange dieses Provisorium weitergehen soll? „Weiß keiner. Wir wissen es jedenfalls nicht.“

Auf dem Weg bis nach Bremen müssen sie elfmal in eine Schleuse einfahren, um Staustufen zu überwinden. Auch hier heißt es häufig warten. Da ist die Schleuse Drakenburg, die seit Monaten klemmt. In Minden gibt es seit zwei Jahren eine neue Anlage, die aber nur von großen Schiffen genutzt werden darf. „Sie soll wohl geschont werden“, mutmaßt Kapitän Klaus Hohenbild. Die „MS Catharina“ muss hier oft stundenlang an der Anlage für kleinere Schiffe ausharren. Beide Schleusen werden aus der Ferne gesteuert – und eine parallele Bedienung ist offenbar nicht möglich oder vorgesehen. „Behörde“, stöhnt der sonst so gelassen wirkende Mann.

Zuständig für den Zustand der Schleusen und der Binnenschifffahrt ist die Wasser- und Schifffahrtsverwaltung (WSV). „Da ist kein Zug drin, das System ist krank, keiner will da die Verantwortung übernehmen“, sagt der Kapitän. Jeder Anruf bei der WSV sei schwierig. Oft erreiche er dort niemanden oder er müsse betteln, um zu einer zuständigen Person durchgestellt zu werden.

Erst ein paar Tage alt ist die Meldung, dass der Nord-Ostsee-Kanal für große Schiffe vorübergehend nicht passierbar ist, weil eine Schleuse in Brunsbüttel gewartet wird und sich die andere nicht vollständig öffnen lässt. In der Nische des Schleusentors hat sich Schlick angesammelt. Angesichts solcher Zustände findet es Klaus Hohenbild „zum Lachen“, dass dauernd von Digitalisierung und selbstfahrenden Binnenschiffen als Zukunftsvision die Rede ist.

Ruhrmündung Duisburg Luftaufnahme 2014.jpg

Doch lustig finden die Hohenbilds die Lage der Binnenschifffahrt nicht. Es hapert überall. Und seit Frühjahr nehmen die Frachtanfragen auch wieder ab, die Preise geraten unter Druck. „Die Kohle ist seit Langem auf dem absteigenden Ast, auch Sand und Kies sind rückläufig“, benennt Hohenbild ganz nüchtern die Probleme seiner Branche. Aufgeben aber ist für die Familie Hohenbild keine Option – und auch der 29-jährige Christoph geht fest davon aus, dass er sein gesamtes Berufsleben auf Flüssen und Kanälen verbringen wird. Seit mindestens 1850 gehört die Schifffahrt zur Familientradition der Hohenbilds.

Hört man den Männern zu, könnte man den Eindruck bekommen, dass die Krise der Binnenschifffahrt vor allem ein Ergebnis mangelnder Finanzierung von Schleusen und Technik ist. Die Bundesregierung will das mit einer Verdopplung ihrer Investitionen ändern. Aber die Probleme liegen gerade für das Familienunternehmen Hohenbild tiefer, oder besser: flacher. Fuhr der Vater von Klaus und Karl Georg noch mit einem 300-Tonnen-Frachter, so kann die „MS Catharina“ sechsmal so viel laden. „Das entspricht 74 Lkw“, rechnet Klaus Hohenbild vor. Damit gehört das Schiff heute eher zu den Kleinen: Fast alle neuen Schiffe sind inzwischen 135 Meter lang und für 3.500 Tonnen Last oder Containertransport vorgesehen – sie schippern fast ausschließlich auf dem tiefen Rhein, wo acht von zehn Transporten auf Flüssen stattfinden.

Quelle          :          TAZ          >>>>>          weiterlesen

——————————————————————-

Grafikquellen        :

Oben        —         Einfahrt zum Sophienhafen, Gebäude des Wasserstraßen- und Schifffahrtsamtes Magdeburg, Halle (Saale)

——————————-

Unten           —       Aerial shot of mouth of the Ruhr (River) River at Duisburg-Ruhrort into the Rhine

Abgelegt unter Nordrhein-Westfalen, Sachsen-Anhalt, Überregional, Wirtschaftpolitik | Keine Kommentare »

Stadtgespräch aus München

Erstellt von DL-Redaktion am 28. November 2019

Mir san Sommer –
Änderung des Ferienbeginns in Bayern

Fitxer:Starnberger See mit Steg und Alpenblick.jpg

Von Ambros Waibel

Früher in die Ferien? Markus Söder will die Ferienzeiten bewahren. Das ist identitätspolitisch clever, preußisches Rumgenöle wirkt da eher kontraproduktiv.

„Das bayerische Abitur bleibt bayerisch“, hat Bayerns Ministerpräsident Söder den Ausstieg Bayerns und Baden-Württembergs aus dem geplanten nationalen Bildungsrat kommentiert – „übrigens genauso, wie die Ferienzeiten bleiben, wir wollen auch die nicht angleichen.“

Das sind gleich zwei inhaltliche Nullaussagen. Denn dass ein bayerisches Abitur einen im Leben irgendwie weiter brächte als ein beliebiges anderes, ist genauso Unsinn – ich kann hier mitreden – wie das trotzige Bestehen auf dem späten Sommerferientermin in Zeiten des Klimawandels; der ja insbesondere den Juli auch in Nürnberg oder in München zu einem Monat macht, in dem sinnvoller Unterricht in den zumeist nicht klimatisierten Lehranstalten kaum mehr möglich ist.

Politisch, also identitätspolitisch hingegen sind beide Aussagen wirkmächtig. Ich brauchte mindestens zehn Jahre, um mich daran zu gewöhnen, dass die Sommerferien in nördlichen Gefilden nicht mehr oder weniger am 1. August beginnen und am 15. September enden. Es erschien mir grausam, ein Kind, wie in diesem Jahr in Berlin, am 5. August nicht in die Sonne, sondern in die Schule zu schicken.

Logisch lässt sich das nicht begründen. Dem Kind ist es auch wurscht. Pfingstferien, die als Argument für den späten süddeutschen Sommerferienbeginn inzwischen vorgeschoben werden, sind etwas sehr Schönes – insbesondere weil da oft noch Vorsaisonpreise gelten und keine Preußen am Gardasee rumhängen. Aber auch sie taugen letztlich nicht zur Rechtfertigung der bajuwarischen Reservat­rechte. Und wer im Sommer und damit eben auch im September schlicht kein Geld übrig hat, um in den Süden zu fahren, der kann in Bayern die letzten beiden Ferienwochen oft genug damit verbringen, in einen zähen Landregen zu schauen.

Das ganze folkloristische Repertoire

Nehmen wir mal eine andere Perspektive ein. In seinem leider nicht auf Deutsch vorliegenden Reisebuch „La leggenda dei monti naviganti“ (etwa „Die Legende der reisenden Berge“, 2007) erkundet der italienische Journalist Paolo Rumiz die Alpen und macht dabei auch einen Abstecher nach München.

Veitshöchheim Haus der Fastnacht 06.jpg

Seine Gesprächspartner klären ihn darüber auf, dass die CSU in Bayern für immer regieren werde, weil letztlich niemand ein anderes Bayern wolle, auch die CSU-Gegner nicht. Die Gleichsetzung von Staat, Partei und Heimat überlebt jeden CSU-Skandal und konnte bislang nur von der CSU selbst beziehungsweise von noch rechteren Gruppierungen – mit noch mehr „Mir san mir“ – herausgefordert werden: wie aktuell von den „Freien Wählern“.

Quelle             :         TAZ       >>>>>         weiterlesen

——————————————————————-

Grafikquellen        :

Oben          —            Starnberger See: Steg mit Ausflüglern und Alpenblick von Starnberg aus

Font Treball propi
Autor MAx59

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

———————————-

Unten         —         Veitshöchheim, Haus der Fränkischen Fastnacht, Fassadenmalerei (2015) mit Motiven aus der Fernsehsendung „Fastnacht in Franken“: Links im Gefängnis Markus Söder, der sich 2014 für die Fernsehsitzung als Shrek verkleidet hatte.

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 Deutschland“ lizenziert.

Abgelegt unter Bayern, Kommunalpolitik, P.CDU / CSU, Überregional | Keine Kommentare »

Synode Dresden: Missbrauch

Erstellt von DL-Redaktion am 14. November 2019

im Evangelischen Kirchenbezirk Ravensburg ?

Bavendorf Ev Kirche 2011b.jpg

Offener Brief von Stefan Weinert an Herrn Dekan Dr. Friedrich Langsam

Sehr geehrter Herr Dekan Dr. Langsam,

sehr geehrte Damen und Herren im Ravensburger

Evangelischen Gesamtgemeinderat,

auf dem Hintergrund der aktuell stattfindenden EKD-Synode in Dresden und der Tatsache, dass es auch aus dem Kirchenbezirk Ravensburg Bewerber/innen für das zukünftige Amt einer/s Synodalen gibt und unter der Prämisse einer schonungslosen Aufarbeitung hätte ich gerne von Ihnen gewusst, ob es auch im Dekanat Ravensburg, Fälle von sexuellen Übergriffen von Pfarrern, Pastoren, Diakonen, Jugendmitarbeitern, Kirchenmusikern oder Ehrenamtlichen gegenüber ihnen anvertrauten Mädchen, Buben und Erwachsenen gab und gibt. Zwar bin ich kein Mitglied der Evangelischen  Kirche und ich frage auch nicht als Christ, der ich zwar bin, sondern als Mitglied der Gesellschaft, die auch die Evangelische Kirche erheblich finanziert. Es kann und darf nicht nur eine gewisse Transparenz in Dresden geben, sondern sie muss in jeder Kirchengemeinde beginnen. Zudem hätte ich gerne von Ihnen gewusst, wie Sie zu dem Thema „Entschädigung“ stehen. Bitte verzichten Sie bei einer etwaigen Antwort auf  Allgemeinplätze und Verweise nach Oben. Danke.
Denn eigentlich – so die Idee ihres Gründers – sollte die Kirche eine für den, durch den Alltag gebeutelten Menschen, entlastende lebendige Bewegung sein. „Einer trage des anderen Last,“ betont deshalb auch der zum Paulus gewordene frühere Christenverfolger, und fährt fort: „So erfüllt ihr das Gesetz Christi.“ Doch die Kirche – und seit 502 Jahren, die Kirchen – sind für die Gesellschaft ganz im Gegenteil  – wie einst Bruno – zum „Problembär“ geworden. Bereits vor einem Jahr (2018), auf der EKD-Synode in Hannover, sagte die Hamburger Bischöfin Kirsten Fehrs: Eine Kirche, die solcher Gewalt nicht wehrt, ist keine Kirche mehr“.
 
Damals berichtete die Bischöfin von Johanna (15) , die ihr berichtete, wie alles anfing. Sie (Johanna) fand es eklig, als der Pastor sie das erste Mal überfallartig küsste und an die Brust fasste.Ein Fall von sexuellem Missbrauch, ein Teil einer Serie in Ahrensburg, einer Kleinstadt nördlich von Hamburg. Die evangelische Kirche habe, so Fehrs, aufgrund ihres  Systems ganz spezifische Risikofaktoren. Sexualisierte Gewalt werde an Kindern und Jugendlichen gegangen, aber auch an Erwachsenen in Beratungsszenarien und Abhängigkeitsverhältnissen. Die Täter seien Pastoren, aber auch Jugendmitarbeiter, Kirchenmusiker oder Ehrenamtliche. Gerade weil in der evangelischen Kirche so viele Berufsgruppen und auch Ehrenamtliche Verantwortung gegenüber Kindern und Jugendlichen trügen, müsse man sie alle in den Blick nehmen. Dazu kämen die vereinsartigen Strukturen der evangelischen Kirche: Oft sei es unklar, wer für was zuständig ist, und weil jeder jeden kenne, rede man nicht öffentlich über die Taten. Es gebe unreflektierte Vermischung von Privaten und Dienstlichem und Einrichtungen, die als „Closed Shops“ geführt würden.
Kerstin Claus ist die erste Betroffene von sexuellem Missbrauch, die vor der aktuell stattfindenden EKD-Synode in Dresden spricht. Die heutige Journalistin, Kerstin Claus, wurde als Jugendliche von ihrem evangelischen Gemeindepfarrer über längere Zeit missbraucht.
 Vor einem Jahr in Würzburg hatte die Synode einen Elf-Punkte-Plan beschlossen. Insgesamt sind der evangelischen Kirche mittlerweile 770 Missbrauchsopfer bekannt. 60 Prozent davon betreffen Fälle aus dem Bereich der Diakonie. 40 Prozent ereigneten sich in Kirchengemeinden. 
 
Einen offenen Dissens gibt es zwischen der EKD und den Betroffenen über die Frage, ob Entschädigungen gezahlt werden sollen. Ein Mitglied des Beauftragtenrats betont, dass die in der katholischen Kirche genannten Entschädigungssummen zwangsläufig zu Auseinandersetzungen über die Beweisbarkeit von Sachverhalten führen könnten, also genau zu den Verfahren, die die Betroffenen über lange Zeit stark belasten und retraumatisieren würden. Bischof Bedford-Strohm sogar meint, sexueller Missbrauch sei ein solch schlimmes Vergehen, dass es mit Geld nicht wieder gut zu machen sei. Anders als es die katholische Kirche seit Jahren tut, wolle die evangelische Kirche keine pauschalen Summen an Opfer zahlen, hatte selbige Bischöfin Fehrs zuvor betont. Wie Claus sagte, gehe es nicht darum, dass die Kirche sich freikaufe. Nötig sei ein lebenslanges Bemühen, den Opfern gerecht zu werden. 
 
Das ist blanker Zynismus und auch Kerstin Claus sieht das anders. Ihr und den Opfern gingen die Schritte der Kirche nicht weit genug. Die evangelische Kirche habe lange gezögert, ehe sie die Missbrauchsproblematik erst 2018 offensiv angegangen habe. Nun müsse die Kirche die Bedürfnisse der Betroffenen in den Mittelpunkt rücken, es sei eine transparente Entschädigungsregelung nötig.Sie meint, sexueller Missbrauch habe vielfältige biografische Folgen. Auch deswegen müsse es solch eine Debatte geben. Vor allem aber ruft die Betroffene die evangelische Kirche zu einem Mentalitätswechsel auf. „Sie und ihre Kirche haben noch immer keine klare Haltung gefunden, was den Umgang mit uns Betroffenen angeht“, sagte Claus vor der Synode und fuhr fort: „Sie werden Ihre Deutungshoheit aufgeben müssen.“ Und dann meldet Claus auch ganz konkrete weitere wichtige Forderungen an: „Täter dürfen nicht weiter im Verkündigungsdienst der Kirche stehen.“
 
Für eine erhellende, transparente und zeitnahe Information wäre ich dankbar.
 
Mit freundlichen Grüßen,
 
Stefan Weinert
———————————————————————
Grafikquellen         :

Oben       —           Evangelischer Friedhof Bavendorf (Ortschaft Taldorf, Stadt Ravensburg) mit der evangelischen Kirche

Abgelegt unter Baden-Württemberg, Kommunalpolitik, Kultur, Religionen | Keine Kommentare »

Elektroautos : Aus Aachen

Erstellt von DL-Redaktion am 12. November 2019

Versucht die fossile Autoindustrie dies zu verhindern?

File:StreetScooter C16.jpg

Quelle       :     Scharf  —  Links

Von Walter Schumacher

Vor über 100 Jahren wurden in Aachen schon mal Autos hergestellt [1].
Seit 2014 gibt es erneut eine Autoproduktion: mit dem „Streetscooter“ und dem e.Go“ werden zwei besonders sinnvolle Elektro-Auto-Typen [2] entwickelt, serienreif gemacht und hergestellt, die wirklich beispielhaft sind für „vernünftige“ E-Autos! [3]

Während einerseits alle politischen und wirtschaftlichen Indikatoren in Richtung eines großen Erfolgs für das Produkt stehen, kommen aber weder die Produktion noch die Auslieferung dieser Fahrzeuge richtig in Gang!

Manipuliert die „fossile“ Autoindustrie die Herstellung vernünftiger Elektro-Autos?

Als kraz beobachten wir diesen erstaunlichen Widerspruch schon seit langem und stellen uns die Frage: Wird die Produktion vernünftiger E-Autos in Aachen gewollt behindert? Und warum könnte das geschehen?

Vorweg das Besondere an Streetscooter und e.Go

  • Der erste war der „Streetscooter“ (10/2015). Er ist ein Elektro-Lieferwagen und es gibt ihn in zwei Größenvarianten: „klein“ wie ein VW-Transporter und „groß“ wie ein Mercedes-Sprinter. Es ist ein zweckmäßig konstruiertes, einfaches Fahrzeug. Die Einzelkomponenten sind weitestgehend Standardprodukte.
    Er passt perfekt in das Anforderungsprofil „Versorgungs- und Arbeitsfahrzeuge im Nahbereich“ (<150km) mit vielen Zwischenhalten, Rückkehr zu einem festen Standort und einem Fahrzeugpool bei flexibler Nutzung von Firmen. Ein perfektes Fahrzeug für ALLE städtischen und regionalen Lieferdienste.
    Die Streetscooter gingen sehr schnell an die Kunden. Seither laufen etwa 10.000 Fahrzeuge in einem harten Alltagsbetrieb. Es sind keine bemerkenswerten Produktionsfehler bekannt geworden.
  • Das zweite Aachener Fahrzeug ist der „e.Go“ (seit 2016), ein kleiner Stadtwagen. Vom Raumangebot her ist er zwischen Smart und Fiat 500/VW Lupo angesiedelt. Technisch ist er komplexer als der Streetscooter, basiert aber auf den Erfahrungen bei dessen Entwicklung. Auch hier werden sehr einfache Komponenten verwendet. Es gibt keine technisch-sachlichen Gründe für Lieferprobleme der Komponenten (außer: man will nicht liefern). Ebenso wenig sind Probleme bei der Zulassung des Wagens bekannt.
    Das Anforderungsprofil ist gezielt für den innerstädtischen Ein-/Zwei-Personenverkehr konzipiert; entweder als Firmenpool-Wagen oder aber als privater Zweitwagen. Mit einem Preis von <20.000€ ist der e.Go deutlich preiswerter als die heutigen anderen E-Autos!

Beide Wagen sind auf ein Käuferpublikum mit folgenden Eigenschaften ausgerichtet: Zweckmäßige Nutzung eines Fahrzeugs, ökologische Orientierung, kein Bedarf an psychologischem Imageaufbau/Protzen (ich-bin-männlich, ich-bin-sportlich, ich-bin-reich).
Diese positive Bewertung bezieht sich ausdrücklich auf das genannte Nutzersegment. [3] Es sind keine klassischen Allzweckautos – da müsste sich noch deutlich was an der Batterietechnik tun. Aber für die genannten Nutzungssegmente gibt es zur Zeit nichts besseres als diese beiden Wagentypen!

==> Hierzu ein positiver Bericht in Auto-Motor-Sport

Die bisherige (kurze) Geschichte von Streetscooter und e.Go

  • Der „Streetscooter“ startete 2014 fulminant und machte ansehnliche Produktionszahlen. Die Firma (Produktionsanlagen) wurde 2014 von der Post AG aufgekauft und sogar noch in Düren durch ein zweites Werk erweitert – und dann würde es plötzlich ganz ruhig um den Wagen.
    Anfangs war er ein Verkaufsrenner. Die Post hat über 10.000 Fahrzeuge im Einsatz, man sieht das Fahrzeug aber auch bei anderen Lieferdiensten. Trotz dieser Erfolge wird der Streetscooter mittlerweile als Sorgenkind präsentiert, Gerüchte besagen, dass die Post das Werk wieder verkaufen will.
  • Den „e.Go“ gibt es seit 3/2017. Seit 5/2017 kann man den Wagen prinzipiell! kaufen. Und mittlerweile arbeiten 500 Leute in dem e.Go-Werk – aber der Wagen wird einfach nicht ausgeliefert!
    Seit mindestens 11/2018 gibt es auf der Hohen Straße in Köln einen großen ‚e.GO Pop-Up Store‘, in dem systematisch Werbung für den Kauf des e.Go macht. Die Verantwortlichen werden das Geld dafür doch nur in die Hand genommen haben, weil sie selber den baldigen Verkauf des Wagens erwartet hatten.
    Stattdessen werden halbjährlich Ausreden für die Nicht-Auslieferung veröffentlicht und die (willigen) Kunden immer wieder vertröstet. Ursprünglich sollten 3000 Fahrzeuge bis Ende 2019 produziert werden. Die Auslieferung ist aber erneut ins Jahr 2020 verschoben worden.
    Den e.Go gibt es „theoretisch“, aber aus irgendwelchen dubiosen Gründen ist er einfach nirgends zu kaufen! Auch der OB Philips wartet nach eigener Aussage immer noch auf „seinen“ e.Go!

Warum also Probleme – bei beiden E-Fahrzeugen?

Diese mysteriöse Geschichte über „Produktionsprobleme“ wird halbjährlich in den lokalen Zeitungen mit wortreichen Ausreden und erstaunlichen Meldungen begründet. Die letzte Überschrift dazu lautet am 19.10.2019 in den AN „e.Go räumt Produktionsprobleme ein.

  • Zu Problemen beim „Streetscooter“ ist (öffentlich) nichts bekannt!
  • Beim e.Go werden öffentlich folgenden Gründe genannt:
    • Der Lieferant ‚Ford‘ liefert nicht. (Was, welche Teile und warum? Ist unklar)
    • Der Batterielieferant ‚BMZ‘ ziert sich mit Lieferungen.
    • Und echt witzig: in den AN vom 19.10.19 wird eine „IP67-Regel für technische Geräte“ zitiert, die folgende skurrile Auflage enthält: „technische Geräte müssen auch nach einem mind. 30 minütigem Tauchbad im bis zu einem Meter tiefen Wasser voll funktionsfähig sein“. Und weil Lieferkomponenten diese Regel nicht erfüllen, darf der e.Go nicht gebaut werden?? Hmm!?

Es gibt ein ganz anderes, aber echtes Problem beim e.Go

Dort entstehen monatliche Unkosten von 2-3 Mio Euro! Seit Monaten sind dort ca. 500 Leute beschäftigt, was bei e.GO mindestens 2-3 Mio Euro Kosten, ohne jedwede Einnahmen erzeugt. Es müsste also ein Kostenproblem existieren – das aber öffentlich NICHT problematisiert wird.

Wieso führt das eigentlich nicht zum Bankrott? Wer bezahlt das?
Sorgt VW dafür, dass das Werk nicht pleite geht? Sorgt VW für Ruhe an den Arbeitsplätzen (wo ja faktisch nicht produziert wird) und „erkauft“ sich (wörtlich) so die Zeit, um seine wesentlich teureren Modell an den Markt bringen zu können? Die Erklärung könnte in der „Strategischen Partnerschaft“ von VW und e.Go liegen (siehe weiter unten).

Unsere Vermutung:
Es gibt einen Boykott der Auto-Industrie gegen ein vernünftiges E-Auto!

Je öfter sich die Ausreden für die Nicht-Lieferung des e.Go wiederholen, desto mehr fragen wir uns, ob wir gerade Zeugen werden, wie die (fossile) deutsche Autoindustrie mit trickreichen Mitteln verhindert, dass endlich mal vernünftige Elektro-Autos (statt der gigantischen E-SUVs) auf den Markt kommen?

Wir haben deshalb mal zusammengestellt, was wirklich hinter dieser eigenartigen und für Aachen (als perspektivischem Produktionsstandort) etwas bitteren Geschichte stecken könnte.

Indizien für eine „gewollte Produktionsbehinderung der sinnvollen E-Autos“

Unser Denkansatz lautet: Die Produkte Streetscooter und e.Go sind (vom Timing und der Funktionsweise) viel zu gut, sodass sie den ganz Großen in der Automobilbranche als Konkurrent echten ökonomischen Ärger machen und deshalb auf dem Markt stark „eingehegt“ oder besser noch „verhindert“ werden müssen. Möglicherweise hatte die fossile Autoindustrie beim Streetscooter noch erwartet, dass die RWTH-Newcomer es nicht schaffen würden. Aber nachdem der Streetscooter dann doch ein Erfolg wurde, wollten sie beim e.Go „besser aufpassen“. Die folgenden Argumente gelten für beide Fahrzeuge.

  • „Zeit schinden, um noch ein/zwei Jahre fossile Autos verkaufen zu können“ (= ExtraProfit-sichern). Jeder Monat spätere Auslieferung guter E-Autos schafft „Zeitraum“ für den Verkauf weiterer (gewinnbringender) Fossil-Autos.
  • „Zeit schinden, um als erstes Protz-E-Autos verkaufen zu können“ (=ExtraProfit-sichern). Solche sinnvollen E-Autos kommen für die fossile Autoindustrie „zu früh“, weil:
    • der Markt für dicke E-SUVs & schnelle E-PKW frei bleiben soll. Leute mit viel Geld wollen sich ein „grünes Image“ kaufen und zahlen dafür auch gerne viel Geld ….
    • erst nach Abdeckung dieses Marktanteils, „lohnt“ sich auch die Belieferung des preiswerteren Marktsegments.
      Sobald einmal der e.Go für 16.000 – 19.000 € auf der Straße zu sehen sein wird, brechen mit Sicherheit die Verkaufszahlen all der wunderschönen E-Golfs E-Opels, E-BMW, E-Benz ein, die zwar (sinnloserweise) in 3 Sek von Null auf 100 km/h „können“, aber preislich mindestens ein/zwei Klassen teurer sind.
  • „Diskreditieren“
    Diese Protz-E-Autos werden die Diskussion um die E-Mobilität bestimmen, weil viele ernsthafte Umweltschützer leider ausschließlich den Irrsinn der Protz-E-Autos sehen werden. Die Relevanz von sinnvollen E-Autos wird dann (wie beabsichtigt?) in den Hintergrund gedrängt.
  • „E-Auto als Spielzeug“?
    siehe zusätzlich auch den Artikel „Produziert e.Go Mobile bald ein VW-Funcar?

Eine vergiftete „strategische Partnerschaft“ mit VW?

Es gibt eine vertraglich/kommerzielle Verbindung zwischen VW und e.Go, die ebenfalls für die von uns unterstellte, bewusste Behinderungs-Strategie spricht: Wir wissen, VW will e.Go als Basis für die eigene, zukünftige E-Mobilitätssparte haben. (In den AN vom 5. März 2019 heißt es dazu: „… Der Weltkonzern öffnet seinen Elektrifizierungsbaukasten (MEB), mit dem es ab 2020 die neue Generation von Elektroautos bauen will, … e.GO ist weltweit der erste Partner in der Elektrosparte … Das Aachener Unternehmer profitiert doppelt von der Kooperation: Zum einen kann der Baukasten in die gerade anlaufende Produktion des eigenen e.GO life integriert werden. Und beide Unternehmen entwickeln in den kommenden Monaten gemeinsam ein Elektro-Auto, das die VW-Flotte ergänzen soll….“ (https://www.aachener-nachrichten.de/nrw-region/kooperation-von-ego-und-vw-neue-elektroautos-in-aachen-produziert_aid-37182963)

Das würde einerseits erklären, wer und warum die Übernahme der aktuell entstehenden Kosten übernimmt. Unfreundlich formuliert ist das dann ein „Leerlauf-Geld“ oder „Bestechungsgeld“ von VW, damit im Aachener e.Go-Werk Ruhe herrscht und man „freiwillig“ nicht liefert, um so den Markt für die in 2020 kommenden (erhofften) VW-Modelle „frei“ zu halten.

Beides macht Sinn für VW: Einerseits so den gefährlichen Newcomer klein halten; gleichzeitig sich dessen Know-how für die eigenen (eigentlich zu spät) kommenden Goliath-Aufgaben an zu eignen!

Es KÖNNTE aber auch ganz anders sein…

Es gibt doch echte Probleme bei der Produktion – eine simplere Erklärung?
Dann wären die Produktions- und Auslieferungsverzögerungen Ergebnis echter Probleme und zeigen nur, dass eine RWTH (bzw. das kommerzielle Spin-Off) nicht in der Lage ist, ein sinnvolles verkäufliches Produkt zu entwickeln, technisch zu planen und zu produzieren. Wir von der kraz glauben DAS nicht.

Zum Schluss eine Bitte

Wir haben versucht, eine wichtige Wirtschaftsentwicklung in Aachen zu beschreiben. Uns fehlen eine Reihe von Fakten, wir haben nur „mögliche“ Erklärungen geliefert. Unsere LeserInnen mögen selber entscheiden, was da eigentlich los ist.

Als kraz-Redaktion würden wir uns aber freuen, wenn wir Insider-Informationen bekämen, die unsere genannten Thesen entweder stützen oder aber widerlegen. Uns geht nicht um das „Recht-Haben“, wir wollen „verstehen“.

Anmerkungen

[1] Zur Geschichte der Aachener Auto-Produktion
Zu Beginn des vorigen Jahrhunderts (1903) gab es eine Automobilproduktion in Aachen durch die Firmen Fafnir und Cudell. Aber schon 1926 war alles wieder vorbei. Deshalb war es schon eine Sensation, als Streetscooter und e.Go als Spin-Offs der RWTH neu auftauchten.

[2] Das Missverständnis im Namens „Elektro-Auto“
Ein Elektro-Auto heißt so, weil der Antrieb „elektrisch“ ist. Der Strom für den Antrieb kann prinzipiell auf unterschiedliche Art ins Fahrzeug gelangen (Straßenbahnen und O-Busse bekommen ihn per Oberleitung). Bei Autos ist der heutige Standard eine (Lithium)-Batterie. Sie könnten aber genauso gut durch Brennstoffzellen (Wasserstoff) mit Strom versorgt werden! Eine (veraltete) Zwischenlösung war ein kleiner fossiler Motor im Fahrzeug, der dessen Batterie und damit die Elektromotoren mit Strom versorgt.

[3] Unser hohes Lob für den Streetscooter und den E.Go könnten so wirken, als ob wir E-Autos für DIE Lösung der städtischen oder gesellschaftlichen Problematik des Autoverkehrs halten.
Nein, wir wissen sehr wohl, dass Elektrofahrzeuge auch den gleichen Platz verbrauchen, den Fuß- und Radverkehr gefährden und verdrängen, die Städte mit Lärm verpesten usw. usf.. Elektroautos sind nur in einigen Bereichen ein echter Fortschritt gegenüber den fossilen Autos. In anderen sind sie genauso schlecht und für das „schlechte Gewissen bei der Autonutzung“ sind E-Autos sogar eher verführerisch, um sich so ein reines Gewissen zu verschaffen!
Wir wissen, dass die wirkliche Lösung ein anderes Verkehrskonzept (= anderer Modalsplit) mit viel mehr Öffentlichem Verkehr (ÖV) sein muss und sein wird. Hierzu gab und gibt es in Aachen Überlegungen („Renaissance der Tram“), über die wir in einem längeren Artikel berichten werden.

Datei:Streetscooter 3.JPG

ABER: Wir wissen auch, dass die Umformung unserer Lebenswelt in Auto-gerechte-Städte – und leider auch des „Denkens“ der Menschen im Sinne einer ‚Windschutzscheibenperspektive‘ – „erfolgreich“ gesteuert durch die Profitlogik der Autoindustrie gelungen ist und dass mit dem aktuellen Höhepunkt der Perversion durch SUVs und der aktuellen Automode mit den hochgeschürzten, aggressiven Frontpartien der Autos eine spezielle Form der „Männlichkeit“ bedient wird.

Deshalb wird es – egal wie schnell ein deutlich besserer ÖV entwickelt wird – noch lange individuell fahrende Autos geben, die bestimmte Bereiche in den Städten und Regionen mit Autos statt mit ÖV bedienen. Unklar ist, wie lange es noch dauert, bis die selbstgesteuerten durch autonom fahrende Fahrzeuge ersetzt werden. Und spätestens DANN wird ein hoher Bedarf an elektrischen – statt fossilen Antrieben bestehen.

Deshalb wünschen wir uns jetzt schon die beschleunigte Entwicklung der Elektroautos – und gerne auch Aachen als die Stadt, in der die Vorreiterfahrzeuge entwickelt und produziert werden. Heute polemisieren noch nur noch genau diejenigen gegen E-Fahrzeuge, die bisher immer die fossile Industrie und ihre Protz-Autos erhalten wollten. Wenn sie dabei heute das Argument „mehr ÖV“ verwenden, ist das nur verlogen. Wir sagen das aus Kenntnis der Verkehrspolitik der letzten 35 Jahre, die sich an zwei wichtigen Lobbyorganisation manifestiert hat: Dem ADAC (als reine Autolobby) und dem VCD (=Verkehrsclub Deutschland), der sich seit seiner Gründung 1986 eindeutig für ein sinnvolles Miteinander ALLER Verkehrsteilnehmer: Fußgänger, Radfahrer, ÖV-Nutzer und Autofahrer einsetzt.

Quelle: https://www.kraz-ac.de/elektroautos-made-in-aachen-5974

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen          :

Oben           —         Prototyp StreetScooter Leichtelelektromobil     C 16

Author Franz Haag

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

——————————-

Unten      —          Streetscooter – Ein batteriebetriebenes Lieferfahrzeug für die Deutsche Post, gebaut in Aachen von der Talbot Services GmbH

Urheber RudolfSimon

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Medien, Nordrhein-Westfalen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle  streifzuege.org

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.

Keep-it-in-the-ground.jpg

Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.

—————————–

2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.

—————————-

3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.

——————————–

Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

30 Jahre Mauerfall

Erstellt von DL-Redaktion am 2. November 2019

Geistiges Kleingärtnertum

Von Stefan Reinecke

Non Stefan ReineckeDie westdeutsche Linke träumte von Revolutionen. Doch als 1989 eine vor ihrer Haustür geschah, war sie überfordert.

Wir kennen die Bilderschleifen, die jeden 9. November aufs Neue gezeigt werden. Wahnsinn-Rufe, knatternde Trabis, Genscher und der Jubel in der Prager Botschaft. Auch Bilder können Floskeln werden, die mehr verstecken als erhellen. Im Herbst 1989, sagen diese Bilder, waren die Deutschen begeistert.

Alle Deutschen? Die Stimmung im Westen war viel schwankender. Im September waren aus der DDR schon Zehntausende in den Westen gekommen. Es fehlten Wohnungen und Jobs. Laut einer Umfrage meinte fast die Hälfte der Westbürger, das Boot sei jetzt leider voll und die Ostler sollten bitte in Plauen und Güstrow bleiben.

Ein paar Wochen nach dem Mauerfall ventilierte Oskar Lafontaine, ob DDR-Bürger weiterhin ein Anrecht auf Sozialleistungen haben sollten. Damit fördere man ja deren Abwanderung. Der SPD-Chef wollte, zumindest für eine Weile, zwei Staatsbürgerschaften. Lafontaine wollte die DDR genau in dem Moment faktisch anerkennen, in dem die SED politisch und die DDR wirtschaftlich kollabierte.

Er spekulierte auf das Gefühl der Westler, von den Habenichtsen aus dem Osten überrannt zu werden. In seinen Reden erschien die Einheit eher als unvermeidliches Übel. Die Grünen rangen sich widerwillig im Frühjahr 1990 – noch nach der SED/PDS – dazu durch, anzuerkennen, dass die Zweistaatlichkeit Geschichte war.

Keine Hürde für Europa

Die Erklärungen von Sozialdemokraten und Grünen bezeugen, 30 Jahre später gelesen, Realitätsblindheit. Warum diese Irrtümer? Der Historiker Timothy Garton Ash hat die Unfähigkeit der SPD im Herbst 1989 mit der erstarrten Ostpolitik erklärt.

Die SPD war demnach auf die SED-Führung und die Politik kleiner Verbesserungen fixiert und nahm die Bürgerbewegung nur als Störung wahr. Die späte Ostpolitik zeigt in der Tat Wahrnehmungsblockaden einer Politik, die auf Verständigung mit den Macht­eliten einer Diktatur verengt war. Allerdings waren die Grünen eng mit der Bürgerbewegung verdrahtet – und hatten ähnliche blinde Flecken.

Die westdeutsche Linke versagte 1989 komplett: moralisch, analytisch und politisch. Moralisch gab es keine Rechtfertigung dafür, dem DDR-Volk, das sich gerade befreit hatte, vorzuschreiben, in welchem Staat es zu leben hatte. Warum sollte Selbstbestimmung in Tibet und der Westsahara gelten, aber nicht zwischen Rostock und Görlitz? Zudem hatte die DDR laut Grundgesetz-Artikel 23 misslicherweise das Recht, der Bundesrepublik beizutreten.

Politisch hechelte die Linke dem Geschehen hinterher. Kohl setzte zügig die Währungsunion um. Dazu gab es angesichts des Abwanderungsstroms von Ost nach West keine realistische Alternative. Doch Lafontaine war überzeugt, dass die Währungsunion ein Fiasko würde und Kohl, der Nationalist, von seinen haltlosen Versprechungen eingeholt würde. Auch die atemlose Kritik, dass die deutsche Vereinigung die europäische zerstören würde, war falsch. Kohl setzte die Einheit zusammen mit Paris, London, Moskau und Washington ins Werk. Die deutsche Einheit war keine Hürde für Europa – im Gegenteil.

Gegen den Kapitalismus

Nach dem 9. November zeigte sich das geistige Kleingärtnertum der politischen Linken. Sie war fasziniert von Revolten gegen Autokraten – in dem Moment, in dem eine Revolution vor ihrer Haustür passierte, war sie schnell irgendwie beleidigt. Eine Epoche ging zu Ende. Die radikale Linke nahm übel, weil die Ossis genau das wollten, was sie ablehnte: Parlamentarismus und Kapitalismus. Viele Sozialdemokraten und Grüne klammerten sich an ihre eingravierte Überzeugung, dass es zwei deutsche Staaten geben müsse, und mäkelten, dass Kohl wieder alles falsch mache. Aber Kassandra gewinnt keine Wahlen.

Warum dieses Versagen? Es wurzelte nicht in der Nähe zum SED-Regime, sondern tiefer. Es gab in der Linken zwar eine kleine Strömung – um Rudi Dutschke, Tilman Fichter und Peter Brandt – die die Einheit als linkes Projekt verstanden. Doch das Gros hielt das für einen bizarren Spleen.

Die meisten Linken verstanden die Teilung irgendwie als gerechte Strafe für die NS-Verbrechen. Das war historisch Unsinn: Die innerdeutsche Grenze war, wie jedes Schulkind wissen konnte, Resultat des Kalten Krieges. Aber unser Gefühl sagte etwas ­anderes. Wir waren, manche insgeheim, manche ­offen, froh, dass die Mauer die fatale Geschichte des deutschen Nationalstaates beendet hatte.

Bundeshauptstadt Bonn 04.jpg

Ich will die neue Kanzlerin werden. Mein Hab und Gut habe ich mitgebracht.

Und gab es dafür nicht auch solide, vernünftige, moralische Motive? Der Historiker Hans Mommsen hatte 1981 eine historische Einordnung des bundesrepublikanischen Selbstgefühls skizziert. Wie in Österreich gebe es in der Bundesrepublik das Bewusstsein, etwas Eigenes geworden zu sein. Der Bismarck’sche Nationalstaat sei Geschichte und die Deutschen seien angesichts der Katastro­phen des 20. Jahrhunderts besser in mehreren Staaten aufgehoben.

Die westdeutsche Linke war postnational – und damit Avantgarde. Die Hälfte der unter Dreißigjährigen im Westen empfand die DDR 1987 als Ausland. In einem CDU-Programmentwurf von 1988 kam die Wiedervereinigung nicht mehr vor. Hatte nicht auch Helmut Kohl 1981 festgestellt, dass „die verlorene Einheit im Sinne eines alten Nationalstaates nicht mehr wiederherstellbar ist“?

Quelle          :        TAZ         >>>>>        weiterlesen

———————————————————————

Grafikquelle          :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

——————————

2.) von Oben    —           DL / privat  – CC BY-SA 3.0

———————–

Unten         —        Die Bundesumweltministerin Angela Merkel am Stresemannufer hinter dem Plenarsaal der ehemaligen Bundeshauptstadt Bonn beantwortet einem Fernsehteam deren Fragen. Im Hintergrund ist das Abgeordnetenhochhaus Langer Eugen zu sehen. Fotografische Impressionen von Andreas Bohnenstengel während der Parlamentarischen Woche im Juni 1995 in: Der Dreizehnte Deutsche Bundestag. Innenansichten unseres Parlaments. ISBN 3-87576-357-2

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Der Cum-Ex-Prozess

Erstellt von DL-Redaktion am 29. Oktober 2019

Der Kronzeuge packt aus

File:Hn-mattheuer-mann-mit-maske-1983.jpg

Von , und

Dieser Mann weiß fast alles über den größten Steuerraub der deutschen Geschichte. Denn er gehörte zum inneren Zirkel der Täter. Nun sagt er im Bonner Cum-Ex-Prozess aus.

Im Frühjahr 2016 kommt es in einem Besprechungsraum des Flughafens Zürich zu einer Begegnung, die für die strafrechtliche Aufarbeitung des größten Steuerraubs in der deutschen Geschichte wegweisend ist. Dort treffen sich Männer, die die Geschäfte zulasten der deutschen Staatskasse perfektioniert haben. Gemeinsam haben sie über Jahre hinweg Cum-Ex-Deals eingefädelt. Doch jetzt will einer von ihnen auspacken. Er will zum Kronzeugen der Staatsanwaltschaft werden und alles über die unlauteren Geschäfte erzählen, die sie gemacht haben.

Aufgebracht reden die anderen Männer auf ihn ein. Für sie ist die Staatsanwaltschaft der Feind. Es sei verrückt, mit ihr zu kooperieren. Die Phalanx müsse stehen. Rund anderthalb Stunden geht das so. Dann unterbricht der Anwalt des Aussteigers die aufgeregte Debatte: „Wissen Sie, wir haben das alles gehört. Aber wir machen alles genau anders.“ Der Bruch ist vollzogen. Bald darauf empfängt die Oberstaatsanwältin und Cum-Ex-Anklägerin Anne Brorhilker ihren wichtigsten Belastungszeugen zum ersten Mal in einem unscheinbaren Vernehmungsraum im Landeskriminalamt Düsseldorf.

Der Mann, der von dieser Szene berichtet, soll an diesem Dienstag im ersten Cum-Ex-Strafprozess vor dem Landgericht Bonn als Zeuge aussagen. Dreieinhalb Jahre nach dem Treffen in Zürich dürfte er Dutzende Personen und Banken schwer belasten, sofern er seine Aussagen vor der Staatsanwaltschaft im Gericht wiederholt. Unter anderem äußerte er sich zu den Hamburger Privatbanken M.M.Warburg und Varengold, zur Schweizer Privatbank Sarasin, zur australischen Investmentbank Macquarie und zu verschiedenen Depotbanken. Außerdem zur Kapitalverwaltungsgesellschaft Ballance, die in dem Prozess eine wichtige Rolle spielt.

Vor einem Jahr hat der Zeuge seine Rolle im Cum-Ex-Skandal in einem Gespräch ausführlich beschrieben, das er mit einem Reporterteam vom ARD-Magazin Panorama, der ZEIT, ZEIT ONLINE und Correctiv unter dem Namen Benjamin Frey geführt hat. Er sagte damals: „Das ist organisierte Kriminalität in Nadelstreifen.“ Seine Geschäftspartner und er hätten sich gefühlt, als hätten sie Fort Knox geknackt. „Warum? Weil der Staat die Quelle des Geldes war und diese Quelle, die konnte nicht versiegen.“

Von den Männern, die bei jenem denkwürdigen Treffen in Zürich dabei waren, muss sich im Bonner Prozess allerdings keiner verantworten. Angeklagt sind dort zwei britische Aktienhändler. Sie sollen zwischen 2006 und 2011 insgesamt 447,5 Millionen Euro aus der deutschen Steuerkasse geraubt haben. Aber sie haben, so sagt es der Zeuge, eng mit seinen Geschäftspartnern zusammengearbeitet, unter anderem über ihre Firma Ballance.

Außerdem hat das Landgericht fünf Banken an dem Prozess beteiligt, darunter die Hamburger Warburg-Gruppe, die der Zeuge vor der Staatsanwaltschaft belastet hat. Das Gericht nutzt damit den neu gefassten Paragraf 73 des Strafgesetzbuchs. Wenn Finanzinstitute eine Tat nicht unmittelbar begangen, sich aber mutmaßlich daran beteiligt und daraus Profite erzielt haben, könnten demnach nach einer Verurteilung der Täter Vermögen der Institute eingezogen werden, um den angerichteten Schaden auszugleichen.

Das Bonner Verfahren ist ein Musterprozess. Noch nie ist jemand strafrechtlich dafür belangt worden, dass er sich an Cum-Ex-Deals beteiligt hat. Sollten die beiden Aktienhändler verurteilt werden, wäre eine Grundlage dafür geschaffen, viele weitere Beschuldigte vor Gericht zu bringen. Staatsanwaltschaften in Frankfurt und München ermitteln ebenso wie die Staatsanwaltschaft Köln, die die beiden Aktienhändler vor Gericht gebracht hat.

Quelle          :           Zeit-online            >>>>>          weiterlesen

———————————————————————

Grafikquellen          :

Oben          —        Mann mit Maske von Wolfgang Mattheuer (1983), Skulptur am Gesundbrunnen, Heilbronn

Author p.schmelzle

I, the copyright holder of this work, release this work into the public domain. This applies worldwide. In some countries this may not be legally possible; if so:

I grant anyone the right to use this work for any purpose, without any conditions, unless such conditions are required by law.

————————–

Unten          —           Hauptsitz der M.M. Warburg & CO in der Ferdinandstraße 75 in Hamburg

Abgelegt unter Finanzpolitik, Justiz-Kommentare, Kultur, Nordrhein-Westfalen | Keine Kommentare »

Polizeigewalt in Köln

Erstellt von DL-Redaktion am 25. Oktober 2019

 Opfer-Täter-Umkehr wie aus dem Bilderbuch

File:Police brutality at Nigerian Embassy protest.jpg

Von Katja Thorwarth

Ein Mann erlebt Polizeigewalt, steht aber als Angeklagter vor Gericht. Obwohl er mehrfach freigesprochen wird, lässt die Staatsanwaltschaft nicht locker. Die Kolumne zum Thema.

Auf den Bildern, die der Mann 2016 auf Facebook postete, sieht man ihm die Misshandlungen an. Das Gesicht und der Kopf sind geschwollen, die Haut mit Blutergüssen übersät, die Arme und Beine malträtiert. Der Mann hatte sieben Stunden in Kölner Polizeigewahrsam verbracht.

An diesem Tag stand die Domstadt ganz im Zeichen des Regenbogens. Die CSD-Parade gegen Diskriminierung sexueller Minderheiten war in vollem Gange, als der Mann in eine Rangelei in einem Schnellrestaurant verwickelt wurde, die vor dem Eintreffen der Polizei bereits ein Ende fand. Den Ort hatte er sich noch geweigert zu verlassen, vielmehr soll er erschöpft auf einem Stuhl gesessen haben.

Opfer von Polizeigewalt: Wie das Protokoll eines Häftlings aus einem russischen Knast

Doch irgendetwas hatte die Beamten wohl getriggert, als der Mann mit einem Schlag ins Gesicht gegen die Wand geschleudert wurde. Er blieb reglos liegen, um mit einem „Schmerzreiz“ wieder in den Bewusstseinszustand überführt zu werden.

Damit sollte ein Martyrium seinen Anfang nehmen, das verschiedene Medien seit drei Jahren aufbereiten, und das sich liest wie das Protokoll eines Häftlings aus einem russischen Knast. Die Staatsdiener, dem Schutz des Individuums verpflichtet, legten ihm Handschellen an, traten und schlugen ihn, ehe sie ihn in ein Polizeiauto verfrachteten und in Unterhose und T-Shirt wegsperrten. Und mit klatschnasser Kleidung aus dem Hinterausgang entließen. „Das ist ein Bild, was voller Scham ist. Ja, voller Schmerz und Gewalt“, wird der Mann zitiert.

Polizeigewalt: Opfer-Täter-Umkehr wieaus dem Bilderbuch

Was hatte er sich zuschulden kommen lassen? „Das brauchst du doch, du dumme Schwuchtel“, soll die Aussage eines Polizisten laut Urteil des Landgerichts Köln gewesen sein, womit die Frage womöglich beantwortet ist. Denn wer sich das Geschehene vergegenwärtigt, könnte zu dem Schluss kommen, dass es sich hier um Homophobie in Uniform handelt, die in kollektivem Sadismus ihre Ausprägung fand. Und die als krimineller Akt zur Anklage gebracht gehört. Das ist bis heute nicht geschehen, im Gegenteil findet sich eine Opfer-Täter-Umkehr aus dem Bilderbuch.

20170707-IMG 9435.jpg

Bislang wurde der Fall zweimal vor Gericht verhandelt, und zweimal war das Opfer der Angeklagte. Die Beamten hatten wegen Widerstands gegen Vollstreckungsbeamte und Beleidigung Strafantrag gestellt, doch die Aussagen des Mannes wurden zweimal bestätigt, er zweimal vom Gericht freigesprochen – und jedes Mal, zuletzt 2019, ging die Staatsanwaltschaft in Berufung. Interessant an dieser Stelle ist, dass 2018 nur zwei Prozent mutmaßlich rechtswidrige Polizeigewalt von der Staatsanwaltschaft zur Anklage gebracht wurden. In diesem Fall scheint es jedoch so, als wolle die Staatsanwaltschaft das Opfer zum Täter umklagen.

Quelle          :       FR           >>>>>          weiterlesen

——————————————————————-

Grafikquellen          :

Oben          —              Police brutalize protester at rally against „embassy hearings“ in front of Nigerian Embassy, Berlin

Source http://asylstrikeberlin.files.wordpress.com/2012/10/polizeigewalt.jpg
Author Berlin Refugee Strike
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

————————–

Unten       —       Ein schwarzer Block der Staatsgewalt rückt aus      —G20 summit policetroops

Abgelegt unter Köln, Kriegspolitik, Kultur, Nordrhein-Westfalen | Keine Kommentare »

Karliczeks Batteriezentrum

Erstellt von DL-Redaktion am 25. Oktober 2019

Ein Forschungsinstitut für Münster

Recke CDU Politischer Aschermittwoch 2014 Anja Karliczek Markus Pieper Karl Josef Laumann 01.jpg

Hoch auf den gebräunten Podest

Von Manfred Ronzheimer

Es wurde eine Kommission gegründet, um den besten Standort für das Institut zu finden. Dann entschied das Forschungsministerium ganz anders. Den Zuschlag bekam die Heimatregion der Ministerin.

Bundesforschungsminis­te­rin Anja Karliczek musste an diesem Mittwoch zum zweiten Mal im Forschungsausschuss des Deutschen Bundestags antreten, um Auskunft in der sogenannten Batterieaffäre zu geben. Seit drei Monaten wird der Politikerin vorgehalten, dass ihr Bundesministerium für Bildung und Forschung (BMBF) in der Standortentscheidung über die Errichtung einer Forschungsfabrik für Batteriezellen die NRW-Stadt Münster bevorzugt hatte, unmittelbar neben dem Wahlkreis der CDU-Bundestagsabgeordneten Karliczek. Zuletzt standen sogar Rücktrittsforderungen im Raum, sogar von der CDU-Kultusministerin Susanne Eisenmann aus dem unterlegenen Baden-Württemberg, ein ungewöhnlicher Vorgang – „friendly fire“.

Die Batterieaffäre hat in den letzten Wochen die Kommunikationsfähigkeit des deutschen Forschungsministeriums – mit 18 Milliarden Euro immerhin der viertgrößte Einzelplan im Haushalt der Bundesregierung – bis an die Grenzen belastet. Hintergrundgespräche und Briefings in Folge, eine außerplanmäßige Anhörung des Ausschusses in der Sommerpause, durchgestochene Dokumente aus den Beratungen – auf den Ministeriumsneubau am Rande der Spree rollte offenbar ein Polit-Tsunami zu.

Oder doch nur ein Sturm im Wasserglas? Am Dienstag dieser Woche trifft die Ministerin im Morgengrauen mit zwei Journalisten der Süddeutschen Zeitung zusammen, um Fehler einzugestehen, was sie tags darauf auch im Parlamentsausschuss wiederholen wird. Aber die Schuldeingeständnisse sind eher banal. So hätte die „Gründungskommission“ der Zellenfabrik aus ihrer Sicht einen weniger missverständliche Namen tragen müssen.

Tatsächlich aber ist die fragwürdige Vergabepraxis für die Forschungsfabrik nur die innere Puppe einer Art russischer Matroschka, die tiefer reichende Defizite der deutschen Innovations- und Industriepolitik in größeren Zusammenhängen symbolisiert. Puppe 2: Die innovative Fehlentwicklung der deutschen Automobilwirtschaft, die jedes Jahr Abermilliarden an Forschungsgeldern in die Fortentwicklung auslaufender Verbrennungstechnologien investiert und den Epochenübergang zur Elektromobilität verschlafen hat, zum Schaden des gesamten deutschen Volkswirtschaft.

Puppe 3: Der widerstandslose Abbau der Elektrochemie – einst ein Paradefeld deutscher Grundlagenforschung – in den Hochschulen der 80er und 90er Jahre, mit dem Nebeneffekt, dass der einst führende Batteriehersteller Varta in diesen Jahren zerlegt wird. Ausstieg aus einem Zukunftsfeld, auch durch Fehleinschätzungen der damaligen Wissenschaftspolitik. Der diesjährige Chemie-Nobelpreis 2019 für die Lithium-Ionen-Batterie geht logischerweise an keinen deutschen Forscher.

Ein internationales Wettrennen

Nun muss sich Deutschland sputen, um im internationalen Wettrennen um die Stromspeicher von morgen nicht abgehängt zu werden. Batterien unterschiedlicher Bauart werden nicht nur für die Elektromobilität auf der Straße oder die mobile Kommunikationstechnik, sondern vor allem als Puffer für die erneuerbaren Energien benötigt. In den letzten Jahren hat das BMBF rund 500 Millionen Euro in den Aufbau neuer Strukturen für die Batterieforschung investiert. Am stärksten profitiert hat davon der Standort Ulm in Baden-Württemberg.

Im vorigen Jahr reiften im BMBF die Pläne zum Aufbau einer Forschungsfabrik für neue Verfahren zur Produktion von Batteriezellen, die mit 500 Millionen Euro aus dem Forschungsetat finanziert wird. Als Träger wurde die Fraunhofer-Gesellschaft ausgewählt. Vorbild ist die vor einigen Jahren installierte „Forschungsfabrik Mikroelektronik“, die von Fraunhofer zusammen mit der Leibniz-Gemeinschaft realisiert wurde.

Das BMBF-Vorhaben läuft parallel zum Aufbau einer konventionellen Fabrik zur Produktion von Batteriezellen, die das Bundeswirtschaftsministerium (BMWi) aus seinem Etat mit einer Milliarde Euro bezuschusst. Den Antrag eines europäischen Industriekonsortiums hat Wirtschaftsminister Peter Altmaier am 9. Oktober bei der EU-Kommission in Brüssel zur Genehmigung für ein sogenanntes IPCEI (Important Project of Common European Interest) eingereicht. Hauptziel ist es hier, die Abhängigkeit der europäischen Autoindustrie von asiatischen Antriebsbatterien zu verringern.

Anja Karliczek 04.jpg

An dem Interessensbekundungsverfahren des BMWi hatten sich mehr als 30 Unternehmen aus der gesamten Wertschöpfungskette „mit Vorschlägen hoher Qualität beworben“, teilte das Altmaier-Ministerium mit. „Sie kommen aus den Bereichen Rohstoffe und Exploration, Materialgewinnung und Recycling, Kathoden-, Anodenfertigung und mechanische Komponenten, Batteriezellproduktion, -integration und -anwendung.“ Die Standort-Entscheidung soll in den nächsten Wochen getroffen werden.

Datenvernetzte Fabriken

In der Forschungsfabrik des BMBF sollen dagegen neue Wege beschritten werden. Anfang des Jahres 2019 wurde auf einer Veranstaltung des Batterieforums das BMBF-„Dachkonzept Forschungsfabrik Batterie“ vorgestellt, das den „Aufbau und Betrieb einer weltweit einzigartigen Pipeline für Batterieinnovationen“ umriss. Dabei geht es vor allem um die drei Teilbereiche „ Materialkonzepte“, „Zellkonzepte“ – wie sie auch schon in der Forschungsproduktionsanlage am ZSW in Ulm „validiert“ wurden sowie um „Produktionskonzepte“, bei denen die deutschen Stärken im Bereich von „Industrie 4.0“, der datenvernetzten Fabrik, ausgespielt werden sollen.

Quelle       :          TAZ         >>>>>           weiterlesen

——————————————————————-

Grafikquellen        :

Oben      —          The 13th Political Ash Wednesday (Politischer Aschermittwoch) of the CDU-Kreisverband Steinfurt in Recke, Kreis Steinfurt, North Rhine-Westphalia, Germany. Among the CDU politicians on the podium were (from left to right) the member of the Bundestag Anja Karliczek, the member of the European Parliament Dr. Markus Pieper and Secretary of State of Germany Karl-Josef Laumann.

Abgelegt unter Bildung, Nordrhein-Westfalen, P.CDU / CSU, Regierung | Keine Kommentare »

Köln-Kurden machten mobil

Erstellt von DL-Redaktion am 24. Oktober 2019

Der Krieg auf der Domplatte

Fichier:Düsseldorf, Rosenmontag 2016, politische Karnevalswagen (06).jpg

Aus Berlin und Köln Dinah Riese, Anett Selleund, Christian Werthschulte

Adnan organisiert in Köln Proteste gegen den türkischen Einmarsch. Bekir Yılmaz in Berlin kann dagegen verstehen, dass die Türkei keinen PKK-nahen Staat tolerieren will. Der eine ist Kurde, der andere Türke. Landet der Konflikt an der syrischen Grenze jetzt mitten in Deutschland?

Aus dem Hauptbahnhof von Köln strömen an diesem wie an jedem Abend die Pendler*innen hinaus. Aber statt des Dom-Panoramas erwartet sie heute etwas anderes: gelb-grün-rote Fahnen der kurdischen Miliz YPG. Seit über einer Woche versammeln sich hier kurdische Gruppen, um gegen den Einmarsch der Türkei in Nordsyrien zu demonstrieren. „Operation Friedensquelle“ nennt die Türkei das, was sie tut; als „nicht im Einklang mit dem Völkerrecht“ bezeichnet es Bundesaußenminister Heiko Maas (SPD). Am Mittag gab es in Köln eine Mahnwache, jetzt am frühen Abend eine Demonstration. Heute sind etwa einhundert Menschen gekommen. „Man muss einen Tag als Kurde leben, um die Kurden zu verstehen“, sagt Adnan, der die Versammlung angemeldet hat. Sein Nachname soll nicht in der Presse veröffentlicht werden.

Adnan arbeitet als Sozialarbeiter in Köln, seine Familie kommt aus einem Dorf in der Nähe von Kobani auf der nördlichen Seite der türkisch-syrischen Grenze. „Ich schaue jede freie Minute aufs Handy“, sagt er. Er liest Nachrichtenportale, wartet auf E-Mails seiner Verteiler und telefoniert mit Freund*innen, die südlich der Grenze auf syrischem Territorium gewohnt haben. Sie sind mittlerweile in die 100 Kilometer entfernte Stadt Raqqa geflohen. „Ich fühle mich so hilflos“, erzählt er. „Wir sind bestürzt, dass wir alleingelassen werden.“ Aber die Solidarität der Bevölkerung mit der Mahnwache sei groß. Einen Tag später, am Samstag, demonstrieren in Köln 10.000 Menschen. An einem der Startpunkte flucht eine Frau im Vorbeigehen im rheinisch-türkischen Akzent: „Diese Scheißkurden. Sollen die doch woanders demonstrieren.“ Niemand beachtet sie.

Es ist kein neues Phänomen, dass sich Konflikte in und um die Türkei auch in Deutschland niederschlagen, sei es die türkische Militäroffensive gegen die syrische Stadt Afrin im Januar 2018 unter dem Namen „Operation Olivenzweig“ – ebenfalls ein Friedenssymbol – oder der Putschversuch in der Türkei 2016; oder seien es die verschiedenen Militärputsche in der Türkei, etwa 1971 oder 1980, in deren Folge viele Kurd*innen vor Verfolgung aus der Türkei fliehen mussten – zum Beispiel nach Deutschland.

Türkischstämmige Menschen bilden laut Mi­krozensus 2018 die größte Minderheit in Deutschland: 13,3 Prozent der „Menschen mit Migrationshintergrund“ hierzulande haben diesen, weil sie selbst oder mindestens ein Elternteil die türkische Staatsbürgerschaft hat oder hatte. Das sind rund 2,8 Millionen Menschen. Darunter sind auch viele Kur­d*innen. Wie viele von ihnen in Deutschland leben, lässt sich nicht so leicht beziffern. Schätzungen gehen von 600.000 bis anderthalb Millionen aus, sie oder ihre Familien stammen vor allem aus der Türkei, aus Syrien, dem Irak oder dem Iran.

Beiderseits wird provoziert. Bei spontanen, nicht angemeldeten Aktionen gegen kurdische Versammlungen und Demonstrationen seien nach Einschätzung des nordrhein-westfälischen Verfassungsschutzes „Anhänger der rechtsextremistischen Grauen Wölfe“ unter den Teilnehmenden gewesen, erklärt das Innenministerium des Landes. Diese, „aber auch nationalistische regierungstreue Türken“ hätten bei diesen Aktionen den Wolfsgruß gezeigt, um ihr Gegenüber zu provozieren. Kurd*innen wiederum reagierten „auf dieses Zeichen hoch emotional.“

Anfang dieser Woche kommt es in Herne zu einer Schlägerei zwischen Türken und Kurden, wie die örtliche Polizei berichtet, beteiligt sind 50 bis 60 Personen. Schon in der Vorwoche wurde in der Stadt im Ruhrgebiet der Wolfsgruß gezeigt, wo­raufhin kurdische Demonstrant*innen erst einen türkischen Kiosk und dann ein Café angriffen. Eine kurdische Demonstration in Mönchengladbach wurde „verbal attackiert“, so das NRW-Innenministerium, bevor es zu körperlichen Auseinandersetzungen kam. In Dortmund wurden türkische Fahnen sowohl gezeigt als auch verbrannt, Letzteres hat der Versammlungsleiter rasch unterbunden. In Lüdenscheid wurde ein türkischstämmiger Mann mit einem Messer schwer verletzt, in Bottrop wurden aus einer Gruppe von etwa 200 Menschen heraus Pflastersteine auf eine kurdische Versammlung geworfen. Immer wieder seien auch Parolen der auch in Deutschland verbotenen Kurden-Partei PKK gerufen oder entsprechende Symbole gezeigt worden.

So hätte der „Schwarze Block des Staat“ aussehen können.

Es sei eine Situation „kurz vor der Explosion“, man sitze „auf einem Pulverfass“ – so ist seit Tagen zu lesen. Unsicher fühle er sich in Köln im Moment nicht, widerspricht Adnan, auch wenn er bestimmte Ecken meidet, wo sich ultranationalistische Türken treffen: „Das hat man nichts zu suchen.“

Im Bundesinnenministerium gibt man Entwarnung. Im Zusammenhang mit der türkischen Militäroffensive würden bereits seit geraumer Zeit „Mobilisierungsaktivitäten kurdischer und deutscher linker Organisationen verzeichnet“, sagt ein Sprecher des Ministeriums auf Nachfrage. Vereinzelte gewaltsame Auseinandersetzungen seien „nicht auszuschließen“. Eine „Verschärfung der ­Gefährdungslage“ sei derzeit aber „nicht erkennbar“.

Quelle       :         TAZ              >>>>>            weiterlesen

—————————————————————–

Grafikquellen          :

Oben        —        So sah es einmal in Düsseldorf aus. /Düsseldorf, Rosenmontag 2016, politische Karnevalswagen.

Cette œuvre a été placée dans le domaine public par son auteur, Kürschner. Ceci s’applique dans le monde entier.

—————————

Unten     —          Bereitschaftspolizei officers during a demonstration

Abgelegt unter Feuilleton, Köln, Medien, Überregional | Keine Kommentare »

Armut und Reichtum

Erstellt von DL-Redaktion am 23. Oktober 2019

Zieht doch nach Duisburg!

Sofienstraße - Karl-Morian-Straße, Duisburg-Neumühl, etwa 1976.jpg

von Utta Seidenspinner

Mit einem Mietendeckel will der rot-rot-grüne Berliner Senat die Hauptstädter entlasten: So sollen Vermieter nicht mehr als 30 Prozent des Haushaltseinkommens verlangen dürfen. Das aber geht am Problem vorbei, argumentiert die Journalistin Utta Seidenspinner. Wer Mieter schützen will, muss grundsätzlichere Lösungen finden.

„Ja, das möchste: / Eine Villa im Grünen mit großer Terrasse, / vorn die Ostsee, hinten die Friedrichstraße; / mit schöner Aussicht, ländlich-mondän, / vom Badezimmer ist die Zugspitze zu sehn – / aber abends zum Kino hast dus nicht weit. / Das Ganze schlicht, voller Bescheidenheit.“ So beschrieb Kurt Tucholsky 1927 das Berliner Ideal.

Frappierend aktuell, möchte man sagen. Alles wollen und auf nichts verzichten, so lautet derzeit die Devise der Berliner Politik: Mehr Wohnungen in der Hauptstadt der viertgrößten Wirtschaftsmacht der Welt fordern, aber bitte zum Preis von Görlitz. Erst in den 2000er Jahren die kommunalen Wohnungen verhökern, so das Stadtsäckel füllen und dann den Investoren die Schuld an der verfehlten Wohnungspolitik in die Schuhe schieben.

Warum so erbost? Weil hier mit der linken Bausenatorin Karin Lompscher eine Berliner Ballungsraum-Politikerin mit hilfloser Polemik auf jene Leute losgeht, die in den vergangenen Jahren überhaupt Wohnungen gebaut und saniert haben und es weiterhin tun sollen. Investoren aber können auch ausweichen. Und wer baut dann? Das notorisch klamme Berlin wohl kaum.

Der Job eines Investors hingegen ist es grundsätzlich, Geld zu verdienen. Wo er dieses Geld anlegt, ist seine Wahl. In Aktien, Rentenpapieren oder Immobilien. In Asien, USA oder Europa. Sein Kompass sind Kriterien wie Risiko, Aufwand, Zeithorizont und Rendite. Berlin hat soeben bei mindestens zwei der Kriterien – Risiko und Rendite – Alarm ausgelöst. Bei Mietern und damit bei den Wählern mag das gut ankommen. Mittel- und langfristig ist es aber kontraproduktiv, Investoren zu verschrecken.

Bewährt hat es sich in einer sozialen Marktwirtschaft vielmehr, Anreize zu schaffen, um Wünschenswertes zu fördern und Unerwünschtes zu verringern. Es geht darum, durchdachte, behutsame Prozesse anzustoßen, die über den Ballungsraum-Tellerrand hinausweisen müssen. Denn in vielen Teilen Deutschlands besteht das Problem in Leerstand und mangelnder öffentlicher Versorgung. Dort wäre man glücklich über jeden Investor.

Ganz ohne politische Eingriffe funktioniert es hierzulande allerdings ebenso wenig: In Zeiten des Neoliberalismus Anfang dieses Jahrhunderts wurde entschieden, es sei das Beste, wenn sich der Staat aus allem heraushält. Aber das geht nicht, wenn er sich vorher rund einhundert Jahre lang in alles eingemischt und gezielt ein Volk von Mietern gefördert hat. Die Politik hat bei uns mehr als anderswo die Verantwortung, sich um das Wohnen zu kümmern, es galt in Deutschland nämlich schon seit der Weimarer Republik als gesellschaftliche Aufgabe. Und da Menschen nicht in ein Vakuum hineingeboren werden, ist es zu Recht ihre Erwartungshaltung, dass man sie vor dem freien Spiel der Kräfte schützt.

Was also wären sinnvolle Maßnahmen, um die Auswüchse in den Ballungsräumen zu puffern?

»In fast der Hälfte der Sozialwohnungen leben Menschen, die sich eigentlich mehr Miete leisten könnten.«

Der Bau von Sozialwohnungen gehört nicht unbedingt dazu. Mit ihnen hat man nicht nur gute Erfahrungen gemacht. So ziehen Menschen zwar arm ein, bleiben es aber vielleicht nicht. Dann kommt es zu einer sogenannten Fehlbelegung, deren Quote derzeit bei 42 Prozent liegt. In fast der Hälfte dieser Wohnungen leben also Menschen, die sich eigentlich mehr Miete leisten könnten – auf Kosten der Allgemeinheit, die diese Wohnungen finanziert hat.

Industrienahe Experten plädieren daher gerne für ein höheres Wohngeld, um damit gezielt Menschen zu fördern: Subjektförderung (Mensch) statt Objektförderung (Immobilie). Das Frühjahrsgutachten der Immobilienwirtschaft warnt sogar ausdrücklich vor großen Sozialwohnungsprogrammen: „Für besonders gefährlich halten wir Mengenvorgaben der Politik, wie z. B. in Berlin. Die kommunalen Wohnungsbaugesellschaften sind hier darauf verpflichtet worden, ihren Wohnungsbestand durch Neubau und insbesondere Bestandskäufe um gut 100 000 Wohnungen zu erhöhen. Nicht nur, dass dies angesichts der überhöhten Preise hochspekulative Investitionen sind, die sich als Fehlinvestition mit öffentlichen Geldern herausstellen können. Noch ärgerlicher ist es, dass eine solche Politik die Preisspirale weiterdreht und es den Rückgang der Preise für Wohnungen und Wohnungsbauprojekte verzögert, wenn das Land Berlin zum ‚Buyer of last Resort‘ wird.“ Harald Simons vom Forschungsinstitut Empirica gibt überdies zu bedenken, dass 50 bis 60 Prozent aller städtischen Haushalte einen Anspruch auf geförderte Wohnungen hätten: „Und von denen gewinnen dann 5000 ein Los und alle anderen gehen leer aus. Das ist auch ungerecht.“ Auch er empfiehlt, den Markt sich selbst zu überlassen und Einkommensschwache direkt mit Geld zu unterstützen.

Einen anderen Vorschlag macht der Deutsche Städtetag. Er plädiert für eine Abkehr von der bisherigen Praxis, öffentliche Flächen meistbietend zu verkaufen. Denn wenn Höchstpreise für die Grundstücke bezahlt werden, bleibt Bauträgern gar nichts anderes übrig, als Luxuswohnungen zu errichten, damit sich die Investition lohnt. Und laut Bundesinstitut für Bau-, Stadt- und Raumforschung sind diese Grundstückskosten derzeit das größte Problem: Bei einem neuen Haus verschlingen sie inzwischen bis zu 70 Prozent des Budgets, in den großen Städten – aufgrund der dichteren Bebauung – immerhin noch durchschnittlich 30 bis 50 Prozent.

Die Preise für Bauland sind in den vergangenen Jahren so enorm gestiegen, dass die Spekulation damit größeren Gewinn verspricht, als tatsächlich zu bauen. Das Land wird gehortet und liegt brach. Dieses „Landbanking“ wird finanziell sogar gefördert, denn der Staat besteuert unbebautes Land niedriger als bebautes. Die Forderungen nach einer Umkehr dieser Logik werden lauter, ausnahmsweise sogar von Industrie und Politik gleichermaßen.[1]

Hans-Jochen Vogel, ehemals SPD-Oberbürgermeister von München, hat „Sorge, dass wir die Dinge weitertreiben lassen und damit die soziale Kluft in unserem Lande noch weiter verbreitern“. Er rechnet vor, dass die Grundstückspreise in München seit 1950 um stolze 69 000 Prozent gestiegen sind. Damals kostete Bauland (erschlossen und baulich nutzbar) 6 Mark, rund 3 Euro, pro Quadratmeter heute sind es 2100 Euro. Das liegt vor allem an der gestiegenen Attraktivität der Stadt, der Lage, den Jobs, der funktionierenden Infrastruktur, der Versorgung mit Schulen und Universitäten. Nichts von alledem haben Grundstücksbesitzer erarbeitet, es ist ihnen in den Schoß gefallen.[2]

Auch bundesweit sind von 1962 bis 2015 die Baulandpreise um 1600 Prozent gestiegen, der normale Preisindex hingegen nur um 302 Prozent – eine Entwicklung, die bereits Anfang der 1970er Jahre abzusehen war. Der Münchner Stadtrat unter Oberbürgermeister Vogel forderte bereits im März 1972 vom Bund die Einführung einer Bodengewinnsteuer und die Abschöpfung der Planungsgewinne. Wenn Wertminderungen durch Planungsentscheidungen entschädigt werden müssten, dürften auch Wertsteigerungen nicht beim Eigentümer verbleiben. Selbst der damalige CSU-Chef Franz Josef Strauß sagte: „Die Grundstückspreise steigen in einem Maße, dass es nicht zu verantworten ist, diese Gewinne unversteuert in die Taschen weniger fließen zu lassen.“ Passiert ist dennoch nichts.

Duisburg, Zinkhüttensiedlung, 2012-11 CN-02.jpg

„Im Gegensatz zu damals gibt es heute aber noch nicht einmal eine öffentliche Diskussion darüber“, kritisiert Vogel in einem Gastbeitrag für die „Süddeutsche Zeitung“. Das Problem müsse ganz rasch zurück auf die politische Tagesordnung: „Grund und Boden ist keine beliebige Ware, sondern eine Grundvoraussetzung menschlicher Existenz. Er ist unvermehrbar und unverzichtbar, […] jeder braucht ihn in jedem Augenblick seines Lebens wie das Wasser oder die Luft.“[3]

Schon das Bundesverfassungsgericht beschloss vor über 50 Jahren, am 12. Januar 1967: „Die Tatsache, dass der Grund und Boden unvermehrbar und unentbehrlich ist, verbietet es, seine Nutzung dem unübersehbaren Spiel der Kräfte und dem Belieben des Einzelnen vollständig zu überlassen: eine gerechte Rechts- und Gesellschaftsordnung zwingt vielmehr dazu, die Interessen der Allgemeinheit in weit stärkerem Maße zur Geltung zu bringen als bei anderen Vermögensgütern.“ Und dann kommt ein aus heutiger Sicht revolutionär anmutender Satz: „Es liegt hierin die Absage an eine Eigentumsordnung, in der das Individualinteresse den unbedingten Vorrang vor den Interessen der Gemeinschaft hat.“[4] Und ausgerechnet in der Bayerischen Verfassung heißt es in Artikel 161, Absatz 2: „Steigerungen des Bodenwertes, die ohne besonderen Arbeits- oder Kapitalaufwand des Eigentümers entstehen, sind für die Allgemeinheit nutzbar zu machen.“ Das aber wurde bislang versäumt.

»Die Infrastruktur im ländlichen Raum wurde vernachlässigt oder radikal weggespart.«

Quelle        :          Blätter        >>>>>           weiterlesen

———————————————————————-

Grafikquellen      :

Oben       —          Ecke Sofienstraße / Karl-Morian-Straße in Duisburg-Neumühl. (Im Hintergrund sind Häuser auf der Lüneburger Straße zu sehen. Die auf dem Foto zu sehende Grünfläche war zu diesem Zeitpunkt noch unbebaut. Das Foto ist vor 1977 entstanden, vermutlich 1976.)

————————————

Unten         —        Duisburg (North Rhine-Westphalia, Germany) – borough Hamborn, district Obermarxloh – residential complex at square Zinkhüttenplatz

Abgelegt unter Nordrhein-Westfalen, P.CDU / CSU, Sozialpolitik, Umwelt | Keine Kommentare »

Sie trainieren unser Ende!

Erstellt von DL-Redaktion am 19. Oktober 2019

Zur laufenden Atomkriegsübung in Büchel 

Quelle         :       Scharf  —  Links

Ein Beitrag von Kathrin Vogler

Seit Montag und bis heute trainieren US-Truppen gemeinsam mit der Bundeswehr in der jährlichen Militärübung „Steadfast Noon“ den Atomkrieg über Deutschland. Die Bundeswehr setzt dabei Tornados und Eurofighter ein. Trainiert werden die Einsatzbereitschaft und die Fähigkeit zur Zusammenarbeit zwischen den europäischen Militärs und der in Europa stationierten US-Air Force-Kräfte. Die beteiligten deutschen Standorte sind in diesem Jahr Büchel und Nörvenich. Auch in Nörvenich waren früher Atomwaffen stationiert. In Büchel lagern aktuell bis zu 20 Atombomben des Typs B61. Das Taktische Luftwaffengeschwader 33 der Bundeswehr soll im Atomkriegsfall die Bücheler Atombomben im Rahmen der Nuklearen Teilhabe ins Ziel bringen.

Kathrin Vogler, friedenspolitische Sprecherin der Fraktion Die Linke im Bundestag, dazu: „Es ist völlig wahnsinnig, was da gerade geschieht. Die USA übt mit der Bundeswehr sowie niederländischen, italienischen und polnischen Streitkräften, wie man einen Atomkrieg in Europa führt. Käme es dazu, würden Millionen Menschen sterben und kein Stein bliebe auf dem anderen. Es ist auch skandalös, dass die Bevölkerung nicht informiert wird. Wir wissen zum Beispiel nicht, ob die Bücheler Atombomben während der Übung über der Eifel herumgeflogen werden.

Kathrin Vogler 3.jpg

Ich habe Mitte September eine Kleine Anfrage zu Steadfast Noon  gestellt, die die Bundesregierung bis heute nicht beantwortet hat. Wie groß ist das Risiko, dass hier ein katastrophaler Unfall geschieht? Dass diese Atomkriegsübung eine politische und militärische Drohgebärde gegenüber Russland sein soll, macht alles noch schlimmer: Steadfast Noon markiert den Rückfall in den nuklear bestückten Kalten Krieg, der uns alle als Geiseln nimmt. Meine Antwort darauf: Wir müssen alle Atomwaffen abschaffen. Die Bundesregierung muss sofort den UN-Atomwaffenverbotsvertrag unterschreiben.“

Urheberrecht

Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquellen      :

Oben       —       Explosion von Upshot-Knothole Badger 1953 auf der Nevada Test Site

———————————

Unten      —        Kathrin Vogler. Foto: Niels Holger Schmidt

 

Abgelegt unter Bundestag, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Beleidigungsbrief der ARGE

Erstellt von DL-Redaktion am 8. Oktober 2019

 ca. 35 Erwerbslose feierten eine „Arme Würstchen Party“ im Jobcenter

Quelle      :        Scharf  —  Links

Von KEAs e.V. und Initiative erwerbslos nicht wehrlos

Verleihung der Auszeichnung „Goldener Haufen rassistischer/klassistischer Scheiße“ an die Leitung des Jobcenters Köln-Porz

Anlass der Party war ein anonymer Beleidigungs- und Drohbrief, der per Hauspost an die Beratungsstelle Die KEAs e.V. (Kölner Erwerbslose in Aktion) gesendet wurde und mit offiziellem Stempel aus dem Jobcenter versehen ist . In diesem Brief werden Beratende und Alg II-Bezieher*innen pauschal als “Arme Würstchen“, „ Penner“ , „lächerlicher Haufen Scheiße“ und „ Asis und Kanaken“ bezeichnet. Die heutige Party war die Antwort der Initiative erwerbslos nicht wehrlos darauf .

Der Einladung folgten über dreißig Menschen, die eine stimmungsvolle Party mit Musik, Tanz uvm. im Wartebereich des Jobcenters feierten. Schmunzelnde sog. „Kunden „ im Wartebereich, Verteilung von Ballons an Kinder, sichtlich überforderte Mitarbeiter*innen und Sicherheitsdienst und immer wieder die Forderung, die Leitung möge sich her bemühen um ihren hart bzw. „hartz“ verdienten Preis entgegen zu nehmen – den goldenen Haufen rassistischer/ klassistischer Scheiße.

Die Preisträgerin ließ eine halbe Stunde auf sich warten, dennoch wurde sie mit einem hartzlichen Applaus begrüßt.

Auf den Wunsch der Preisträgerin hin wurde die Preisverleihung vor das Gebäude verlegt. Dort wurden die Gäste bereits von ca. 20 Polizist*innen erwartet. Trotz kleinerer Störungen seitens der Beamt*innen, wurde der Leitung der anonyme Beleidigungs- und Drohbrief verlesen. Die Jobcenter Leitung nahm den Inhalt desinteressiert auf und beauftragte im Anschluss die Beamten, die Personalien der Demonstrierenden festzustellen.

Diese Reaktion bestätigte die Jury in der Entscheidung, dass sie eine wirklich würdige Preisträgerin ist. Nach einer kurzen Laudatio und der Überreichung des goldenen Haufens rassistischer/ klassistischer Scheiße wollten die Protestierenden das Gelände verlassen. Einigen gelang dies, andere wurden auf dem Parkplatz von der Polizei eingekesselt oder vom öffentlichem Raum zurück auf das Jobcenter Gelände gezerrt. Dieses Vorgehen diente der Feststellung von Personalien, auch wenn dies nicht bei allen gelang.

File:Protest - "Hartz 4 macht nackig".JPG

Hiernach wurde noch auf der Straße bei Snacks und Grillwurst heiter weiter gefeiert und gefleyert.

Es bleibt dabei – Widerstand lohnt sich! Der Ausgangspunkt der Proteste und des Schreibens vom Jobcenter, war eine besonders böswillig und rassistisch agierende Fallmanagerin – Fr. A.. Diese soll laut mehrerer Betroffener seit Anfang September immerhin nicht mehr in Erscheinung getreten sein (erste Aktion: https://www.die-keas.org/Jobcenter%20Porz%20Begleitung ).

„Ihr werdet uns nicht los, wir sind viele und werden mehr.“ so die Ansage von Kim O. .

Hartz IV abschaffen!

Reichtum verteilen!

Armut abschaffen! 

Initiative erwerbslos nicht wehrlos & KEAs e. V.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————-

Grafikquellen       :

Oben      —          Scharf-Links

privat     —   KEAs

———————————-

Unten       —  

„Hartz 4 macht nackig“.
Date
Source Own work
Author High Contrast
Permission
(Reusing this file)
I, the copyright holder of this work, hereby publish it under the following license:
w:en:Creative Commons
attribution

Abgelegt unter Deutschland, HARTZ IV, Köln, Nordrhein-Westfalen | Keine Kommentare »

Climate: Justice – Chaos ?

Erstellt von DL-Redaktion am 4. Oktober 2019

Wetterfeste FFF Bewegung

Quelle      :  Scharf  —  Links

Von Jimmy Bulanik

Das Thema von FFF ist das Klima. Deshalb gilt es für die Bewegung unabhängig an Lebensjahren, Raum der Sozialisierung, gegenwärtiger Aufenthaltsort (wie von Besucherinnen und Besucher einer Messe oder Touristinnen und Touristen), Bildungsgrad, soziale Stellung in der Gesellschaft und Wohnorten mit ihrer Wetterfestigkeit wie der aktuell bevorstehenden Herbstferien auch zur Weihnachtsferien, Weihnachtszeit 2019, im Übergang zum Jahr 2020 das bestehende Ausmaß an Entschlossenheit öffentlich und medial unter Beweis zu stellen. Das stärkt ihre bereits bestehenden Glaubwürdigkeit im Inland als auch im Ausland. Sofern die Menschen in der Bundesrepublik Deutschland weiter unbeirrt Freitags für das Klima demonstrieren, desto höher die Chance das die Menschen im EU Ausland es vor Ort gleich handhaben werden.

Insbesondere die Menschen in Großstädten mit ihrem vorhandenen ÖPNV stehen in der Verantwortung. Ebenfalls wichtig dabei ist, dass von allen Landeshauptstädten, der Bundeshauptstadt Berlin, den EU Großstädten und EU Hauptstädten ein sichtbares und hörbares Signal ausgesendet wird, das weltweit nicht zu ignorieren ist. Jene Menschen welche im Umland einer Landeshauptstadt, Großstadt, EU Hauptstadt wohnen haben die Option eine Gemeinschaft zu bilden um gemeinsam in einer Großstadt vor Ort an den FFF Veranstaltungen teilzunehmen. Um Hürden abzubauen, gerne sich an die eigene Familie, Freundeskreis, ein (Sport) Verein, die Gewerkschaft oder eine Partei zu wenden um nach Unterstützung zu fragen. Einen Mangel an Fahrräder wird es mit Sicherheit nicht geben. Eine weitere Möglichkeit besteht darin Geld zusammenzulegen damit mehrere Personen auf ein ÖPNV Ticket fahren dürfen. Was allen offen steht ist die Menschen im persönlichen Zirkel, Zirkeln in jeglicher Form der analogen, digitalen Form der Kommunikation zu motivieren auch an den FFF Demonstrationen teilzunehmen. Die Bundesrepublik Deutschland hat viele Rentnerinnen und Rentner, Pensionärinnen und Pensionäre dessen Bedeutung an politischen Wahlen stetig wächst.

In der Thematik der Verschmelzung von Ökologie, Ökonomie und Soziales insbesondere in Verbindung mit der Digitalisierung befindet sich erheblich viel an positiver und progressiver Macht. Mitunter die Behandlung einer globalen Frage des bestehenden und zukünftigen System. Dies darf gerade in global volatilen Zeiten zu keinem Zeitpunkt unterschätzt werden und immer richtig eingeordnet. Menschen die an Kapitalmärkten, Banken, Unternehmungen dahinter arbeiten wissen dies nur zu präzise. Deshalb ist es ratsam das teilnehmende Personen an den FFF Demonstrationen mittels des dem Smartphone, Laptop, dem Internet ungefiltert Öffentlichkeit schaffen. Für die Qualität sind alle selbst verantwortlich und können sich dahingehend gemeinsam und gegenseitig fachlich optimieren.

Die Motive zur Teilnahme an den FFF Demonstrationen gibt es genug. Die neueste Augenwischerei der gegenwärtigen Bundesregierung in Sachen Klimapolitik ist aktuell lediglich eines davon.

Die innerdeutsche Landschaft der politischen Parteien wird die Entwicklung der FFF Demonstrationen bemerken. Es obliegt allen Menschen ob sie und ihre legitimen Inhalte und Ziele von der bestehenden Bundesregierung weiter ernst genommen werden oder ob die Parteien der neoliberalen FDP und der menschenverachtenden AfD, dessen Funktionär Höcke laut Gericht als Faschist betitelt werden darf bei ihren bevorstehenden Veranstaltungen zum Karneval im Jahr 2020 im Fernsehen in der Live Übertragung wie beispielsweise der politische Aschermittwoch hämische Witze auf Kosten von über 1,4 Millionen Menschen in der Bundesrepublik Deutschland, weitere Millionen Menschen in der Europäischen Union und weltweit der FFF, Klima Demonstrantinnen und Demonstranten artikulieren und obendrein dafür noch Applaus bekommen werden und beim geneigten Publikum lautes Gelächter auslösen werden. Die deutsche und internationale Industrie wie zum Beispiel der Automobilindustrie, Pharma Konzerne  würde es ihren Erfüllungsgehilfinnen und Erfüllungsgehilfen in den politischen Parteien mittels Aufträge, Posten und monetäre Zuwendungen danken.

Daher ist es allen möglich sich wetterfeste Kleidung anzuziehen, sich ökologisch und gerecht gehandelten vegetarisch oder veganen Proviant vorzubereiten und Fairtrade Kaffee, Kräutertee in einer Thermokanne auf die FFF Demonstrationen mitzunehmen. Von Menschen aus Südkorea habe ich vor vielen Jahren in meinem Leben gelernt, das diese ziemlich gerne eine warme Suppe in einer Thermokanne transportieren um dies außer Haus zu genießen. Vielleicht ist dies in kalten Zeiten auch etwas für die Menschen im Herzen oder Westen von Europa, bzw. der Europäischen Union.

Quelle:

https://fridaysforfuture.de

Bodo Wartke – Hambacher Wald

https://www.youtube.com/watch?v=tTKcnlp0x_Y

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————-

Grafikquelle      :

Wellington, Neuseeland, 15. März 2019

Abgelegt unter APO, International, Köln, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

Ein Stadtgespräch aus Essen

Erstellt von DL-Redaktion am 1. Oktober 2019

RWE baut das Portfolio um – Heuchlerische Pläne

Kuckum.jpg

Von Ingo Arzt

Die RWE feiert sich dafür, dass man jetzt auf Ökoenergien macht. Dabei ist der Konzern viel zu spät dran und zerstört weiterhin Dörfer für die Kohle.

Sie nennen sich „Menschenrecht vor Bergrecht“ und hatten zumindest am Montag keine Chance gegen RWE: Der Essener Energiekonzern generierte eine Menge positiver Schlagzeilen an der Börse und in der Wirtschaftspresse. Am Morgen präsentierte Vorstandschef Rolf Martin Schmitz die Neuaufstellung des Konzerns und bastelte daraus eine Jubelmeldung.

Fast zeitgleich schickten Anwohner*innen des Tagesbaus Garzweiler II einen Brief an Schmitz. Sie forderten eine „Klarstellung, dass in Zeiten des beschlossenen Kohleausstiegs und der Klimakrise keine Dörfer mehr für den Kohleabbau zerstört werden dürfen“. Der Konzern will die Orte Keyenberg, Kuckum, Berverath, Ober- und Unterwestrich und weitere trotz Kohleausstiegs zerstören und abbaggern. Das, obwohl Berechnungen etwa des Deutschen Instituts für Wirtschaftsforschung ergeben haben, dass für die Restlaufzeit der Kraftwerke bis 2038 mehr als genug Kohle in den vorhandenen Tagebauen abgebaut werden kann.

Schmitz‘ Konzernumbau ist deshalb heuchlerisch. Bis 2040 will er RWE „klimaneutral“ und zu einem weltweiten Player für erneuerbare Energien machen. Bereits 2018 hat RWE dabei mit Eon, dem zweiten großen deutschen Energiekonzern, das Terrain in Sachen Energiewende abgesteckt: Die beiden Energiealphatiere haben die Eon-Tochter Innogy unter sich aufgeteilt. Eon bekommt die Stromnetze, die wegen der Energiewende digitaler und intelligenter werden müssen, und außerdem das Geschäft mit den Endkunden, also uns. RWE übernimmt dafür komplett die Stromerzeugung aus erneuerbaren Energien von Eon und Innogy.

20170613 xl P1120777-Ostsee-Windpark-zwischen-Deutschland-und-Schweden.jpg

Kurzum, beide Konzerne kommen sich nicht in die Quere, in guter, alter Tradition: Seit der Weimarer Republik haben sich in Deutschland RWE und die Firmen, aus denen Eon im Jahr 2000 zusammenfusioniert wurden, den deutschen Strommarkt staatlich abgesegnet fein aufgeteilt. In den Nullerjahren sprachen sich die Konzerne regelmäßig ab, das Bundeskartellamt sprach damals von einem „Duopol“.

Quelle         :      TAZ        >>>>>        weiterlesen

———————————————————————

Grafikquellen        :

Oben        —        Beschreibung Bildbeschreibung: Ortseingang Kuckum. Quelle: eigenes Foto… Fotograf/Zeichner: bodoklecksel 20:31, 25. Jun 2006 (CEST) Datum: Juni 2006… Sonstiges: …

Abgelegt unter Nordrhein-Westfalen, Überregional, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Typisch Deutsche Reflexe

Erstellt von DL-Redaktion am 30. September 2019

BDS und der Nelly-Sachs-Preis

Kamila shamsie 3280373.jpg

Kommentar von Stefan Reinecke

Die BDS-Aktivistin Shamsie bekommt den Nelly-Sachs-Preis nicht. Das ist verständlich, doch israelkritische Positionen werden zu oft diskreditiert.

In Dortmund hat eine Jury der britisch-pakistanischen Autorin Kamal Shamsie erst den Nelly-Sachs-Preis verliehen, dann wieder entzogen, weil Shamsie die Israel-Boykott-Bewegung BDS unterstützt. Das wiederum hat harschen internationalen Protest provoziert. Mehr als 200 vor allem angloamerikanische AutorInnen, darunter mehrere LiteraturnobelpreisträgerInnen, bekundeten ihre Bestürzung über die Aberkennung des Preises. Eine peinliche Affäre für die Jury.

Auf den ersten Blick fügt sich der Fall Shamsie in eine Reihe von kritikwürdigen Anti-BDS-­Aktionen. Der Bundestag hat BDS in toto für antisemitisch erklärt, was Augenmaß und Differenzierung vermissen ließ. BDS besteht in Deutschland, anders als in Irland oder Schweden, nur aus ein paar Dutzend AktivistInnen und spielt politisch keine Rolle. Zudem ist BDS eine facettenreiche Bewegung, die von christlich motivierten AktivistInnen, die sich für die Rechte der Palästinenser einsetzten, über antikolonial inspirierten Widerstand bis zu fundamentalistischen Israelgegnern reicht.

BDS ist komplexer als es scheint

In Deutschland ist man aus historischen Gründen mehr als vorsichtig mit Boykottforderungen in Richtung Israel. Das ist richtig. Trotzdem ist das Bild komplexer, als es der auf die NS-Zeit fixierte deutsche Blick erfasst. So war BDS in Palästina der Versuch, nach dem Debakel der gewaltsamen Inti­fada einen zivilen, friedlichen Weg einzuschlagen.

In der deutschen BDS-Debatte kommt dies ebenso wenig vor wie die Tatsache, dass in Israel Liberale vor einer Hexenjagd gegen BDS warnen. Sie hegen wenig Sympathien für die Boykottbewegung, sind aber alarmiert, weil sie in der professionell inszenierten Anti-BDS Kampagne des Ministeriums für strategische Angelegenheiten eine rechtsautoritäre Formatierung der Öffentlichkeit und einen Angriff auf die liberale Demokratie in Israel erkennen. Die Netanjahu-Regierung bereitet völkerrechtswidrig die Annektierung eines Teils des Westjordanlandes vor – die Anti-BDS-Aktionen der Regierung sollen Kritik an der Besatzung als illegitim diffamieren.

In Deutschland kreist die Debatte indes über das Kampfwort Antisemitismus. Das ist naheliegend, aber unterkomplex. Man dürfe, heißt es großzügig, die israelische Regierung kritisieren. Doch wer das entschlossen tut, wird schnell als anti­semitisch disqualifiziert. Die deutsche BDS-Debatte ist undifferenziert und so selbstfixiert, dass noch nicht mal auffällt, wie seltsam der BDS-Beschluss des Bundestages in anderen westlichen Demokratien wirkt.

Deutsche Ängstlichkeiten

Der Fall Shamsie scheint in dieses Muster zu passen: hier deutsche Ängstlichkeit, dort Protest von literarischen Koryphäen wie Richard Ford, A. L. Kennedy, Deborah Eisenberg, Rachel Kushner, Michael Ondaatje und Teju Cole, die allesamt nicht zu den üblichen Unterzeichnern in Sachen BDS zählen. Hat die Jury also doppelt versagt – erst weil sie wenig über Shamsie wusste, dann weil die deutschen Reflexe einschnappten?

SchönebergNellySachsPark-2.jpg

Der Fall ist schwieriger. Die deutsch-jüdische Schriftstellerin Nelly Sachs, von den Nazis ins schwedische Exil getrieben, hat so intensiv wie Paul Celan den Mord an den Juden literarisch bearbeitet und der Qual des Überlebens eine Stimme gegeben. „Wir Geretteten/ Immer noch essen an uns die Würmer der Angst“ heißt es in dem Gedicht „ Chor der Geretteten“.

Israel erschien Sachs als das Land des „Urväterstaubs“. Ob sie, wie Peter Hamm mutmaßte, fürchtete, dass in Israel aus „den Verfolgten bald Verfolger werden könnten“, wissen wir nicht. Sachs war mit Politik weniger vertraut als mit existenzieller Einsamkeit. Mag sein, dass sie die Idee Israel mehr bewunderte als deren Verwirklichung.

Quelle         :          TAZ           >>>>>            weiterlesen

—————————————————————————

Grafikquellen           :

Oben       —     reading at „The Global Soul: Imagining the Cosmopolitan“

Abgelegt unter Kultur, Mensch, Nordrhein-Westfalen, Positionen | Keine Kommentare »

Fridays For Future Köln

Erstellt von DL-Redaktion am 22. September 2019

Ein globales Signal

Datei:Bundesarchiv B 422 Bild-0086, Köln, Rheinufer, Hochwasser.jpg

Quelle           :      Scharf   —  Links 

Von Jimmy Bulanik

Köln – weit über 70.000 Menschen aus allen Segmenten der Zivilgesellschaft aus natürlichen Personen, juristische Personen kamen zwecks Fridays For Future Klimastreik, Demonstration um 11 Uhr zum DGB Haus am Hans – Böckler – Platz bis zum Hohenzollernring. Mit mittels Absperrungen, Beeinträchtigungen für den Verkehr auf den Straßen von Köln. Das Mobilfunknetz in Köln war zeitweilig überlastet. Köln stellt in NRW die größte Anzahl der Teilnehmerinnen und Teilnehmer und somit einer der größten Demonstrationen in der Bundesrepublik Deutschland. In NRW haben sich über 270.000 Menschen an den Veranstaltungen beteiligt. Bundesweit handelt es um über 1,4 Millionen Demonstrantinnen und Demonstranten. Begleitet wird dies von Gewerkschaftlerinnen und Gewerkschaftler wie Verdi, DGB als auch dem Künstlerinnen und Künstler, wie beispielsweise der Band Cat Ballou welche für ihr Lied „Et jitt kei Wood“ bundesweit bekannt ist. Sehr viele anwesende Demonstrantinnen und Demonstranten werden im Bundesland NRW künftig Erstwählerinnen und Erstwähler werden. In jedem Fall leidenschaftlich politisiert und im harmonischem Einklang mit der Generation ihrer Eltern und Großeltern. Die Ziele bestehen in der so zeitnah als möglich Einleitung einer Energiewende insgesamt Sowohl persönlich (mit der Auswahl des Stromanbieter wie Greenpeace Energy eG, der persönliche Pizza Konsum) als auch gemeinschaftlich als Binnenmarkt und international.

Mittlerweile konstatieren Ökologische Strom Anbieter wie Greenpeace Energy eG das nicht allein natürliche Personen zu ihren Kundschaft zählen, als auch juristische Personen wie Büros von den Bündnis 90 / Die Grünen. Selbst eine Gesellschaft mit Bussen und Züge in grüner Farbe gehört zu solch einem Geschäftskunden.

Es werden künftig mehr Geschäftskunden werden. Das Bewusstsein bei den Menschen in der gesamten Gesellschaft besteht seit langem, wächst jedoch weiter. Dies bemerken auch Lebensmittelgeschäfte bei ihren Verkaufszahlen von fleischlosen Lebensmittel.

Die Sonne schien in Köln bei zirka 13 Grad Celsius. Die Stimmung war fröhlich und ausgelassen. Die Menschen, welche am Köln Bahnhof West der Route der Demonstration leben, zeigten aus geöffneten Fenstern mit ihrem Zuwinken und Daumen in Richtung blauen Himmel zeigend ihre Zustimmung.

Tatsache ist das die ökologischen Themen von allen demokratisch wählbaren Parteien aufgegriffen werden. Über Modalitäten des Sparens von Energie wird vielfältig gerungen.

In meinen Interviews mit den Demonstrantinnen und Demonstranten vor Ort in Köln wurde die massive Förderung eines egalitär bezahlbarer DB Bahnkarte 100 der zweiten Klasse im Jahres Abo verlangt. Somit wird der Verkehr auf den Straßen, Autobahnen gravierend entlastet. Ungeachtet der Form des Energieträgers ob fossil oder basierend auf regenerativ gewonnener Strom für Batterie oder noch besser Wasserstoff. Ziemlich verteidigend waren die (jungen) Leute zum Thema Windräder. Sie erkannten für sich das mit den modernen und effizienten Windrädern welche heute größer sind, als der Kölner Dom die Energiewende steht.

Der Internationalismus kommt bei den Fridays For Future Demonstrantinnen und Demonstranten nicht zu kurz. Sie artikulieren mitunter das es für alle Menschen nur eine Welt besteht in der wir gemeinsam leben, sich darin gegenseitig brauchen. Die Informationen über die Anzahl derer welche heute global für das Klima von ihrem verbrieften Grundrecht auf Versammlung den öffentlichen Raum friedlich und demokratisch in Anspruch nehmen motiviert die anwesenden in Köln.

Alles in allem steht eine stärkere Verbindung von Ökologie, produzierender Ökonomie mit ebensolchen Erwerbsarbeitsplätzen in der Bundesrepublik Deutschland bevor. Von der Bundesrepublik Deutschland kann ein Mondscheineffekt für andere Volkswirtschaften darstellen.

Dies zu bewerkstelligen obliegt uns allen.

 Jimmy Bulanik

 Quellen:

 https://fridaysforfuture.de

 https://www.greenpeace-energy.de

 https://www.gruene.de

 Cat Ballou – Et jitt kei Wood

 https://www.youtube.com/watch?v=VF6p-BGQcl4

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————-

Grafikquelle        :        Namensnennung: Bundesarchiv, B 422 Bild-0086 / Sers, Günter / CC-BY-SA 3.0

Abgelegt unter Köln, Nordrhein-Westfalen, Überregional, Umwelt | 1 Kommentar »

Der Kauf des Staatsfunk ?

Erstellt von DL-Redaktion am 21. September 2019

Der Klima-Podcast, der verschwand

Ende Gelände part of the Red Finger at the brim 22-06-2019 12.jpg

Von Alexander Nabert

WDR und SWR starteten im Juni einen wöchentlichen Klima-Podcast. Doch schon nach der ersten Ausgabe war Schluss. Der SWR bedauert das, der WDR spricht von einem Missverständnis. Wurde eine Chance auf kritischen Journalismus vertan?

Der Podcast „Klimazone“ startete als ambitioniertes Projekt. „Willkommen in der Klimazone, dem wöchentlichen Podcast zur Klimakrise von SWR und WDR“, begrüßen Werner Eckert vom SWR und sein WDR-Kollege Jürgen Döschner die Zuhörer der ersten Folge. Das war im Juni. Eckert und Döschner sind ansonsten vor allem im Radio zu hören und beschäftigen sich schon lange mit dem Klimawandel. Eckert berichtet seit Jahrzehnten von Umwelt- und Klimakonferenzen, Döschner ist seit 2011 offizieller „Energieexperte“ des ARD-Hörfunks, schon zuvor berichtete er im WDR über Energie. Wenn zwei Urgesteine des Klimajournalismus sich in Zeiten von Fridays for Future für einen Podcast zusammentun, ist das bemerkenswert. Vor allem wenn die Kooperation scheitert. Still und leise.

Man hatte sich vorgenommen, den Themen rund ums Klima mehr Zeit einzuräumen, heißt es in der ersten Folge. Dösch­ner referiert zu Beginn einen alten Spruch aus dem Radio: „Ob du faul bist oder fleißig: Am Ende wird’s 1:30.“ Damit spielt er darauf an, dass die meisten nachrichtlichen Beiträge im Radio sehr kurz sind. Der Podcast aber biete, so Eckert, die Chance, „tiefer eingehen zu können auf die Probleme, die momentan ganz offensichtlich ganz Deutschland bewegen“. Klima sei nach Jahren mal wieder oben auf der Tagesordnung. „Wir haben uns gedacht: Es muss mehr geben, als die Stanzen der Politiker und die Forderungen der Aktivisten“, erklärt Eckert, „da muss es irgendjemanden geben, der sich mit beidem beschäftigt und versucht, das irgendwie zusammenzubringen.“

Man könnte meinen, dass ein öffentlich-rechtlicher Klima­pod­cast in diese Zeit passt. Der Klimawandel dominiert seit Monaten die Themensetzung von Politik und Medien. Gleichzeitig erlebt das Format Podcast einen nie dagewesenen Boom. Auch die Öffentlich-Rechtlichen sind mit vielen Podcast-Projekten dabei. Knapp eine Million Mal wurde die App der ARD-Audiothek mittlerweile auf mobilen Endgeräten installiert. Martin Wagner, der Vorsitzende der ARD-Hörfunkkommission, sprach in dieser Woche von einer „Erfolgsgeschichte“. Seit dem Start der ARD-Audiothek im November 2017 wurden über 41 Millionen Mal Audios abgerufen.

Auch der wöchentlich angekündigte Podcast „Klimazone“ erschien im Juni in der ARD-Audiothek und auf der Webseite des SWR. Doch es blieb entgegen der Ankündigung bei einer Folge. Ohne eine öffentliche Mitteilung wurde der Podcast eingestellt.

Mehr noch: Während Jürgen Döschner vom WDR auf seinem Twitter-Kanal im Vorfeld ein Logo des Podcasts veröffentlichte, auf dem die Logos beider Sender vorhanden waren (siehe Abbildung in der Mitte dieser Seite), fehlte bei der Veröffentlichung des Podcasts plötzlich das Logo im WDR. Auf den Kanälen und der Webseite des WDR ist der Podcast nicht beworben worden. Geschweige denn veröffentlicht. Will der WDR plötzlich nichts mehr damit zu tun haben?

Ende Gelände Green Finger in Viersen 21-06-2019 16.jpg

Auf Anfrage teilt der WDR mit, dass der SWR die „federführende Anstalt“ und eine „dauerhafte Beteiligung des WDR über die Entwicklung hinaus“ nicht vorgesehen sei. „Diese Entscheidung liegt ausdrücklich nicht am Inhalt oder der handwerklichen Qualität des Podcasts.“ Aber woran dann? Dazu sagt der WDR in seiner Antwort nichts.

Immer wieder hat der Sender Ärger wegen Döschner, manch einer findet ihn zu kritisch. Seine Berichterstattung war bereits Thema im Innenausschuss des Landestags Nordrhein-Westfalen und im Rundfunkrat des WDR. Und in einer Facebookgruppe „RWE Mitarbeiter contra WDR“ polemisierte man heftig gegen Döschner, mehrfach twitterten leitende Angestellte von RWE gegen den Klimaexperten.

SWR widerspricht WDR

Quelle      :           TAZ          >>>>>       weiterlesen

——————————————————————-

Grafikquellen        :

Oben       —      Teil des Roten Fingers von Ende Gelände oberhalb der Abbruchkante des Tagebaus Garzweiler am 22. Juni 2019.

———————————

Untebn        —   Grüner Finger von Ende Gelände beim Losgehen in Viersen am 21. Juni 2019.

Abgelegt unter Baden-Württemberg, Nordrhein-Westfalen, Rheinland-Pfalz, Umwelt | Keine Kommentare »

Fleisch – woher der Scheiß?

Erstellt von DL-Redaktion am 18. September 2019

Das System Tönnies muss gestoppt werden

File:Technologiezentrum zur Mühlen Gruppe.JPG

Abmahnungen der Schertz-Kanzlei soll Tönnies-Kritik unterbinden

Quelle   : untergrund-blättle ch.

Von Werner Rügemer

Statt Tarifvertrag – nur Mindestlohn. Statt Leiharbeit – Werkverträge. Dieses System des europäischen Marktführers bei der Schweineschlachtung hat sich nicht nur in die Arbeitsverhältnisse eingefressen, sondern auch in die Natur. Mit Abmahnungen der Anwaltskanzlei Schertz will dieser nun seine Kritiker einschüchtern.

Wir fordern das Ende des Systems Tönnies. Denn der Konzern im Eigentum des Rassisten und Menschenverächters Clemens Tönnies und seines Familienclans ist ein System.

Das System Tönnies verletzt die Menschenrechte und die Demokratie. Dieses System des europäischen Marktführers bei der Schweineschlachtung hat sich nicht nur in die Arbeitsverhältnisse eingefressen, sondern auch in die Natur, in die Lebensgrundlage Wasser, in die Tierwelt und nicht zuletzt in die politischen Verhältnisse in Deutschland und in der Europäischen Union, auch in die Kommunen, die mit Tönnies-Standorten gesegnet beziehungsweise belastet sind.

Die zentrale Tönnies-Holding mit Sitz in Dänemark hat jetzt mit Hilfe der berüchtigten Medienkanzlei Schertz Bergmann beim Landgericht Berlin gegen «aktion gegen arbeitsunrecht» eine Einstweilige Verfügung erwirkt. Die Organisation soll unter anderem nicht mehr behaupten dürfen, dass Tönnies Lohnraub begeht. Die «aktion gegen arbeitsunrecht» ist gegen diese Verfügung in Widerspruch gegangen und wird die Gelegenheit nutzen, die Tönnies-Praktiken weiter bekannt zu machen.

Tönnies Machenschaften, Methoden und Marken sind weitgehend unbekannt

Denn obwohl Tönnies der größte Schweineschlacht-Konzern ist, sind seine Praktiken der Bevölkerung, den Einwohnern der Tönnies-Standorte und auch den meisten Käufern der Tönnies-Produkte so gut wie unbekannt. Dafür sorgen auch unsere Leitmedien, die privaten wie die öffentlich-rechtlichen, die der sogenannten Meinungsfreiheit verpflichtet sind. Sie kritisieren ein bisschen, wenn der Chef Clemens Tönnies sich als Rassist äußert und Menschen in Afrika verächtlich macht, aber diese ach so freien Medien schweigen – bis auf löbliche Ausnahmen im öffentlich-rechtlichen Rundfunk und vereinzelten investigativen Print-Reportagen – auf der nationalen Ebene zu den Arbeitsverhältnissen in den Tönnies-Betrieben und was diese sonst noch an Schweinereien in der Gesellschaft anrichten.

Sozialschädliche Arbeitsverhältnisse

Ja – der Konzern begeht Lohnraub, systematischen Lohnraub, und zwar durch die Kombination mehrerer Praktiken. Die Mehrheit der Schlachter ist nicht bei Tönnies angestellt, sondern bei Werkvertragsfirmen. Von diesen Vermittlern gibt es bei Tönnies mindestens ein Dutzend. Sie haben öffentlich so unbekannte Namen wie PTW, DSI, Best Promo, MGM, FSD, Agriserv Europa Meat ZNL, Lazar, Flash Works, Besselmann Services, Ni.Ke, FBS, Ninbog und Christian Fleisch – schon mal gehört? Clemens Tönnies und sein Geschäftsführer Josef Tillmann behaupten: Festanstellungen seien nicht möglich, denn die Bulgaren, Rumänen, Ungarn, Polen, Griechen undsoweiter wollen nur befristet arbeiten und ihr Leben in ihren Heimatländern nicht aufgeben.2 Aber: Auch für eine zeitlich befristete Anstellung von einem oder zwei Jahren kann bekanntlich ein regulärer Arbeitsvertrag abgeschlossen werden, viele solche Arbeitsverträge sind heute befristet.

Statt Tarifvertrag: nur Mindestlohn. Statt Leiharbeit: Werkverträge

Oder Tönnies könnte sich Leiharbeiter holen. Aber nein, selbst Leiharbeiter sind noch zu teuer und haben zu viele Rechte, denn immerhin nach 9 Monaten müssen Leiharbeiter mit den regulär Beschäftigten gleichgestellt werden. Nein, Tönnies lässt sich die Mehrheit der Beschäftigten als Werkvertragsarbeiter liefern. Sie bilden die Mehrheit in Rheda-Wiedenbrück, der größten Tönnies-Schlachterei, und im ostdeutschen Weißenfels, der zweitgrößten Schweineschlachterei, sind es etwa 70 Prozent.

Werkvertragler haben einen noch schlechteren Status als Leiharbeiter. Sie können auch keinen Betriebsrat wählen und können sich auch nicht selbst zur Wahl stellen. Das Kündigungsschutzgesetz gilt nicht. Der Mindestlohn gilt zwar im Prinzip, aber nicht für diejenigen, die als Selbständige beziehungsweise als Scheinselbständige arbeiten. Tarifliches Recht auf Kranken-, Urlaubs- und Weihnachtsgeld gilt nicht – Tönnies weigert sich, mit der zuständigen Gewerkschaft NGG überhaupt zu verhandeln.

Werkverträge als moderne Sklaverei

Hinzukommen weitere Praktiken. Selbst der Vorsitzende der CDU-Mittelstandsvereinigung in Paderborn, Friedhelm Koch, sieht Tönnies als „Sklavenhalter“. In zwei Branchen bestehe diese moderne Sklaverei. Damit wird die Armut in den von der EU verarmten Peripherie-Staaten ausgenutzt, nämlich in der Prostitution und in der Fleischzerlegung, sagt Koch. Diese Art moderner Sklaverei zeige sich darin, dass Tönnies den Werkvertraglern „schon einmal 200 Euro für ein Bett in einer überfüllten Wohnung abzieht“.

Die NGG Ostwestfalen kennt Wucherpreise bis 270 Euro im Vierbettzimmer.3 Der MDR berichtete über 250 Euro pro Bett in einem 7-Bett-Zimmer.4 Dass es sich um ein Element von Lohnraub handelt, wird auch daraus deutlich, dass osteuropäische Vorarbeiter, die zudem viel besser bezahlt werden, von Tönnies eine viel bessere Wohnmöglichkeit bekommen, und die ist außerdem kostenlos.5

Ein weiteres Element, auf dem der Lohnraub beruht, sind die Gebühren, die die Fleichzerleger schon in der Heimat ihren Werkvertragsfirmen bezahlen müssen. Sie müssen dieses teure Eintrittsticket kaufen, um überhaupt zu Tönnies zugelassen zu werden.6 Wenn sie ganz normale Arbeitnehmer wären, bräuchten sie dieses Eintrittsticket gar nicht. Also auch hier: ein Element des Lohnraubs.

Tönnies nutzt Armut und Abhängigkeit aus und führt ein Angstregime. Kaum ein Werkvertragler spricht öffentlich über das Arbeitsunrecht. Nur ganz ganz wenige haben sich einmal für ihre Rechte vor Gericht getraut. Und dann blockiert das Tönnies-System feige ein Urteil, scheut den Rechtsstaat.

Zum Beispiel haben zwei Werkvertragler auf Nachzahlung der täglichen Rüst- und Wegezeiten geklagt. Sie mussten als Angestellte der Werkvertragsfirma Besselmann Services eine halbe Stunde vor dem eigentlichen Arbeitsbeginn im Tönnies-Betrieb sein und sich mit der Schutzkleidung ausrüsten und dann zum Arbeitsplatz gehen. Diese Zeit wurde nicht bezahlt, obwohl das zur Arbeitszeit zählt. Das Gericht ordnete an, dass ein Gutachter in den Betrieb geht. Doch Tönnies verweigerte ihm den Zutritt. Zum Gerichtsverfahren erschien das Werkvertragsunternehmen nicht. Das Gericht erließ deshalb ein Versäumnisurteil, Besselmann zahlte sofort in aller Stille für die täglichen 26 Minuten nach: Damit wurde aber ein Grundsatzurteil verhindert. So berichtet der DGB Rechtsschutz.7

Die DGB-Beratungsstelle „Faire Mobilität“ berät Wanderarbeiter aus Osteuropa, auch viele, die an diversen Standorten von Tönnies arbeiten. Der mit den Werkvertragsfirmen vereinbarte Mindestlohn wird vielfach unterlaufen: Überstunden werden nicht dokumentiert und nicht bezahlt, ebenso Umkleide- und Wegezeiten. Die meisten Arbeiter nehmen ihre Rechte nicht wahr, aus Angst, den ohnehin befristeten Job zu verlieren, so berichtet der Mitarbeiter der Beratungsstelle Szabolcs Sepsi.

So führt Tönnies ein Angstregime. Was ist hier mit der ansonsten so gelobten Meinungsfreiheit? Meinungsfreiheit für Rassisten wie Tönnies – aber keine Meinungsfreiheit für hart arbeitende Menschen? Tönnies verletzt Menschenrechte, tausendfach, dauerhaft.8

Wie wurde Deutschland zum Niedriglohnparadies?

Die Bundesregierungen mit den Regierungsparteien CDU, CSU, SPD und Grünen sind verantwortlich für die Niedriglohnwüste Deutschland. Und dafür, dass Unternehmer, die Gesetze verletzen, nicht bestraft werden. Deshalb haben Schlachtereien aus anderen EU-Staaten wie Dänemark und den Niederlanden Schlachtereien nach Deutschland verlegt. So wurde der führende Niedriglohnstaat Deutschland zum führenden Schlachtzentrum Europas und Tönnies dessen Marktführer.

Auch die Europäische Union hat zu diesem Arbeitsunrecht beigetragen. Auch der Marktführer Tönnies hat möglichst lange den Werkvertragsarbeitern die üblichen Sozialabgaben vorenthalten. Das war möglich, solange es noch Sonderregelungen für osteuropäischen EU-Beitrittsstaaten gab. Da waren die Werkvertragler bei ihren Vermittlern in Bulgarien und Rumänien angestellt und da galt nicht einmal das niedrige Arbeitsrecht in Deutschland.

Die Lüge vom Fachkräftemangel

Chef Tönnies behauptete: „Wir sind auf Werkvertragsunternehmen angewiesen. Sonst würden wir nicht die Mitarbeiter in Menge und Qualifikation finden, die wir brauchen.“9 Natürlich ist das eine Lüge. Natürlich würden die Arbeiter aus Rumänien, Bulgarien, Polen, Ungarn und Griechenland auch kommen, wenn sie regulär angestellt würden. Da würden sie sogar noch viel lieber kommen, sie würden mehr verdienen und sie würden mehr Rechte haben. So strickt Tönnies auch mit an der Lüge des Fachkräftemangels.

Klärschlamm-Wahnsinn: Nitrat ins Trinkwasser, Methangas in die Luft

Die Tönnies-Schlachterei in Rheda-Wiedenbrück leitet von den täglich etwa 30.000 geschlachteten Schweinen täglich tonnenweise Schlachtabfälle in das Abwasser-Klärwerk der Stadt Rheda-Wiedenbrück ein. Daraus entsteht Klärschlamm. Tönnies verursacht davon täglich 480 Kubikmeter. Das sind 70 Prozent des Klärschlamms der Stadt, während alle weiteren Betriebe in der Stadt und alle Einwohner zusammen nur 30 Prozent des Klärschlamms verursachen.

Bevor der schadstoffhaltige Klärschlamm täglich durch zwei Sattelzüge mit jeweils 22 Tonnen abtransportiert wird, muss er im Faulturm zwischengelagert werden. Der hat ein Fassungsvermögen von 11.500 Kubikmetern. Dabei entsteht das ozonschädliche Methangas. Hallo Umweltfreundinnen und Umweltfreunde: Methangas aus den Klärschlämmen! Schon gehört?

Der Klärschlamm wurde und wird nach „Ostdeutschland“ entsorgt, Ihr wisst schon: Dorthin wo man aus dem sauberen Westen und der sauberen Stadt Rheda-Wiedenbrück und aus der sauberen Tönnies-Schlachterei allen Schmutz wegschaffen kann. „Ausnahmeregelung zur Düngung von Zwischenfruchtflächen in Ostdeutschland“ heißt das im offiziellen deutschen Beschönigungs-Unrechts-Sprech.

Die Tönnies RWE-Braunkohle-Connection

Ein größerer Teil des Klärschlamms wird allerdings tief in den Westen weggeschafft. Er wird nämlich in Kohlekraftwerken mitverbrannt. Und die gehören wem? Richtig, die gehören dem Umweltvergifter RWE. Und der Klärschlamm aus Weißenfels wird ins Braunkohlekraftwerk Lippendorf in der Lausitz verbrannt. Bei der Verbrennung gelangen Schadstoffe auch in die Luft. Schadstoffe, die im Filter aufgefangen werden, werden in stillgelegte Bergwerke weggeschafft und können das Grundwasser verseuchen. Hallo Umweltfreunde: Schon mal gehört? Tönnies gehört also, bisher ungenannt, zur Braunkohle-Verbrennungs-Umwelt-Zerstörungs-Connection.

Tönnies schlachtet immer mehr, auch wenn das schon überlastete Klärwerk von Rheda-Wiedenbrück gar nicht auf die Verarbeitung der immer mehr Schlachtabfälle eingerichtet ist. Deshalb muss die Stadt auf ihre Kosten seit 2018 einen zusätzliche Lagerplatz bauen. Schon mal 320.000 Euro für den ersten Bauabschnitt. Da liegt also der Klärschlamm herum. Methangas tritt aus. Die Düngemittel- und Klärschlamm-Verordnung wird verletzt. Der überschuldete Stadthaushalt wird durch Tönnies noch weiter überschuldet.

Geschundene Flüsse: Ems und Saale

Die Abwässer aus dem Klärwerk von Rheda-Wiedenbrück werden in den Fluss Ems eingeleitet. Die Ems gehört zu den besonders mit Schadstoffen belasteten Flüssen in Deutschland. Aber haben die sogenannten Aufsichtsbehörden aussagekräftige Messungen über multiresistente Keime in der Ems vorgenommen, hinter der Einleitungsstelle des Klärwerks Rheda-Wiedenbrück im Vergleich zur Belastung vor der Einleitungsstelle? Nein, solche Messungen gibt es nicht.

Die Behörden sperren wie die drei Affen Nase und Mund und Ohren zu. Rechtsstaat mit Tönnies?

Im ausgebeuteten Ostdeutschland kann Tönnies sich noch viel mehr erlauben. Von 2006 bis 2011 hat seine Schlachterei in Weißenfels seine Abwässer in die Saale geleitet, illegal, durch einen Bypass im städtischen Klärwerk. Dafür hat Tönnies, erst gezwungen nach einem langen Gerichtsverfahren, 1,5 Millionen Euro Buße gezahlt. Methode Tönnies: Gesetze brechen, wenn keiner aufpasst. Damit Gewinne machen. Notfalls nachher ein Bußgeld aus der Portokasse

Übrigens, wenn wir schon mal dabei sind: vernutzt auch das wertvolle Grundwasser. Tönnies zapft in Weißenfels das Grundwasser an. Zusätzlicher Vorteil: Tönnies braucht dafür nicht das Wasser aus den Stadtwerken zu bezahlen.

Nichts sehen, nichts hören, nichts riechen – und schon gar nicht drüber reden

Wir haben den stellvertretenden Leiter des Klärwerks von Rheda-Wiedenbrück, Rainer Bollmers angefragt:

  • Wieviel Kubikmeter Abwasser leitete Tönnies in den Jahren 2016, 2017 und 2018 in die Kläranlage ein?
  • In welche der vier Schadstoff-Belastungsstufen wurde das Tönnies- Abwasser entsprechend der Abwassersatzung der Stadt eingestuft?
  • Welchen Verschmutzungszuschlag zahlt Tönnies entsprechend dieser Einstufung?
  • Wurden überhaupt Messungen in der Zuleitung aus dem Schlachtbetrieb in die Kläranlage vorgenommen?
  • Wie hoch ist die Emission des ozonschädlichen Methangases aus dem Faulturm und vom Lagerplatz?
  • Wieviele Tonnen Klärschlamm wurden in den Jahren 2016, 2017 und 2018 in RWE-Kraftwerken verbrannt?
  • Die Verbrennung einer Tonne Klärschlamm kostet die Stadt 150 Euro – wieviel davon zahlt Tönnies?

Weder Herr Bollmers noch jemand anders aus der Stadtverwaltung hat geantwortet. Es herrscht das Gesetz des Schweigens.

Toennies Fleisch.jpg

Wir haben dieselben Fragen auch an Tönnies gerichtet. Tönnies hat ja zur Beantwortung von Fragen eine eigene „Kommunikations“abteilung. Chef ist Herr Dr. André Vielstädte. Er hat schon viel zur schönen Sauberkeit der Arbeitsverhältnisse und auch des Wassers bei Tönnies an die Medien kommuniziert. Aber zu unseren Fragen schweigt verbissen auch dieser ansonsten vielschwätzende Kommunikationsstratege.

Komplizen: Landkreis Gütersloh und Regierungspräsident Herford

Tönnies als größter Schlachtbetrieb Europas beruht auf der Schweinemast in zahlreichen Mastbetrieben. Dort wird Gülle in die Umwelt eingeleitet, in den Boden als Dünger, ebenfalls in die dortigen Kläranlagen, in die Flüsse, in das Grundwasser. Ebenfalls versenkt Tönnies Klärschlämme als Zwischennutzung in Ostdeutschland. Aber die Komplizenschaft der Behörden auf kommunaler Ebene setzt sich beim Landkreis Gütersloh und beim Regierungspräsidenten in Herford fort. Dasselbe in Weißenfels im ostdeutschen Sachsen-Anhalt.

Immerhin: EU kritisiert verseuchtes Grundwasser

Bekanntlich stellt die Europäische Kommission, die gewiss sehr nachsichtig ist, besonders mit dem mächtigen Deutschland und seiner christlich-nachsichtigen Bundeskanzlerin, immer wieder fest: Die Bundesrepublik verletzt nachhaltig die Gülle-Verordnung. Das hat auch der Europäische Gerichtshof festgestellt. „Deutsches Grundwasser gehört zum schlechtesten in der EU“, erklärt die Kommission. In einigen Regionen wird der zulässige Grenzwert um das vier- bis sechsfache überschritten. Vom Grundwasser gelangt das krebserregende Nitrat ins Trinkwasser. Die Bundesregierungen erlauben die dauerhafte Verletzung des Gesetzes, gefährden die Bevölkerung, insbesondere Kleinkinder und Schwangere.

Zur Belohnung gibt’s EU-Subventionen obendrauf

Dabei hat die Europäische Union zum Aufstieg von Tönnies selbst beigetragen: acht Schlachtereien in Deutschland, weitere Standorte inzwischen in Dänemark, Polen, Frankreich und Großbritannien, Exporte in 80 Staaten. Das hat die EU nicht nur durch die Förderung der Niedriglöhne in den armen Mitgliedsstaaten und durch die Freizügigkeit für Werkvertragsfirmen bewirkt. Die EU hat Tönnies auch mit Agrarsubventionen beschenkt. So erhielt Tönnies im Jahre 2008 2,67 Millionen Euro aus dem Europäischen Garantiefonds für die Landwirtschaft.10

Kartellamt durch Bauerntrick getäuscht

2014 verhängte das Bundeskartellamt gegen 21 Wursthersteller wegen illegaler Preisabsprachen Bußgelder von insgesamt 338 Millionen Euro. Der Löwenanteil von 128 Millionen Euro entfiel auf Haupttäter Tönnies. Doch Tönnies trickste und löste die betroffenen Tochterfirmen Böklunder, Plumrose und Könecke schnell auf. Das Kartellamt resignierte. Tönnies brauchte nicht zu zahlen.11

Was können wir tun?

Das System Tönnies schadet den Beschäftigten und ihren Menschenrechten, dem Wasser, den Böden, den Tieren, den Bürgern in den betroffenen Kommunen, dem Rechtsstaat, der Demokratie.

Wir fordern deshalb:

  • Das System Tönnies endlich stoppen!
  • Reguläre Arbeitsverträge und Meinungsfreiheit für die Werkvertragsarbeiter!
  • Menschenwürdige Unterbringung!
  • Glasklare Messungen der Abwässer aus den Tönnies-Schlachtereien!
  • Keine Verbrennung der Klärschlämme in den RWE-Kohlekraftwerken!
  • Einwohner von Rheda-Wiedenbrück, Weißenfels, Kempten und so weiter: Klopft Euren Stadtverwaltungen auf die Finger!

Und was können wir noch tun? Böklunder, Gutfried & ALDI-Fleisch meiden

Kaufen wir Tönnies nichts mehr ab! Seine Marken Böklunder – für Schweine und Rindfleisch – und Gutfried – für Geflügel – liefert er an alle Supermärkte, für ALDI beliefert Tönnies die Hausmarken Tillmann’s, Sölde, Rolffes, Landbeck.

Hallo Fans von Schalke 04 und VfB Stuttgart: Sorgt dafür, dass Tönnies Böklunder Dumping-Wurst aus euren Fußballstadien verschwindet! Dann macht Fußball erst richtig Spaß!

Fussnoten:

1 Werner Rügemer ist der Vorsitzende des Vereins aktion ./. arbeitsunrecht – Initiative für Demokratie in Wirtschaft & Betrieb. Er hält die Rede am 13. September 2019 in Rheda-Wiedenbrück. Die Rede mag vervielfältigt und bei Aktionen genutzt und – auch auszugsweise – verlesen werden.

2 Kreis Gütersloh, Der Landrat: Protokoll des Erörterungstermins am 12.7.2017, S.10

3 CDU-Mittelstandspolitiker: Tönnies macht Profit mit „Sklaverei“, WDR-Lokalzeit 16.8.2019; https://nw.de/nachrichten/wirtschaft/22536149_CDU-Mittelstandspolitiker-Toennies-macht-Profite-mit-Sklaverei.html

4 Viel Arbeit, wenig Lohn, mdr/Heute im Osten 27.11.2017, https://www.mdr.de/heute-im-osten/fleischindustrie-arbeitnehmer-osteuropa-ausbeutung-100.html

5 Was Tönnies‘ Angestellte zu ihren Arbeitsbedingungen sagen, Der Westen, 30.8.2013, https://www.derwesten.de/wirtschaft/was-toennies-angestellte-zu-ihren-arbeitsbedingungen-sagen-id8376590.html

6 Siehe Fußnote 2

7 Kein Grundsatzurteil über Umkleide- und Wegezeiten, 28.6.2017, https://www.dgbrechtsschutz.de/recht/arbeitsrecht/arbeitszeit/kein-grundsatzurteil-ueber-umkleide-und-wegezeiten/

8 Siehe Fußnote 3

9 Siehe Fußnote 3

10 Hintergrund, 27.8.2013

11 Wurstkartell: Kartellamt gibt auf, Tönnies ist aus dem Schneider, https://www.juve.de/nachrichten/verfahren/2016/10/wurstkartell-kartellamt-gibt-auf-toennies-ist-aus-dem-schneider, 19.10.2016

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

———————————————————————-

Grafikquellen         :

Oben     —      Technologiezentrum zur Mühlen Gruppe

 Zu Tönnies-Wurstimperium gehört auch die Fleischwarenfabrik Böklunder. / zur Mühlen-Gruppe – zur Mühlen ApS & Co. KG (CC BY-SA 3.0)

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: zur Mühlen-Gruppe – zur Mühlen ApS & Co. KG

———————–

Unten      —     Rheda-Wiedenbrück, Tönnies Fleischwerk im Stadtteil Rheda. Aufgenommen am 14. Januar 2006 von Daidalus.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled GNU Free Documentation License.http://www.gnu.org/copyleft/fdl.htmlGFDLGNU Free Documentation Licensetruetrue

Abgelegt unter Nordrhein-Westfalen, Schicksale, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Der Antisoziale Patriotismus:

Erstellt von DL-Redaktion am 16. September 2019

Die Rentenpläne der AfD

Maischberger - 2018-01-24-1895.jpg

Von Christoph Butterwegge

Vor den anstehenden Landtagswahlen in Brandenburg, Sachsen und Thüringen im September beziehungsweise Oktober inszeniert sich die ostdeutsche AfD als Fürsprecherin der Benachteiligten – und all jener, die sich benachteiligt fühlen. Allerdings zeigt sich die vermeintliche „Kümmererpartei“ gerade hinsichtlich ihres Rentenkonzepts nicht nur zutiefst gespalten, sondern auch hochgradig unsozial. Dort, wo vielen Menschen aufgrund längerer Arbeitslosigkeit und/oder schlecht bezahlter (Leih-)Arbeit künftig Altersarmut droht, plädiert der völkisch-nationalistische und in weiten Teilen rechtsextreme Parteiflügel um Björn Höcke, dem Landes- und Fraktionsvorsitzenden der thüringischen AfD, für einen „solidarischen Patriotismus“, der all jenen zugutekommen soll, die eine deutsche Staatsbürgerschaft besitzen. Dagegen setzt der national- bzw. wirtschaftsliberale Flügel um Bundessprecher Jörg Meuthen und die Bundestagsfraktionsvorsitzende Alice Weidel weniger auf staatliche Interventionen als auf den (Finanz-)Markt, das Prinzip Eigenverantwortung und individuelle Selbstvorsorge.

Obwohl die Richtungsgruppierungen innerhalb der AfD in vielen Politikbereichen konträre Positionen vertreten, gelang es ihnen bisher fast immer, zugunsten einer möglichst breiten Akzeptanz in der Wählerschaft für alle Strömungen tragbare Kompromisse zu schließen. Dabei bildet die „Massenmigration“ von Flüchtlingen das Schlüsselthema, mit dem die Partei alle übrigen Themenkomplexe zu verbinden und die konträren Lager zu einen versucht.[1] Dies gilt auch für das Problem der Altersarmut, obwohl es mit der Fluchtthematik nichts zu tun hat: Erstens erhalten Flüchtlinge (noch) keine Rente. Und zweitens hat der Bundestag bereits lange vor dem „Sommer der Migration“ im Jahr 2015 beschlossen, dass das Sicherungsniveau der Renten von damals 53 auf bis zu 43 Prozent vor Steuern im Jahr 2030 sinken kann, ohne dass der Staat eingreift.

Auch sechseinhalb Jahre nach ihrer Gründung hat die AfD immer noch kein Rentenkonzept verabschiedet. Die Vielzahl unausgegorener Papiere der verschiedenen Parteigruppierungen sollte eigentlich im September dieses Jahres auf einem Sonderparteitag zur Sozialpolitik in einen Beschluss münden. Doch da die AfD in der Rentenpolitik nach wie vor heillos zerstritten ist, verschob ihr Bundesvorstand den Parteitag kurzerhand auf das kommende Jahr. Bis dahin kann jede Strömung ihr eigenes Konzept als mehrheitsfähig präsentieren – und damit auf Wählerfang gehen.

Eigentum als Alterssicherung

Die Werbetrommel wird bereits seit längerem kräftig gerührt. Im Mai 2018 stellte Uwe Witt, nordrhein-westfälischer AfD-Bundestagsabgeordneter und Vorsitzender der „Alternativen Vereinigung der Arbeitnehmer“ (AVA) dieser Partei, zusammen mit dem Oberurseler Stadtverordneten Peter Lutz ein Diskussionspapier mit dem Titel „Alterssicherungskonzept für die Bürgerinnen und Bürger Deutschlands“ vor. Ausgehend von der These, dass die Rentenversicherungsbeiträge zu hoch, die Renten zu niedrig und die Zukunftsaussichten katastrophal seien, nahmen sie das jahrzehntelange Hinausschieben „notwendiger Anpassungsmaßnahmen“ ins Visier.[2] Gemeint waren damit offenbar Rentenkürzungen, denn Witt und Lutz lehnen Beitragserhöhungen ebenso ab wie höhere Steuerzuschüsse. Was sie als „Flexibilisierung durch Lebensarbeitszeit“ bezeichnen, läuft auf eine Verlängerung der Lebensarbeitszeit und eine Anhebung des durchschnittlichen Renteneintrittsalters hinaus: „Wir müssen uns […] in Zukunft von einem fixen Renteneintrittsalter entfernen und allein die geleistete ‚Lebensarbeitszeit‘ zum Maßstab des Renteneintritts nehmen. Wer mit 15 Jahren anfängt zu arbeiten und Rentenbeiträge zu zahlen, sollte auch mit 60 Jahren abschlagsfrei in Rente gehen dürfen. Wer sich hingegen mit seiner Ausbildung viel Zeit lässt, muss dann auch die Konsequenz ziehen und erst später in die Rente eintreten.“[3] Abgesehen davon, dass schon heute kaum noch jemand die 45 Beitragsjahre des „Standardrentners“ erreicht, hieße dies, dass für Akademiker*innen mit entsprechend langen Ausbildungszeiten die Rente mit 70 oder 75 Jahren zur Regel würde.

Neben einer Verlängerung der Lebensarbeitszeit soll die Einnahmebasis der Rentenversicherung um Beamte und Selbstständige erweitert und das „Lohnabstandsgebot“[4] beachtet werden. Darüber hinaus fordern Witt und Lutz einen „On Top Zuschuss“ zur Rentenbeitragszahlung der Niedriglohnempfänger*innen von bis zu 40 Prozent.[5] Weiter setzt die AVA auf ein Drei-Säulen-Modell – bestehend aus staatlicher, betrieblicher und privater Vorsorge –, bei dem sich die Unterstützung der betrieblichen und der privaten Altersvorsorge „an Effizienzkriterien zu orientieren“ habe: „Insbesondere in der dritten Säule, der privaten Vorsorge, wollen wir neue Wege gehen. Denn wir fordern hier eine deutlich höhere staatliche Förderung bei der Schaffung von selbstgenutztem Wohneigentum für jeden Erwerbstätigen wie auch die staatliche Unterstützung bei der Bildung von Unternehmenseigentum in Arbeitnehmerhand.“[6] Staatlich subventioniertes Eigentum soll also an die Stelle von Sozialleistungen treten – ohne ihn zu nennen, greift die AVA dabei die Idee des „Volkskapitalismus“ von Ludwig Erhard auf, während ansonsten wenig originelle Ideen entwickelt wurden.

Völkische Sonderregelungen

Ebenfalls bereits im Mai des letzten Jahres veröffentlichte Markus Frohnmaier ein „Impulspapier“ zu Rentenpolitik. Er ist langjähriger Bundesvorsitzender der Jungen Alternative, verfügt über gute Kontakte in die rechtsextreme Szene und ist heute AfD-Bundestagsabgeordneter. Frohnmaier spricht sich für einen „Volkskapitalismus“ im Sinne einer „Volksrente“ nach Schweizer Vorbild aus. Das bisherige Umlageverfahren soll zwar nicht abgeschafft, sein Schwerpunkt aber zu einem „kapitalgedeckten“ – in Wirklichkeit: zu einem finanzmarktabhängigen – Rentensystem verschoben werden.

Die geplante „Volksrente“ verfügt über drei Bestandteile: erstens eine „Grundrente“ für „alle Menschen mit deutscher Staatsangehörigkeit weltweit“, die sie durch Pflichtbeiträge finanzieren, sofern ihr Jahreseinkommen mindestens 15 000 Euro beträgt; zweitens eine „Lebensrente“ als „kapitalgedeckte private Teilzwangsversicherung“, welche die Lebensleistung widerspiegeln und im Idealfall den Löwenanteil der Ausgaben eines Ruheständlers decken soll; drittens eine „rein private und freiwillige Zusatzrente“, durch die sich der Lebensstandard im Alter dem Lebensstandard im Arbeitsleben noch stärker angleichen soll.[7]

Beiträge zur Grundrente wären an die Höhe des Einkommens, aber auch an die Zahl der Kinder gekoppelt (pro Kind würden sie halbiert).[8] Nichtdeutsche hätten jedoch stets den vollen Grundrentenbeitrag zu entrichten und erhielten auf ihr „Lebensrentenkonto“ im Unterschied zu deutschen Staatsbürger*innen auch keinen staatlichen Zuschuss.

File:2017-04-23 AfD Bundesparteitag in Köln -68.jpg

Zwei Ärsche ohne Kopf – ergeben keinen Zopf

Ganz im Sinne einer völkischen Ideologie werden Deutsche privilegiert und wird die traditionelle Familie hochgehalten: „Eine deutlich bessere Absicherung im Alter als jedes Rentensystem [sind] nach wie vor die eigenen Kinder“, so Frohnmaier; mit ihnen könne „auf eine höhere Lebensrente im Zweifel einfacher verzichtet werden“.[9] Frohnmaier gehört folglich zu den Verächtern, nicht zu den Verteidigern des modernen Sozialstaates, glaubt er doch, man könne die Altersvorsorge im 21. Jahrhundert wie in einer altertümlichen Gesellschaft organisieren, in der Kinder den Reichtum ihrer Eltern darstellten und diese im Alter mit „durchfütterten“. Statt jedoch die Konsequenz aus seiner absurden Vorstellung zu ziehen und den Eltern mehrerer Kinder, die sie im Alter versorgen könnten, eine staatliche Rente vorzuenthalten, macht Frohnmaier das Gegenteil und möchte sie gegenüber Kinderlosen privilegieren.

Nichtdeutsche dürfen derzeit nicht gegenüber Deutschen diskriminiert werden, denn das Sozialversicherungssystem finanziert sich durch verfassungsrechtlich nach Art. 14 Abs. 1 GG als Eigentum geschützte Beiträge von Arbeitnehmer*innen und Arbeitgebern. Wer also gewisse Rentenbestandteile deutschen Ruheständler*innen vorbehalten will, verstößt gegen die Verfassung – weshalb Frohnmaier auch eine Grundgesetzänderung anstrebt. Zugleich will die AfD, wie in ihrem Bundestagswahlprogramm angekündigt, zum Blutrecht zurückkehren und sowohl Mehrfachstaatsangehörigkeiten als auch Einbürgerungen nach dem seit knapp zwanzig Jahren geltenden Territorialprinzip wieder abschaffen.[10] Hier lebende Nichtdeutsche hätten dann keine Möglichkeit mehr, die deutsche Staatsbürgerschaft und damit volle Rechte als Rentenbezieher*innen zu erhalten.

»Staatsbürgerrente« für deutsche Geringverdiener

Quelle           :         Blätter         >>>>>          weiterlesen

—————————————————————————

Grafikquellen       :

Oben     —         MAISCHBERGER am 24. Januar 2018 in Köln. Produziert vom WDR. Thema der Sendung: Ganz unten: Wie schnell wird man obdachlos? Foto: Christoph Butterwegge (Armutsforscher)

Abgelegt unter Köln, P.AfD, Rentenpolitik, Sozialpolitik | Keine Kommentare »

Tönnies stoppen –

Erstellt von DL-Redaktion am 9. September 2019

Bundesweite Proteste und zentrale Kundgebung in Rheda

Quelle       :    Scharf  —  Links

Von Aktion gegen Arbeitsunrecht und Bündnis gegen die Tönnies-Erweiterung

Einladung zum Aktionstag

Am Freitag, dem 13. September 2019 findet eine Demonstration zur Konzernzentrale der Schlachtfabrik Tönnies in Rheda-Wiedenbrück statt. Treffpunkt ist um 15 Uhr auf dem Bahnhofsplatz in Rheda-Wiedenbrück. Der Protest ist Teil des von der Aktion gegen Arbeitsunrecht und dem Bündnis gegen die Tönnies-Erweiterung organisierten bundesweiten Aktionstages „Freitag, der 13.“. Von Kiel bis Kempten, von Düren bis Berlin, in über 20 Städten sind bereits Aktionen angemeldet, um auf die Machenschaften des Konzerns aufmerksam zu machen. Der Fleischkonzern reagierte mit einer einstweiligen Verfügung und erwirkte mit Hilfe der Kanzlei Schertz Bergmann auf fragwürdige Weise die Schwärzung mehrerer Passagen auf der Homepage der Aktion gegen Arbeitsunrecht.

Mit dem Aktionstag „Freitag, der 13. – Das System Tönnies stoppen“ gewinnt der Widerstand gegen die Ausbeutung von Mensch, Tier und Natur eine neue Qualität. Die Demonstration in Rheda-Wiedenbrück wird vom Bündnis gegen die Tönnies-Erweiterung und der Aktion gegen Arbeitsunrecht veranstaltet und organisiert. Bündnispartner und Unterstützer sind u.a. Attac Gütersloh, der BUND-OWL, Fairleben e.V., Venga e.V., Safe Movement Bielefeld, die LAG Tierschutz DIE LINKE.NRW, ARIWA OWL, IG WerkFAIRträge, die Linksjugend [’solid] Kreis Gütersloh und DIE LINKE Kreisverband Gütersloh Die Fridays for Future Gruppen in OWL wurden von dem Bündnis zur Teilnahme an der Veranstaltung eingeladen und haben bereits zugesagt. Anderswo organisieren die Greenpeace-Jugend, zahlreiche Tierrechts-Organisatoren und viele andere den Protest.

Die Breite des Widerstandes zeigt sich auch an den Rednerinnen und Rednern, die nach Rheda kommen werden. Der Journalist und Publizist Dr. Werner Rügemer spricht für die Aktion gegen Arbeitsunrecht. Die Tierrechtsaktivistin Dr. Bettina Rehberg vertritt ARIWA OWL. Der Student und Fridays for Future-Aktivist Ercan Korkmaz wird den Klimaschutz zum Thema machen. Ebenfalls als Rednerin wird die Bundestagsabgeordnete Amira Mohamed Ali auftreten. Die Juristin Amira Mohamed Ali aus Oldenburg vertritt die Partei DIE LINKE. im Bundestag in den Ausschüssen Recht und Verbraucherschutz sowie Ernährung und Landwirtschaft.

Der Protest richtet sich gegen ein System, das auf die skrupellose Ausbeutung von Menschen, das grausame Quälen von Tieren und die Zerstörung der Natur setzt. Die industrielle Fleischproduktion gehört zu den Hauptverursachern der Klimakatastrophe. Das verbindet den Aktionstag am 13. September mit der eine Woche später beginnenden globalen Klimastreikwoche. Eine Übersicht der bundesweit stattfindenden Aktionen gegen Tönnies am 13. September findet sich hier:

https://aktion.arbeitsunrecht.de/fr13toennies

Von den juristischen Drohungen durch die von Tönnies beauftragten Anwälte werden sich die Organisatoren nicht einschüchtern lassen. Sollte es zu einem Prozess kommen, könnte dieser zu einem Tribunal gegen Tönnies und die Praktiken der Kanzlei Schertz Bergmann werden.

Weitere Infos:

https://buendnis-gegen-die-toennies-erweiterung.de/

https://fridaysforfuture.de/Save-the-date/

Twitter-Hashtag: #Fr13Toennies

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————

Grafikquelle      :           Bild: Aktion Arbeitsunrecht   –      Schatf – Links

Abgelegt unter Arbeitspolitik, Gewerkschaften, Nordrhein-Westfalen, Regierung | Keine Kommentare »

Anlass zur Unruhe

Erstellt von DL-Redaktion am 7. September 2019

AfD gewinnt, LINKE verliert deutlich

Quelle     :          AKL   

Von Claus Ludwig

Dass die AfD in keinem Bundesland zur stärksten Partei geworden ist, ist kein Grund zur Entwarnung. Die Landtagswahlen vom 1. September markieren eine Stabilisierung der offen rechtsextrem auftretenden AfD auf hohem Niveau und bestätigen deren Ergebnisse der Bundestags- und Europawahlen.

Die gestiegene Wahlbeteiligung basiert teilweise darauf, dass es eine Anti-AfD-Mobilisierung in letzter Minute gab, die überwiegend den jeweiligen Parteien des Ministerpräsidenten – CDU in Sachsen, SPD in Brandenburg – nutzte. Die Parteien der Berliner Koalition sind Wahlverlierer, doch mit dem blauen Auge davongekommen, weil es keine sichtbare Alternative zu ihrer Regierung gab.
Trotz des beschämenden Wahlergebnisses der SPD in Sachsen wird diese dort zum Regieren dringlicher gebraucht als je zuvor. Ihr Absturz beschleunigt nicht das Ende der sogenannten GroKo, sondern stabilisiert diese zunächst.
Aufgrund der gestiegenen Wahlbeteiligung legen AfD, Grüne, FDP in beiden Ländern bei den absoluten Stimmen zu, ebenso die CDU in Sachsen und die SPD in Brandenburg. Die LINKE hingegen wird in beiden Ländern prozentual fast halbiert, verliert in Brandenburg fast 48.000 (CDU: 30.000) und in Sachsen 85.000 (SPD: 38.000) Stimmen.
Die schwelende Krise der Partei, mit Schwächen bei mehreren Landtagswahlen, einem mittelmäßigen Ergebnis bei der Bundestagswahl 2017 und dem schwachen Abschneiden bei der Europawahl hat damit einen akuten Zustand erreicht.

Profillose LINKE verliert

Dafür gibt es nicht nur einen Grund. Der erste und wichtigste Schritt raus aus dem Tief der LINKEN wäre, nicht mehr so viel falsch zu machen, selbst wenn man noch nicht so genau wüsste, was danach käme. Brandenburg ist ein Paradebeispiel für die verheerende Wirkung der Regierungsbeteiligung.
Die Brandenburger LINKE hat dem repressiven Polizeigesetz zugestimmt. Sie hat entgegen dem bundesweiten Programm die Ausdehnung des Braunkohle-Abbaus mitgetragen. Sie hat Kürzungsmaßnahmen im öffentlichen Dienst beschlossen und keinen Ansatz geboten, die Probleme von Provinzflucht, schlechter Versorgung und geringer Mobilität anzugehen. 70% äußerten in einer Umfrage, die LINKE hätte „in der Landesregierung nichts durchgesetzt, was mir besonders aufgefallen wäre“. [1]

Das ist in Sachsen nicht grundlegend anders. Hier erbringt DIE LINKE den Beweis, dass man auch als Oppositionskraft eine staatstragende Haltung an den Tag legen kann.
Während diese Tatsachen für jede*n klar erkennbar sind, gehen Teile der Partei- und Fraktionsführung, vor allem die Vorsitzende Katja Kipping und der Fraktionsvorsitzende Dietmar Bartsch in die Offensive, um die Bereitschaft für das Mitregieren in Ländern und im Bund zu erhöhen. Angesichts des grünen Höhenflugs ist R2G rechnerisch wieder wahrscheinlicher geworden. Doch politisch ändert dies nichts.

Eine Zusammenarbeit mit dieser SPD und diesen Grünen ist nur um den Preis der politischen Selbstaufgabe der LINKEN zu haben. Im Osten hat die Partei ihre Funktion als soziale Protestpartei bereits weitgehend verloren, sie wird als Teil des Establishments gesehen und wird überflüssig, weil die Grünen den Spagat zwischen fortschrittlich klingenden Versprechungen und kapitalistischer Realpolitik eleganter aussehen lassen.
Es mag Zwischenhochs geben wie aktuell in Berlin oder Anfangseuphorie wie in Bremen. Am Ende kommt die Rechnung dafür, von einer grundlegend anderen Politik geredet, aber nicht geliefert zu haben.
Nichtregieren allein ist auch keine Lösung. Die sächsische LINKE gebärdet sich seit Jahren wie eine Regierungspartei im Wartestand. In ihrem Programm zur Landtagswahl spricht sie von einer „Privatisierungsbremse“, aber nicht davon, Privatisierung komplett abzulehnen und die schon privatisierten Betriebe wieder in öffentliches Eigentum zu überführen. Den sozialen Wohnungsbau
wolle man „ankurbeln“, aber die Aussage, dass das Land und die Kommunen die Wohnungen bauen werden, wollte die sächsische LINKE nicht treffen.

Soziale Frage unterbetont?

In der LINKEN wird seit Längerem darüber gestritten, ob man die „soziale Frage“ genug betone. Vor allem die Anhänger*innen von Sarah Wagenknecht behaupten, die LINKE hätte diese vernachlässigt und wäre den Grünen zu ähnlich, als großstädtische Partei, die auf Fragen wie Antirassismus und Umweltschutz setze.
Natürlich sind die bereits erlittenen sozialen Abstiege im Osten, niedrige Löhne, prekäre Jobs und Sorgen bezüglich kommender wirtschaftlicher Verwerfungen oder Altersarmut und auch die realen Erfahrungen mit der LINKEN an der Regierung Teil des Frustrations-Mixes, auf dem die Angst-
Propaganda der Rechtspopulisten basiert.
Allerdings waren soziale Gerechtigkeit und wirtschaftliche Probleme nicht die ausschlaggebenden Faktoren bei dieser Wahl. 58% in Brandenburg und 75% in Sachsen sind mit ihrer wirtschaftlichen Lage nach eigenen Angaben zufrieden. Hingegen fürchten 63% in Sachsen, dass „der Klimawandel unsere Lebensgrundlagen zerstöre“ und 60%, der „Einfluss des Islam“ werde in Deutschland „zu stark“. [2]
Es nutzt nichts, die „soziale Frage“ wie eine Monstranz vor sich her zu tragen. Sie muss konkret beantwortet werden. Dazu gehört, eine klare antirassistische Position zu formulieren. Die LINKE sollte in der Klimafrage in die Lücke stoßen, welche die Grünen lassen: Für eine radikale ökologische Wende eintreten und gleichzeitig dafür kämpfen, dass nicht die Arbeiter*innenklasse dafür bezahlt, sondern die Reichen und die Konzerne.

Klimaschutz und Arbeitsplätze

Die AfD hat flächendeckend unter „Arbeitern“ [3] gut abgeschnitten, zudem war sie im Lausitzer Braunkohlerevier erfolgreich. Mit einer Ausnahme ist sie dort in allen Wahlkreisen stärkste Partei geworden. Das Gegeneinander-Ausspielen von Ökologie und Ökonomie, von Klimaschutz und Arbeitsplätzen hat gegriffen. Wohl aus Sorge um ihre Jobs haben viele Arbeiter*innen die Klimaleugner-Partei gewählt. Hier hilft weder der opportunistische Kurs der Brandenburger LINKEN, die an der Braunkohle festhalten will noch die ignorante Haltung der Grünen, sich um die Jobs nicht zu scheren. Hier müsste eine Linke agieren, die ohne Zögern für den Ausstieg aus dem Klimakiller Braunkohle kämpft und genauso kompromisslos dafür eintritt, dass die Löhne der Braunkohle-Beschäftigen unbefristet weiterbezahlt werden bis eine gleichwertige Anschlussbeschäftigung gesichert ist. Dies wird nicht funktionieren, wenn man sich scheut, die Eigentumsfrage – die notwendige Vergesellschaftung der Energiewirtschaft unter demokratischer Kontrolle – aufzuwerfen.

Hahn Wahlkampfauftakt, August 2009 - by Die Linke Sachsen.jpg

Nachvollziehbar ist auch, dass die Braunkohle-Arbeiter*innen allgemeinen Versprechungen von Ersatzarbeitsplätzen und Strukturprogrammen angesichts Kohls historischer Lüge von den „blühenden Landschaften“ nicht trauen. Die LINKE müsste für ein umfassendes öffentliches Programm zum ökologischen Umbau der Industrie eintreten, dafür aktiv auf die Straße gehen, müsste auch in den Gewerkschaften für diese Position argumentieren und den Beschäftigen eine Perspektive aufzeigen, wie diese selbst aktiv werden können, um ihren Lebensstandard zu verteidigen.

System change

Die „soziale Frage“ lediglich defensiv aufzugreifen, im Sinne eines zweiten Aufgusses der Sozialdemokratie, wird nicht funktionieren. Es gibt keinen Platz für eine „Kümmererpartei“, welche sich anbietet, den ausgefransten Sozialstaat zu flicken. Die Klassenfrage ist untrennbar mit den großen Zukunftsfragen Migration und Klima verbunden, mit der Frage, wie wir leben wollen und wer darüber entscheidet. Die Partei sollte die „soziale Frage“ nach vorne gerichtet aufgreifen. Dazu müsste sie offensiv antikapitalistisch agieren.
Das System befindet sich, ungeachtet des noch im Bewusstsein wirkenden relativen Aufschwungs in Deutschland, in einer strukturellen ökonomischen, ökologischen, sozialen und politischen Krise. Die LINKE wird nur aus ihrer strategischen Klemme herauskommen, wenn sie Antworten auf diese Krise bietet und in den konkreten Auseinandersetzungen zeigt, dass sie sie einen Gebrauchswert hat, weil sie dies Auseinandersetzungen inhaltlich und praktisch befördern kann.
Solange der LINKEN der Mut zur grundlegenden Infragestellung des Kapitalismus fehlt, solange sie Fragen wie Klimaschutz, Wohnungsnot, Rassismus und Armut durch die Augen einer Werbeagentur sieht und sich fragt, welches Thema man wann auf die Plakate schreiben soll, gar einige einen Widerspruch darin sehen anstatt verschiedene Aspekte einer Krise des Systems, wird die Partei den Entwicklungen hinterherlaufen. Die Partei muss die Vision einer grundlegenden anderen Gesellschaft vermitteln, sie braucht eine sozialistische Perspektive, die mit konkreten
Vorschlägen untermauert werden muss.
Weder die weitere Anpassung an SPD und Grüne noch gegenseitige Schuldzuweisungen und neue Personaldebatten helfen der Partei jetzt weiter. Die LINKE muss umschwenken von einer parlamentarisch fixierten, auf die Establishment-Parteien starrenden Politik, hin zu Kampagnen, rein in die sozialen Auseinandersetzungen, muss sich als aktive Kraft beweisen, die einen Gebrauchswert für die Menschen vor Ort hat. [4]

AfD zeckt sich fest

Die Krise des Systems, das Auseinanderdriften der EU und gewachsene Widersprüche zwischen den Regionen der Welt führen zu einer Polarisierung – nach links und nach rechts. Nur findet die Polarisierung nach links, die sich aktuell in großen antirassistischen Protesten sowie der Bewegung Fridays for Future ausdrückt, keine Entsprechung auf Wahlebene. Der AfD ist es gelungen, die rechte Polarisierung bei Wahlen nahezu zu monopolisieren.

Die AfD verfügt über Eigenschaften einer „Protestpartei“. So sagen 87% der AfD-Wähler*innen in Brandenburg und 83% in Sachsen, das wäre die einzige Partei, mit der man einen Protest gegen die Etablierten ausdrücken könne.
Doch es handelt sich dabei nicht um einen fehlgeleiteten Sozialprotest, der sich leicht nach links umlenken lassen würde. Nur 14% der AfD-Wähler*innen in Brandenburg gaben an, Löhne und Renten wären ausschlaggebend für ihre Wahlentscheidung gewesen, 11% in Sachsen sagten dies über die soziale Sicherheit. 97% in Brandenburg und 99% in Sachsen gaben an, dass sie die AfD gut fänden, weil diese „den Zuzug von Ausländern und Flüchtlingen begrenzen“ will, 30% bzw. 34% sagten, Forderungen in diese Richtung wären ausschlaggebend für ihre Wahlentscheidung gewesen. [5]

Erfolg für den „Flügel“

Horst Kahrs von der Rosa-Luxemburg-Stiftung schreibt in seiner Wahlanalyse: „Wer AfD wählt, will eine andere Gesellschaft.“ Das ist vereinfacht, aber nicht falsch. Der Protestcharakter der AfD
basiert auf tiefsitzenden völkischen und rassistischen Einstellungen, sie schwimmt mit auf der weltweiten Welle reaktionärer Antworten auf die Krise des Kapitalismus. Nur 24% der AfD-Anhänger*innen sind der Meinung, die Lebensumstände hätten sich massiv verschlechtert. Aber
92% sorgen sich vor dem Einfluss des Islam und 80%, dass sich „unser Leben“ zu stark verändere.
Das erklärt auch, warum die klare Rechtsentwicklung der Partei kaum deren Beliebtheit einschränkt. Die Landesverbände in Sachsen und Brandenburg sind zur aktivistischen, militanten Rechten hin offen, der Brandenburger Spitzenkandidat Kalbitz selbst hat Kontakte zu bekennenden Nazis. Im gesamten Osten ist der völkische, aggressiv rassistische „Flügel“ um Bernd Höcke dominant.
So schnell werden wir die AfD nicht los. In einer Phase, in der soziale Kämpfe nicht offen ausgetragen werden und die Klassenfrage in den Hintergrund tritt vor scheinbaren „Wertefragen“ kann die AfD die Widersprüche zwischen ihre prokapitalistischen Wirtschafts- und Sozialpolitik und der Demagogie, sich als Vertreterin der „kleinen Leute“ zu gebärden, relativ einfach verschleiern.
Ihr Aufstieg ist kein Grund zur Panik, aber sollte Anlass zur Unruhe sein. Die AfD in der Opposition verschiebt den politischen Diskurs nach rechts und treibt vor allem die CDU vor sich her.
Durch die Wahlerfolge im Stammland von Höckes „Flügel“ wird der völkische, offen rechtsextreme Teil der Partei gestärkt. Höcke hat bereits angekündigt, sich auf die im Herbst anstehenden Wahlen für den Parteivorstand vorzubereiten. Gleichzeitig wird die AfD einem stärkeren
Anpassungsdruck ausgesetzt sein. Bald werden die Stimmen in der sächsischen oder brandenburgischen CDU lauter werden, die AfD „einzubinden“, sie zu „entzaubern“.
Eine Regierungsbeteiligung der AfD würde dem Protest- und Anti-Establishment-Gehabe der Partei einigen Schwung nehmen. Die österreichische Erfahrung zeigt allerdings, dass die Rechtspopulisten nicht durch diese derartige „Entlarvung“ strukturell geschwächt werden. Dort konnten sie sich festigen und treiben die gesamte etablierte Politik weiter nach rechts.

Zum Autor

Claus Ludwig lebt in Köln und ist Mitglied im Landessprecher*innen-Rat der Antikapitalistischen Linken NRW und im Bundesvorstand der Sozialistischen Alternative.

***

[1] Zitiert nach: Kahrs, Horst: Die Wahl zum 7. Landtag Brandenburg und zum 7. Sächsischen Landtag am 1. September 2019, Wahlnachbericht, erste Kommentare und Daten, Rosa-Luxemburg-Stiftung.

[2] Ebd.

[3] In der Wahlanalyse sind damit Arbeiter*innen im klassischen Sinn, Handarbeiter*innen in der Industrie und im Handwerk, gemeint.

[4] Zitiert nach: Kahrs, Horst: Die Wahl zum 7. Landtag Brandenburg und zum 7. Sächsischen Landtag am 1. September 2019, Wahlnachbericht, erste Kommentare und Daten, Rosa-Luxemburg-Stiftung.

[5] Ebd.

akl - Antikapitalistische Linke

———————————————————————

Grafikquellen      :

Oben       —        von Foto René Lindenau auf scharf – links

———————————–

Unten       —          Dr. André Hahn bei Wahlkampfauftakt der sächsischen LINKEN

Abgelegt unter Köln, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Riegelsberger lechts-rinks

Erstellt von DL-Redaktion am 26. August 2019

Wer kann mit wem in Riegelsberg?

Neujahrsempfang2011BH.jpg

Von Marco Reuther

Was ist Politik? Dass sie eine Gemengelage aus vielen Gesichtspunkten und auch persönlichen Befindlichkeiten sein kann, zeigt gerade das Beispiel Riegelsberg. Dort sorgen die Beigeordneten-Wahl, eine Linke-„Abweichlerin“ und ungewöhnliche Partner für politisches Zähnefletschen.

In Riegelsberg ist der wechselseitige Ärger in den Ratsfraktionen noch nicht so ganz verraucht. Vor der konstituierenden Gemeinderatssitzung hatten CDU und Linke vereinbart, sich mit ihren gemeinsamen Stimmen die Ehrenämter der Beigeordneten zu teilen. Was aber wiederum die für die Linke neu in den Rat eingezogene Petra Brück nicht unterstützen wollte, so dass sie wieder aus der dreiköpfigen Fraktion der Linken austrat – dennoch konnten CDU und Linke ihre Kandidaten durchbringen (wir berichteten).

Erster Beigeordneter ist nun Benjamin Schmidt (CDU), mit 17 Ja-, einer Nein-Stimme und 14 Enthaltungen gewählt. Zweiter Beigeordneter ist der Linken-Fraktionsvorsitzende Ludwig Dryander. Er gewann die geheime Wahl mit 17 zu 14 und einer ungültigen Stimme. Die Sitzverteilung im Riegelsberger Gemeinderat: CDU 13, SPD 10, Bündnis 90/Die Grünen 4, Die Linke 3, AFD 2, FDP 1. In der Sitzung fehlte die FDP-Vertreterin wegen Urlaubs.

Der SPD-Fraktionsvorsitzende Frank Schmidt spricht nun davon, dass sich CDU und Linke die Beigeordneten-Ämter „geschnappt“ hätten, obwohl Ludwig Dryander zuvor kein Interesse an dem Amt gezeigt habe. Offenbar wolle die CDU lieber mit zwei „schwachen Linken“ zusammenarbeiten als mit der SPD. Man müsse nun schauen, wo man Mehrheiten herbekommt. Er hoffe, dass von CDU und Linken keine Blockaden kommen.

Es gibt sicher viele Linke deren Hände gerne in Taschen der Rechten enden ! Oder Umgekehrt

Dazu muss man auch wissen, dass das wechselseitige Verhältnis zwischen Bürgermeister Klaus Häusle (SPD) und der bisherigen Linken-Fraktionsvorsitzenden Birgit Huonker, ehemalige Landtagsabgeordnete und hauptberuflich Referentin der Linken-Landtagsfraktion, bestenfalls unterkühlt war. Birgit Huonker war in der ersten Runde der Bürgermeisterwahl – angetreten als unabhängige Kandidatin – knapp auf Rang drei verwiesen worden und hatte, wie im Wahlkampf angekündigt, nicht mehr für den Gemeinderat kandidiert. Vor der Stichwahl sprach sie sich für den CDU-Kandidaten Benjamin Schmidt aus. Im Hintergrund ist sie weiterhin aktiv und ihr Mann Joachim Schild-Schröder ist für die Linken neu in den Gemeinderat eingezogen, wo er nun neben Dryander das zweite verbleibende Fraktionsmitglied der Linken ist.

Quelle     :         Saarbrücker-Zeitung         >>>>>          weiterlesen 

———————————————————————

Grafikquellen        :

Oben       —        Neujahrsempfang DIE LINKE. Birgit Huonker und Oskar Lafontaine

————————-

Unten      —        Rechte Tasche – linke Tasche – übrig blieb die leere Flasche /  Screenshot  YOUTUBE

Abgelegt unter Kommunalpolitik, P. DIE LINKE, Positionen, Saarland | 7 Kommentare »

Die Linke in Riegelsberg

Erstellt von DL-Redaktion am 14. August 2019

Eklat im Riegelsberger Gemeinderat

Jetzt geht die Nächste ?

Von Monika Jungfleisch

Petra Brück von der Linken tritt noch in der ersten Sitzung des Gemeinderats aus ihrer Fraktion aus. Ihre Parteigenossen reagieren auf die Entscheidung mit Unverständnis.

Mit einem Paukenschlag endete am Montag die konstituierende Sitzung des Gemeinderates Riegelsberg. Petra Brück, die für „Die Linke“ neu in den Rat gewählt worden war, trat noch in der Sitzung aus der Fraktion aus.

Zuvor hatte die 64-Jährige, vor der Wahl des 2. Beigeordneten, eine Erklärung abgegeben: Sie plädierte, entgegen der anderen Linken, für Dominik Blaes von der SPD als 2. Beigeordneten. „Dies entspricht meinem Demokratieverständnis und auch dem Wählerwillen. Die zwei stärksten Fraktionen sollten den ersten und zweiten Beigeordneten stellen.“ Dies hätten auch vor fünf Jahren die damalige Linken-Fraktionsvorsitzende Birgit Huonker sowie das Grünen-Ratsmitglied Stephan Lehberger zu Protokoll gegeben. Ihre Unterstützung für den SPD-Kandidaten nützte jedoch nichts, denn der Linken-Kandidat, ihr (Ex-)Fraktionskollege Ludwig Dryander, gewann die Wahl mit 17 zu 14  und einer ungültigen Stimme (Sitzverteilung: CDU 13 Sitze, SPD 10, Bündnis 90/Die Grünen 4, Die Linke 3, AFD 2, FDP 1 (fehlte wegen Urlaub).

Neujahrsempfang2011BH.jpg

Und Mama Hu ? Sie macht das rechte Auge auf und zu !

Bautzen Großwelka - Sauriergarten - Homo erectus 03 ies.jpg

Die sucht nun bei den ALTEN Ruhm ?

Schon im Zuge der Bürgermeisterwahl im Mai war das enge Verhältnis der Linken-Bürgermeisterkandidatin Birgit Huonker mit der CDU auffallend. Nach ihrer Niederlage im ersten Wahlgang, knapp hinter dem zweitplatzierten CDU-Kandidaten, hatte sich Huonker für den CDU-Herausforderer Benjamin Schmidt stark gemacht – was vielen in den eigenen Parteireihen missfiel. Auch in den Verhandlungen nach den Gemeinderatswahlen bestimmte sie die Gespräche zwischen den im Rat vertretenen Parteien.

Quelle        :         Saarbrücker-Zeitung           >>>>>          weiterlesen

————————————————————————-

Grafikquellen       :

Oben     —          Screenshot DL /  privat –  Saarbrücker-Zeitung – Foto: Becker&Bredel

————————

 2.) von Oben      —       Neujahrsempfang DIE LINKE. Birgit Huonker und Oskar Lafontaine

———————————–

Unten         —      Jagdszene: Homo erectus im alten Teil („Sauriergarten Großwelka“) des Saurierparks in Bautzen-Kleinwelka

Abgelegt unter Kommunalpolitik, P. DIE LINKE, Saarland, Überregional | 68 Kommentare »

Diskussion um Einschulung

Erstellt von DL-Redaktion am 12. August 2019

Alle mit dabei

Schultafel.jpg

Von Ralf Pauli

Sollten Kinder mit mangelnden Deutschkenntnissen erst später in die Grundschule? Was ErzieherInnen und LehrerInnen von der Debatte halten.

 Wenn an diesem Samstag 73 neue Erstklässlerinnen und Erstklässler an der Möwensee-Grundschule im Norden Berlins eingeschult werden, hat Manuel Honisch sie im Kopf schon sortiert. Nach Kindern, die keine Reime erkennen. Nach Jungen, die ihren Namen falsch schreiben. Nach Mädchen, die Sätze unvollständig formulieren.

Die ganze Woche über haben der Sonderpä­da­goge und andere Lehrkräfte der Schule die Kinder einzeln für je eine Stunde getestet: auf Motorik, auf Konzentrationsfähigkeit und Zahlenverständnis – und eben auf Deutschkenntnisse. In den kommenden Wochen folgen noch Tests in der Kleingruppe und der gesamten Klasse. Doch schon jetzt ist sich Honisch sicher: „Mehr als die Hälfte hat Sprachförderbedarf“.

Zum Beweis hat Honisch – kurze Hose, Ohrringe, pinkes Hemd – einen Stapel weißer Hefte mit ins „Förderzimmer“ gebracht. Dieser Raum ist das Reich der beiden SonderpädagogInnen an der Möwensee-Grundschule. Hier treffen sie sich nachmittags mit ihren Sprachfördergruppen oder dem „Matheclub“, hier sind Honisch und seine Kollegin Anna Brinkmann nun verabredet, um die Tests der neuen ErstklässlerInnen zu sichten und Lernziele für die Förderbedürftigen zu formulieren.

Für viele wird die Empfehlung lauten, das „phonologische Bewusstsein“ zu trainieren, dafür reichen Brinkmann und Honisch nur wenige Blicke auf die Sprachübungen. Manche werden vielleicht ein richtiges Sprachtraining benötigen. Das könne man aber erst nach Ende aller Tests mit Sicherheit sagen.

Was Honisch und Brinkmann aber jetzt schon wissen: Sie werden mit ihren beiden Teilzeitstellen nur die Kinder mit „intensiven Förderbedarf“ betreuen können. Im letzten Schuljahr waren das 40 Erst- und ZweitklässlerInnen, fast jedeR Dritte. Durch die Neuen, schätzen Honisch und Brinkmann, dürften 20 weitere Kinder hinzukommen, die dem Unterricht vermutlich nur schwer folgen können.

Keine Ahnung

Es ist keine neue Debatte, die in dieser Woche hochgekocht ist. Wie Schulen mit diesen Kindern umgehen sollen, darüber wird in Deutschland seit den 70ern leidenschaftlich gestritten. Jedes Bundesland hat seine eigene Antwort darauf gefunden, ob und wie lange SchülerInnen verschiedener Niveaus zusammen lernen sollen.

Seitdem die schleswig-holsteinische Bildungsministerin Ute Erdsiek-Rave (SPD) 2005 jedoch als Erste das gegliederte Schulsystem aus Hauptschule, Realschule und Gymnasium zugunsten einer Gemeinschaftsschule aufbrach, vertiefen sich die ideologischen Gräben wieder: zwischen den Verfechtern des getrennten Lernens, die um die Unterrichtsqualität fürchten – und den Befürwortern des integrativen Lernens, die darin den Schlüssel zu mehr Bildungsgleichheit für alle sozialen Schichten sehen.

Selten wurde das so eindrucksvoll sichtbar wie diese Woche, als der CDU-Haushaltspolitiker und Fraktionsvize Carsten Linnemann der Rheinischen Post ein Interview gegeben hat. Darin hatte er vor „neuen Parallelgesellschaften“ gewarnt und gefordert, Kinder ohne ausreichende Deutschkenntnisse nicht einzuschulen. Zu seinen Äußerungen erhielt Linnemann Zustimmung, aber es gab auch viel Kritik.

Vom Thema keine Ahnung

„Man sieht, dass der Mann von dem Thema keine Ahnung hat“, sagt Sonderpädagoge Honisch. An seiner Schule sei der Sprachstand sehr niedrig und der Anteil der SchülerInnen mit Migrationshintergrund sehr hoch, 70 Prozent. Nichts Ungewöhnliches im Stadtteil Wedding. Honisch warnt aber vor falschen Rückschlüssen. Die Sprachdefizite der SchülerInnen hätten vor allem mit der sozialen Schicht und dem Mangel an Lernunterstützung durch Eltern zu tun.

„Wir haben ausländische Kinder aus Syrien oder Russland, die ohne ein Wort Deutsch an die Schule kommen und in erstaunlich kurzer Zeit dem Unterricht folgen können. Und wir haben deutsche Kinder, die mit erheblichem Förderbedarf an die Schule kommen und später die Schule abbrechen.“ Honisch ärgert sich vor allem über Linnemanns Alternative zur Einschulung: eine verpflichtende Vorschule für alle Kindern, die kaum Deutsch sprechen. „Wie sollen die Kinder Deutsch lernen, wenn sie keine Sprachvorbilder um sich herum haben?“

Tatsächlich ist diese Praxis längst verbreitet, in Hessen beispielsweise. Allerdings ist die Teilnahme an den Vorlaufkursen dort freiwillig. Der Berliner Senat hingegen hat vor Jahren die Vorschulklassen abgeschafft und stattdessen eine flexible Schuleingangsphase eingeführt. An der Möwensee-Grundschule lernen Erst- und ZweitklässlerInnen zusammen; wer nicht weit genug ist, bleibt noch ein drittes Jahr.

Carsten Linnemann CDU Parteitag 2014 by Olaf Kosinsky-1.jpg

Ein  Hinterbänkler aus der CDU, Carsten Linnemann –  eine Niete in Nadelstreifen

Zwar hat die Berliner SPD zuletzt ins Spiel gebracht, das letzte Kitajahr vor der Schule zur Pflicht zu machen, um auch die letzten 5 bis 7 Prozent Abstinenzler an die Kitas zu bringen. Auf taz-Anfrage äußert sich der Berliner Senat aber ablehnend zu den Vorschlägen Linnemanns: „Natürlich ist es wünschenswert, dass Kinder vor der Einschulung Deutsch lernen und so gut in die Schule starten können.“ Das aber sei kein Grund, Kinder, die nicht gut Deutsch können, länger von der Schule auszuschließen.

Stattdessen setzt Berlin wie fast alle anderen Bundesländer auf frühzeitige Sprachförderung schon im Kita-Alter. Acht Bundesländer testen sämtliche Kinder mit vier oder fünf Jahren, also bis zu zwei Jahre vor dem Schuleintritt. Woanders werden nur nichtdeutsche Kinder getestet (Bayern), oder solche, die keine Kita besuchen (Nordrhein-Westfalen). In Hessen ist der Test freiwillig. Nur Schleswig-Holstein und Thüringen prüfendie Deutschkenntnisse gar nicht.

Quelle       :         TAZ           >>>>>          weiterlesen

———————————————————————

Grafikquellen         :

Oben       —         Schultafel gesehen am Ersten Schultag. Veröffentlicht in: Münchner 09/1998, Seite 22

Abgelegt unter Bundestag, Nordrhein-Westfalen, P.CDU / CSU, Wirtschaftpolitik | Keine Kommentare »

Tönnies muss weg !

Erstellt von DL-Redaktion am 8. August 2019

Neues vom Lügenleser

2018-08-17 1. FC Schweinfurt 05 vs. FC Schalke 04 (DFB-Pokal) by Sandro Halank–059.jpg

Kolumne von Juri Sternburg

Menschen lügen, manchmal aus Selbstschutz. Andere wie Schalke-Chef Tönnies tun es wissentlich und offenbaren dabei ein menschenfeindliches Weltbild.

Menschen machen Fehler, na klar. Man sagt ab und zu Dinge, die man nicht so meint. Eine kurze Entschuldigung, mein Fehler. Zumindest wenn man ein wenig Respekt für den Gegenüber mitbringt. Schwamm drüber.

Auch Menschen in Führungspositionen machen Fehler. Da sei ihnen was rausgerutscht, heißt es oft. Meist lügen sie jedoch einfach frech. „Ich habe noch keinen einzigen Sklaven in Katar gesehen“, erklärte Franz Beckenbauer 2013, als es um die Stadionbauten in Katar ging. Solch vermeintliche Unwissenheit ist keine Seltenheit

VW-Chef Herbert Diess etwa erklärte jüngst gegenüber der BBC, dass ihm die Arbeits- und Umerziehungslager für circa 1,5 Millionen muslimische Uiguren in der chinesischen Provinz Xinjiang nicht bekannt seien. Genau in dieser Provinz betreibt VW jedoch ein Werk. Diese Art von Lügen dient dem Selbstschutz. Das ist ja wenigstens menschlich, möchte man sagen, wenn auch falsch.

Anders sieht es aus, wenn jemand nicht nur wissentlich lügt, sondern ein menschenfeindliches Weltbild offenbart. Nicht als Ausrutscher, sondern in einer vorbereiteten Rede. So wie jetzt im Fall von Schalkes Aufsichtsratsvorsitzendem Clemens Tönnies.

File:2010-06-03 Arena AufSchalke 20.jpg

Der Sportfunktionär hatte bei einer Veranstaltung als Reaktion auf den Klimawandel gefordert, man müsse zwanzig Kraftwerke in Afrika finanzieren, anstatt höhere Steuern einzuführen. „Dann würden die Afrikaner aufhören, Bäume zu fällen, und sie hören auf, wenn es dunkel ist, Kinder zu produzieren.“ Laut dem anwesenden Reporter erntete Tönnies dafür Applaus.

Quelle      :           TAZ        >>>>>             weiterlesen

———————————————————————-

Grafikquellen      :

Oben       —         DFB-Pokal 2018/19, 1. Hauptrunde: 1. FC Schweinfurt 05 gegen FC Schalke 04 0:2 (0:1)

No Facebook.svg This file has been released under a license that is incompatible with the license terms of Facebook. Thus it is not allowed to upload this file on Facebook. The use of this file on Facebook is a Copyfraud and copyright infringement.
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.

Abgelegt unter Feuilleton, International, Nordrhein-Westfalen | Keine Kommentare »

Radschnellweg Ruhrgebiet

Erstellt von DL-Redaktion am 7. August 2019

Eine Fahrradautobahn mitten durchs Ruhrgebiet 

MH-Radschnellweg RS1 Bahnbrücke.jpg

Von Andreas Wyputta

Ausgebremst – „der  schöner Wunschzettel“, sagt eine Planerin. Warum sich der Bau des Radschnellwegs Ruhr verzögert.

Holger Kesting sitzt in seinem Eiscafé „Radmosphäre“ und wartet auf Gäste. Direkt vor seiner Tür liegt der „Radschnellweg Ruhr“, aber besonders viele Radler*innen sind an diesem Tag nicht unterwegs. „Ich bin mit falschen Versprechen hergelockt worden“, sagt der 49-Jährige.

Mitten im sozialen Brennpunkt Essen-Altendorf hat die Stadt investiert: Alte Zeilenbauten wurden abgerissen, der Niederfeldsee künstlich angelegt. Hier liegt Kestings Eisdiele in einem schicken Neubau. „Trotzdem fehlt mir die Kundschaft, sagt er. „Der Radweg ist doch nur ein kurzes Teilstück – eine Sackgasse.“

Seit 2010, als das ganze Ruhrgebiet Kulturhauptstadt war, träumt die Region von diesem „rs1“ genannten Radschnellweg durchs Revier – dem ersten in ganz Nordrhein-Westfalen. Die bestbesuchte Veranstaltung damals war das Projekt „Still-Leben“ gewesen. An einem Julisonntag wurde die Autobahn 40 für Autos einfach dicht gemacht.

Radschnellweg RS1.png

In Richtung Dortmund waren Hunderttausende auf Fahrrädern unterwegs – und konnten erfahren, wie viel Raum und Vorrang Blechlawinen sonst eingeräumt wird. Die A40 verbindet die Städte Duisburg, Essen, Bochum und Dortmund auf kürzestem Weg. Wer wollte, konnte plötzlich in 60 Minuten von Bochum nach Mülheim radeln, Benutzung des Ruhrschnellweg-Tunnels in Essen inklusive.

101 Kilometer lang

„Wir haben gedacht: So etwas brauchen wir immer – eine Fahrradautobahn mitten durchs Revier“, erzählt Martin Tönnes, Chefplaner im Team des Regionalverbands Ruhrgebiet (RVR). Der RVR versucht seit Jahrzehnten, die 53 Städte zu einer „Metropole Ruhr“ zusammenzubringen. 2012 gab es eine erste Förderzusage für den rs1, 2014 bestätigte eine Studie die Machbarkeit. Kernaussage: Schon 2020 könne der 101 Kilometer lange rs1 fertig sein.

Doch ein Jahr vor dem anvisierten Fertigstellungstermin existiert nur eine 13 Kilometer lange Vorzeigestrecke zwischen Essen und Mülheim, an der auch die „Radmosphäre“ des Gastronomen Kesting liegt. Aber Radschnellweg-Standard – also Asphalt, vier Meter breite, getrennte und markierte Fahrbahnen, Beleuchtung, Winterdienst, kombiniert mit einem abgetrennten, zwei Meter breiten Fußweg – gibt es nur auf einem im Mai eröffneten 1,2 Kilometer kurzen Teilstückchen.

Schon die Modellstrecke zeigt allerdings, wie wichtig gut ausgebaute Radwege für die Verkehrswende sind: Wer will, kann erhaben über die Trasse der teilweise stillgelegten Rheinischen Bahn radeln. Auf dem alten, nicht mehr genutzten Bahndamm läuft der rs1 vom Essener Universitätsviertel Richtung Westen frei von lautem, stinkenden Autoverkehr mehrere Meter über der Stadt. Und in Richtung der Mülheimer Hochschule Ruhr West wird es hinter Kestings „Radmosphäre“ richtig grün.

Auf weiten Teilen der Strecke aber fehlt noch der Asphalt. Gefahren wird auf „wassergebundener Decke“ – also kleingemahlenem, gewalztem Schotter, der im Sommer staubt und im Winter matschig ist. Auch von der Beleuchtung ist noch nicht viel zu sehen. Immerhin: 2021 soll ein „Upgrade“ auf Radschnellweg-Standard folgen. „Der rs1 ist eines der wenigen Infrastrukturprojekte, gegen das nicht protestiert wird“, freut sich RVR-Planungschef Tönnes. „Stattdessen fragen die Leute: Wann geht’s endlich weiter?“

Endet abrupt im Nichts

Denn tote Gleise gibt es auch westlich in Richtung Duisburg und östlich in Richtung Bochum. Trotzdem ist in Essen in unmittelbarer Nähe der Uni, an der vierspurigen, vielbefahrenen Gladbecker Straße, Schluss. Die alte, noch zugewachsene Bahntrasse endet an einer meterhohen Mauer. Der Radweg läuft verschwenkt noch ein paar hundert Meter weiter durch das ab 2010 neu entstandene Universitätsviertel bis zum Viehofer Platz – und endet auch dort im Nichts.

„Hallo, wo geht’s denn hier weiter“, fragt Wilfried Uck. Der 68-Jährige aus Mülheim nutzt den Sommertag für eine Radtour – und ist nach 13 Kilometern in der Betonwüste am Viehofer Platz gestrandet. „Absolut enttäuscht“ ist er, als er hört, dass er hier nur unter allergrößten Schwierigkeiten in Richtung Bochum weiterkommt. Zwar hat die Stadtverwaltung eine Radstrecke zum Weltkulturerbe Zeche Zollverein ausgeschildert – von dort geht es schon heute weiter auf einem durchgehend asphaltierten Radweg bis fast in die Bochumer Innenstadt.

RS1 Radschnellweg Ruhr in Mülheim 1.jpg

Doch von dem bequemen, sicheren, autofreien und nicht zu verfehlenden Damm der Rheinischen Bahn ist bis Zollverein nichts zu sehen. Stattdessen schlägt die Stadt einen Schleichweg vor, der von Nichteingeweihten kaum zu finden ist. Zweimal müssen vier- bis sechsspurige Ausfallstraßen überquert werden, danach geht es über schmale, mit Schlaglöchern überzogene Wege durch Kleingartenanlagen Richtung Zollverein. Es ist, als wolle Essen Radler*innen um jeden Preis klarmachen: Du bist nichts – und der motorisierte Verkehr alles.

Quelle         :       TAZ           >>>>>            weiterlesen

——————————————————————–

Grafikquellen         :

Oben     —     2019 – Radschnellweg RS1 an der Alten Bahnbrücke / Stadtviadukt in Mülheim an der Ruhr.

————————————–

2. ) von Oben       —   Radschnellweg RS1

Abgelegt unter Energiepolitik, Kommunalpolitik, Nordrhein-Westfalen, Sozialpolitik | Keine Kommentare »

Freitag, der 13.

Erstellt von DL-Redaktion am 7. August 2019

Das System Tönnies stoppen!

File:Toennies Fleisch.jpg

Quelle        :         Scharf  –  Links

Von Bündnis gegen die Tönnies-Erweiterung

Bundesweite Aktionen gegen Tönnies, zentrale Demonstration in Rheda-Wiedenbrück.

Kurz nachdem die aktion./.arbeitsunrecht bekannt gab, dass Tönnies zur Zielscheibe des Aktionstags am 13. September 2019 wird, demontierte sich der „König der Schweine“ selbst. Vor der Kreishandwerkerschaft Paderborn-Lippe vertrat er offen rassistische Positionen und machte dadurch deutlich, wie eng Rassismus, Kapitalismus und damit die Ausbeutung von Mensch, Tier und Natur zusammenhängen. Die aktion gegen arbeitsunrecht und das Bündnis gegen die Tönnies-Erweiterung organisieren die Kampagne für den Schwarzen Freitag gemeinsam.

Campaignerin Jessica Reisner erläutert die Strategie: „Es gilt den Konzern dort zu treffen, wo es weh tut. Das sind Supermarkt-Regale und Stadion-Imbisse. Wir wollen Kunden, Einzelhändler und Fußball-Clubs animieren, auf Tönnies-Produkte zu verzichten. Tönnies skrupellos produziertes Billig-Fleisch steckt hinter den Aldi-Marken Tillman‘s und Landdiele. Ihm gehören die Marken Böklunder, Gutfried, Hareico, Redlefsen und weitere Marken der Zur Mühlen Gruppe

Für das Bündnis gegen die Tönnies-Erweiterung ergänzt Camila Cirlini: „Die zentrale Kundgebung findet in Rheda-Wiedenbrück statt. Auftakt ist um 15 Uhr am Bahnhof. Regionale Vorbereitungstreffen und erste Aktionen sind bereits in zahlreichen anderen Städten angekündigt. Gewerkschaften, Umwelt- und Tierrechtsverbände, Bürgerinitiativen, antifaschistische Gruppen und aktive Fußballfans sind aufgefordert, die Aktionen zu unterstützen.“

Michael Pusch vom Bündnis gegen die Tönnies-Erweiterung verweist auf die Auswirkungen der Fleischindustrie auf das Klima: „Eine Woche nach unserem Aktionstag beginnt der globale Streik für Klimagerechtigkeit. Die industrielle Fleischproduktion gehört zu den Hauptverursachern der Klimakatstrophe. Der Kampf für Klimagerechtigkeit lässt sich also nicht vom Kampf gegen die skrupellose Ausbeutung von Menschen und gegen die grausamen Qualen der Tiere trennen.“

Weitere Infos:

https://aktion.arbeitsunrecht.de/freitag13-toennies

https://buendnis-gegen-die-toennies-erweiterung.de/

Twitter-Hashtag: #Fr13Toennies

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————

Grafikquellen      :

Oben      —         Rheda-Wiedenbrück, Tönnies Fleischwerk im Stadtteil Rheda. Aufgenommen am 14. Januar 2006 von Daidalus.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————————–

Unten        —          Camila Cirlini (l.) und Michael Pusch (r.) vom Bündnis gegen die Tönnies-Erweiterung mit Elmar Wigand, Pressesprecher der aktion ./. arbeitsunrecht; Foto: privat

entnommen :  Scharf –  Links

Abgelegt unter APO, Arbeitspolitik, Medien, Nordrhein-Westfalen | Keine Kommentare »

Besetztes Haus in Köln

Erstellt von DL-Redaktion am 1. August 2019

DB schmeißt obdachlose Frauen raus

Alte Wagenfabrik Scheele, Vogelsanger Straße 321, Köln-9639.jpg

Aus Köln Anett Selle

Kölner*innen hatten für obdachlose Frauen ein leerstehendes Haus der Deutschen Bahn besetzt – und sie wollten es kaufen. Nun wurde es geräumt.

 „Meine Söhne wissen noch nicht, dass ich Hausbesetzerin geworden bin“, sagt die 79-jährige Erika Henning. Sie sitzt auf einer Kunstledercouch und räufelt ihren Rocksaum von den Knien auf die Oberschenkel. Draußen sind 35 Grad und durch die offenen Fenster kommt keine Brise. Vor der Couch steht ein Holztisch mit Kerzenständer, daneben eine alte Schirmlampe. Das Bett ist eine Matratze in der Ecke.

Sie schaut sich im Zimmer um und lächelt mit Zahnlücken. „Es ist ein so schönes Haus. Hohe Decken. Laminat – das ist vom Saubermachen her leicht. Fließendes Wasser. Toilettenspülung. Ich kann eine Tür zumachen und meinen Körper ausruhen. Alles ist so schön.“ Das war vor einer Woche.

Henning gehörte zu einer Gruppe obdachloser Frauen – die meisten über 70 –, die in Köln anderthalb Wochen lang in einem vormals leerstehenden Haus lebten. An diesem Mittwoch hat die Polizei das Haus geräumt, auf Drängen des Eigentümers, der Deutschen Bahn.

Das Haus steht in Köln-Ehrenfeld, Vogelsanger Straße 230. Die „Elster“, wie die Frauen es nannten, hat zwei Obergeschosse und einen Keller, Strom und Heizung, Gas und fließendes Wasser. Seit Jahren steht es leer. Bis am 19. Juli eine Gruppe von Kölner*innen das Haus besetzte.

Nicht an die Besetzer*innen verkaufen

Die Besetzer*innen sind lose organisiert, einige gehören zum Autonomen Zentrum Köln oder zur sozialistischen Selbsthilfe Mülheim, andere zu einer Gruppe, die sich Frauen der 1006 nennt. Es sind obdachlose Frauen, die in der Vergangenheit – angefangen bei der Bergisch-Gladbacher Straße 1006 – selbst Häuser besetzten. Auch das Haus in der Vogelsanger Straße soll anderen obdachlosen Frauen zur Verfügung stehen. Der Plan ist, das Haus von der Bahn zu kaufen.

Doch die Bahn, genauer ihre Tochter DB Immobilien, will das Haus zwar verkaufen, aber nicht an die Besetzer*innen und ihre Unterstützer*innen.

Aus aktuellen Statistiken der Landesregierung geht hervor, dass die Obdachlosigkeit in Nordrhein-Westfalen binnen eines Jahres um fast 40 Prozent gestiegen ist. „Wohnungslosigkeit ist nach Hunger das schlimmste Zeichen von Armut“, sagte Sozialminister Karl-Josef Laumann (CDU). In Köln bauen Bürger*innen für obdachlose Mitmenschen inzwischen Wohnkästen aus Spanplatten. Die Stadt Köln hat rund 6.000 Menschen als wohnungslos erfasst. Die tatsächliche Zahl dürfte höher liegen. Nach Angaben der Stadt ist vor allem die Zahl der wohnungslosen Frauen gestiegen.

42 Jahre lang hat Erika Henning gearbeitet und alleinerziehend drei Söhne großgezogen. Ihr ältester Enkel ist 27 Jahre alt und studiert in Weimar. Zweimal hat sie Krebs überlebt. Dann keine Wohnung gefunden, trotz Rente. Mit 77 wurde sie obdachlos. In den zwei Jahren ihrer Obdachlosigkeit hat Erika Henning in Bahnhöfen geschlafen. Mehrfach sei sie bestohlen und geschlagen worden, auch in Notunterkünften. „Ich bin 1940 geboren: Ich musste mich immer durchbeißen“, meint sie nur.

„Wir helfen uns gegenseitig, das war die Idee“, sagt eine 22-jährige Kölnerin, die die obdachlosen Frauen schon länger unterstützt. Sie nennt sich Sascha Fink und war eine von vielen Unterstützer*innen, die Betten und Matratzen organisierten, Lebensmittel heranschafften und sich um Verhandlungen mit der Deutschen Bahn bemühten.

Oben Wohnen, unten Beratung

„Frauen, die obdachlos waren oder sind, sprechen andere Frauen an und helfen“, erläutert Fink die Idee für die neue Nutzung der Vogelsanger 230. „Wenn du eine wohnungslose Frau bist, konntest du einziehen.“ Ziel war es, in der „Elster“ ein feministisches soziales Zentrum zu schaffen. Oben Wohnen, unten Platz für Frauenberatungsstellen. Zwei Kölner Initiativen, denen gerade die Räume gekündigt wurden, sollten mit einziehen.

Quelle      :      TAZ        >>>>>        weiterlesen

—————————————————————-

Grafikquelle        :      File:Alte Wagenfabrik Scheele, Vogelsanger Straße 321, Köln-9639.jpg

Alte Wagenfabrik Scheele

Abgelegt unter Deutschland, Köln, Nordrhein-Westfalen, Schicksale | Keine Kommentare »

DIE LINKE als Arzt –

Erstellt von DL-Redaktion am 25. Juli 2019

 am Krankenbett des kapitalistischen Systems?

Flag of Die Linke

Politiker ohne Dreck am Stecken zeigen ein Gesicht ?

Quelle      :      Scharf  –  Links

von Jürgen Aust *

Als die Mitglieder der Bremer LINKEN auf ihrem Sonder-Parteitag nach einer kurzen Debatte über den mit SPD und Grünen ausgehandelten Koalitionsvertrag abstimmten, kam aufgrund des Abstimmungsergebnisses eine nahezu euphorische Stimmung auf: die Delegierten hatten mit 71% dem Koalitionsvertrag zugestimmt und damit die Tür für eine erste „rot-grün-rote“ Landesregierung im Westen weit aufgestoßen. Diese Entscheidung wurde nunmehr auch durch einen Mitgliederentscheid bestätigt, der zwar mit einer Zustimmung von 78,5 % relativ deutlich ausfiel. Allerdings waren von 620  Mitgliedern nur 580 Mitglieder stimmberechtigt, weil 40 Briefe wegen veralteter Adressen nicht zugestellt werden konnten. Beteiligt hatten sich an der Abstimmung dann 349 Mitglieder, von denen 266 für den Koalitionsvertrag stimmten, während 67 und somit 19,8 % dagegen votierten. Setzt man die 266 Ja-Stimmen ins Verhältnis zu den 580 stimmberechtigten Mitgliedern, dann relativiert sich das Abstimmungsergebnis mit lediglich 46 % doch ziemlich deutlich.

Im Vorfeld der Bremer Wahl stimmte die Bremer Spitzenkandidatin, Christina Vogt, die Partei bereits auf eine neue Regierungskoalition mit den Worten ein: „Wir haben ein hohes Interesse an einer progressiven Regierung. Wir bereiten uns ernsthaft darauf vor und sind bereit, Verantwortung zu übernehmen. Bremen ist eine Folie für die gesamte Bundesrepublik.“ Und der Parteivorsitzende Bernd Riexinger erklärte bereits unmittelbar vor der Wahl: „Ich erwarte, dass wir zum ersten Mal in einem westlichen Bundesland in eine linke Regierung eintreten.“

Zu den politischen und ökonomischen Ausgangsbedingungen

Bremen gehört seit vielen Jahren zu den Bundesländern, in denen Armut und Arbeitslosigkeit auf Rekordniveau liegen. Nach dem aktuellen Arbeitsmarktbericht (Juni 2019) liegt Bremen bei der Arbeitslosigkeit im Vergleich mit allen anderen Bundesländern prozentual auf dem letzten Platz. Im Wahlprogramm der Bremer LINKEN heißt es u.a., dass Bremen das Bundesland mit der „höchsten Kinderarmut“ sei. Gleichzeitig habe Bremen aber bundesweit mit ca. 10.000 Millionär*innen prozentual die höchste Zahl an Einkommens- bzw. Vermögensmillionären.

Bremen hat seit 2011 unter einer grünen Finanzsenatorin einen harten Spar- und Konsolidierungskurs hinter sich. Ein auf Bundesebene eingerichteter „Stabilitätsrat“ hatte, vergleichbar mit dem Kurs der Troika in Griechenland, Bremen eine „Verwaltungsvereinbarung“ aufoktroyiert, die eine umfangreiche Liste von Sparmaßnahmen vor allem im Personal- und Sozialbereich enthielt. Im Gegenzug erhielt Bremen eine jährliche Konsolidierungshilfe von 300 Mio. €, um das eigentliche Ziel dieser Rotstiftpolitik zu erreichen, nämlich 2020 unter Einhaltung der Schuldenbremse keine neuen Schulden mehr machen zu müssen. Dieser Sparkurs war u.a. damit verbunden, dass Bremen einen jährlichen Sanierungsbericht vorlegen musste, der einen Katalog von Grausamkeiten enthielt: allein in 2019 soll danach ein Einsparvolumen von 538 Mio. € und in 2020 ein solches von 476 Mio. € generiert werden. Dass mit diesem Austeritätskurs alles andere als eine fortschrittliche Wirtschafts- und Sozialpolitik realisiert werden kann, dürfte auf der Hand liegen.

Zur sozialen Lage in Bremen

In Bremen liegt die Hartz IV-Quote seit vielen Jahren deutschlandweit prozentual an der Spitze aller Bundesländer. Aktuell sind in Bremen 72.386 Hartz IV-Bezieher*innen im Alter von 15 – 64 Jahren und 31.197 Kinder und Jugendliche von 0 – 14 Jahren, also insgesamt ca. 103.500 Menschen im Hartz IV-Bezug registriert, was angesichts von ca. 585.000 Einwohnern ein ungewöhnlich hohes Ausmaß von armutsbetroffenen Menschen darstellt. Diese Armutsverhältnisse kommen insbesondere auch auf dem Wohnungsmarkt zum Ausdruck. Hatte das Land Bremen in den 90er Jahren noch ca. 79.000 Sozialwohnungen, führte der Niedergang des Sozialen Wohnungsbaus dazu, dass der Bestand an Sozialwohnungen bis 2017 auf lediglich ca. 8.300 Sozialwohnungen zusammengeschmolzen war. Parellel zu dieser Entwicklung haben die Mietpreise sich nahezu explosionsartig in den letzten Jahren nach oben entwickelt. Allein in den letzten 10 Jahren sind die Mieten im Land Bremen um 32% (!) gestiegen, während die sog. Angebotsmieten von 2004 bis 2018 sogar ein Plus von 43,2% zu verzeichnen haben.  Für Menschen bzw. Haushalte mit geringem Einkommen ist es deshalb immer schwieriger, eine für sie bezahlbare Wohnung zu finden, während die Mietbelastungsquote für rund ein Viertel alle Haushalte bei 40% und mehr liegt. Ein im Auftrag der Sozialsenatorin erstelltes Gutachten kam zum Ergebnis, dass 41% aller Haushalte einen erhöhten Bedarf nach bezahlbarem Wohnraum haben, was allein in der Stadt Bremen ca. 123.000 (!) Haushalten entspricht.

Das Wahlprogramm und was daraus geworden ist

Das Wahlprogramm der Bremer LINKEN „Wem gehört die Stadt?“ hatte die Latte für einen möglichen Regierungswechsel relativ hoch gehängt. Es finden sich sogar unter der Überschrift „Alternativen zum Kapitalismus stützen und stärken“ Aussagen wie: „Eine entscheidende Frage gesellschaftlicher Veränderung ist und bleibt die Frage des Privateigentums am Produktionskapital. Eine soziale, friedliche, umweltgerechte, demokratische Gesellschaft erfordert, dass die ökonomische Macht derer, die an Armut, Ausbeutung, Naturzerstörung, profitorientiertem Wachstum, Rüstung und Kriegen verdienen, zurückgedrängt und überwunden wird.“ Realer Anspruch oder doch eher Symbolpolitik?

Um feststellen zu können, ob die Bremer LINKE zentrale Forderungen ihres Wahlprogramms einlösen konnte, sollen die Ergebnisse daran gemessen werden, was insbesondere bei dem, was die LINKE immer gerne mit linkem „Alleinstellungsmerkmal“ beschreibt, nämlich ihren  Forderungen zu Hartz IV, Arbeitslosigkeit und den mit dem Bereich „Soziale Gerechtigkeit“ zusammenhängenden Positionen, sich im Koalitionsvertrag wiederfindet. Um es vorweg zu nehmen: die Ergebnisse sind mehr als ernüchternd, was der langjährige Fraktionsvorsitzende der Bremer LINKEN, Peter Erlansson, in einem TAZ-Interview mit den Worten umschreibt: „Der Koalitionsvertrag ist noch schlimmer, als ich befürchtet habe.“

Im einzelnen:

I. Hartz IV

In ihrem Wahlprogramm erklärt die Bremer LINKE, dass das Modell Hartz IV arbeitsmarktlich gescheitert sei. Seine wesentlichen Bestandteile wie eine soziale Sicherung auf Armutsniveau, permanenter Druck, etc. „haben eine katastrophale Wirkung nicht nur auf die Betroffenen, sondern auch auf den Arbeitsmarkt.“ Deshalb formuliert sie weiter, dass „wir kämpfen für eine bundesweite vollständige Abschaffung aller Sanktionen.“ Sie fordert deshalb für Bremen eine „Zurückdrängung“ der Sanktionen und insbesondere im „Rahmen der Zusammenarbeit“ keine Sanktionen gegenüber Jugendlichen auszusprechen sowie das Ausschöpfen aller Ermessensspielräume, nicht auf Sanktionen zurückzugreifen.

Sie fordert außerdem, dass die Wohn- und Energiekosten (Strom, Wasser, Heizung) in tatsächlicher Höhe anerkannt werden müssen, um Zwangsumzüge durch Kostensenkungsverfahren auszuschließen. Außerdem fordert sie, das Absperren der Versorgung mit Strom, Gas und Wasser gesetzlich zu untersagen und durch Einrichtung eines Härtefallfonds in Bremen Energiesperren zu verhindern.

Schließlich will sie (Landes-) Programme für Zielgruppen einsetzen, die keine oder wenig Chancen auf Förderungen nach dem SGB II haben:  Alleinerziehende mit Kindern unter 3 Jahren, Aufstocker*innen, altere Beschäftigte und Erwerbslose, die bereits erfolgreich in geförderter Beschäftigung.

II. Arbeit in Bremen (Kap. Wirtschafts- und Strukturentwicklung)

Auch in diesem wesentlichen Politikfeld legt das Programm die Latte erfreulich hoch, wie beispielhaft diesen Themen zu entnehmen ist:

1) So will die LINKE den „Landesmindestlohn“ auf 12,63 € anheben, also auf eine Höhe, die nach 45 Erwerbsjahren in Vollzeit eine Rente oberhalb der Grundsicherung (aktuell 814 €) liegt. Damit will sie gleichzeitig ein deutliches Signal gegen den in Bremen ausufernden Niedriglohnsektor setzen.

2) Sie will die Ausweitung der Tariftreue nicht nur wir bisher im Bausektor, sondern auf alle öffentlichen Aufträge, also auch auf Dienstleistungen und Beschaffung ausweiten.

3)  Sie will, dass die öffentliche Hand in Bremen grundsätzlich auf Leiharbeit verzichtet (mehr als 4.600 Leiharbeiter*innen waren 2016 für den Senat beschäftigt).

4) Sie fordert weiterhin, dass das Bremische Personalvertretungsgesetz auch für alle Honorarkräfte, Lehrbeauftragte und vergleichbare Berufsgruppen ausgeweitet wird.

5)  Und sie fordert eine „Landesausbildungsumlage“, um dem Skandal den Boden zu entziehen, dass in Bremen jährlich 700 bis 1.000 Schüler*innen die Schule verlassen, ohne in eine weitere schulische oder berufliche Ausbildung zu gehen.

Der Koalitionsvertrag löst diese Vorgaben nicht annähernd ein

Es soll zunächst keinesfalls bestritten werden, dass die Bremer LINKE auf dem sozialpolitischen Terrain einige positive Akzente im Koalitionsvertrag setzen konnte. Statt vieler soll herausgestellt werden, dass die Situation der Alleinerziehenden auf dem Arbeitsmarkt nachhaltig verbessert werden soll, dass entschiedene Maßnahmen zur Veringerung der Kinderarmut ergriffen werden sollen, dass das Stadtticket für von Armut betroffene Menschen auf 25 € reduziert werden soll oder dass die Sozialwohnungsquote auf 30 % erhöht werden soll. Doch eine linke Regierungsbeteiligung sollte sich insbesondere daran messen lassen, was sie auf keinen Fall mittragen sollte, also ob sie ihre programmatischen Positionen bzw. die sog. roten Haltelinien nicht verwässert, sondern bewahren konnte.

1. Im Bereich Hartz IV und Armutsbekämpfung verlässt der Koalitionsvertrag leider nicht die neoliberale Hartz IV-Logik, sondern knüpft u.a. bei der Bekämpfung der Langzeitarbeitslosigkeit an den bisherigen neoliberal ausgerichteten Programmen LAZLO und PASS an, die die Vorgängerregierung von SPD und Grünen aufgelegt hatten. Diese Programme beruhten auf befristeten (geringfügig entlohnten) Arbeitsverhältnissen, waren grundsätzlich sanktionsbewehrt und hatten von ihrer zahlenmäßigen Dimension her allenfalls Placebo-Effekte. Der Koalitionsvertrag sieht bei ca. 20.000 Langzeitarbeitslosen in Bremen (Stand 30.06.2019) nicht mehr als 1.500 Beschäftigungsverhältnisse vor, was bei der Bekämpfung der Langzeitarbeitslosigkeit nur der bekannte Tropfen auf dem heißen Stein sein dürfte. Zumal ein wesentlicher Bestandteil dieses Programms das seit dem 01.01.2019 von der GroKo beschlossene „Teilhabechancengesetz“ ist, was nur die bereits seit sieben Jahren im Hartz IV-System arbeitslos registrierten Menschen erfasst und den größten Teil der Langzeitarbeitlosen im Regen stehen lässt.

2.  Eine der auf bundes- und Landesebene zentralen Forderungen zur Bekämpfung von Hartz IV, Ein-Euro-Jobs als eine moderne Form von Sklavenarbeit bedingslos abzuschaffen, sucht man im Koalitionsvertrag leider völlig vergeblich (und erstaunlicherweise auch im Wahlprogramm).

3. Die im Wahlprogramm als eine der Kernforderungen formulierte Forderung nach Bekämpfung der Sanktionen findet sich im Koalitionsvertrag lediglich als Absichtserklärung wieder, ohne dass die Koalitionsparteien sich auf eine entschiedene Absage an die Sanktionspolitik verständigt hätten. Es finden sich allenfalls moderate Positionen wieder, die eine Absenkung der Zahl der Sanktionen enthalten, insbesondere im Bereich der U 25-Jährigen.

4.  Auch die für eine glaubhafte Armutsbekämpfung im Wahlprogramm erhobene Forderung, bei Energiesperren einen Härtefonds einzurichten, sucht man im Koalitionsvertrag vergebens. Da Energiesperren eine besondere Form von sozialpolitischer Kannibalisierung darstellen, wird die neue Koalition in diesem Bereich offensichtlich die menschenunwürdige Politik der Vorgängerregierung fortsetzen.

5. Last but not least:  die für die Verelendung eines großen Teils der im Hartz IV-System erfassten Menschen (in Bremen und Bremerhaven beträgt die aktuelle Zahl ca. 103.500 Betroffene) ursächliche Nichtanerkennung der tatsächlichen Mietkosten findet sich entgegen den Forderungen im Wahlprogramm im Koalitionsvertrag mit keinem Wort wieder. Menschenverachtende Zwangsräumungen oder wachsende Verschuldung sind dadurch vorprogrammiert.

6. Im Bereich Beschäftigungs- und Wirtschaftsentwicklung legt die Bremer LINKE gemeinsam mit ihren Koalitionären ein Bekenntnis zur Förderung einer „starken Sozialpartnerschaft als Voraussetzung guter Arbeit“ ab, womit im Koalitionsvertrag bereits deutliche Weichen gestellt wurden, keine die Kapitalseite zu stark belastenden, also eher schonende Forderungen zu erheben. Deshalb sind wesentliche Positionen des Wahlprogramm in diesem für linke Politik wesentlichen Handlungsfeld nahezu ausgeblendet:

a) Der im Wahlprogramm mit 12,63 € geforderte Landesmindestlohn wird im Koalitionsvertrag auf 11,13 € abgeschmolzen mit einer Delegation an die Landesmindestlohnkommission, den Mindestlohn „zeitnah anzupassen.

b)  Zur notwendigen Enschränkung prekärer  Beschäftigung findet sich im Koalitionsvertrag zwar die Bereitschaft, auf sachgrundlose Befristungen auch weiterhin zu verzichten, allerdings sollen Befristungen mit Sachgrund lediglich auf ein Minimum reduziert werden. Was sich zunächst einmal positiv anhört, stellt jedoch in der Praxis das Haupteinfalltor für die ausufernde Befristungspraxis dar. Dies betrifft in Bremen insbesondere die Bereiche Universität, Schulen oder die Bremer Lagerhaus-Gesellschaft (BGL). Im gesamten Bereich der öffentlichen Hand sind über 4.600 Beschäftigte in Leiharbeit, so dass zu deren Austrocknung sicherlich andere Maßnahmen erforderlich sind, als die Zahl lediglich zu „minimieren“.

c) Ein nahezu dunkles Kapitel findet sich im Koalitionsvertrag unter der Überschrift „Mobile Beschäftigung, Migration und Integration“, wenn es dort u.a. heißt, dass „wir zur Verhinderung der missbräulichen Inanspruchnahme von Sozialleistungen die Zusammenarbeit der operativen Behörden (insbesondere Jobcenter, Agentur für Arbeit, Polizei, Zoll, Arbeitsschutz) fördern und ausweiten“ werden. Dies ist im Kern ein Teil der staatlichen Repressionspolitik à la Seehofer und es sollte sich für eine LINKE grundsätzlich verbieten, auf diesen Repressionszug aufzuspringen.

d)  Um Massenarbeitslosigkeit zu bekämpfen, bedarf es unter verschärften neoliberalen Verhältnissen unabdingbar eines groß dimensionierten öffentlichen Beschäftigungsprogramm, mit dem nicht nur Placebo-Effekte generiert werden, sondern das tatsächlich den Anspruch hat, Arbeitslosigkeit ernsthaft zu bekämpfen. In Bremen (einschließlich Bremerhaven) sind offiziell 38.042 Arbeitslose registriert, wodurch aber die tatsächliche Arbeitslosigkeit verharmlost wird. Einschließlich der in der Kategorie „Unterbeschäftigung“ erfassten Arbeitslosen liegt die Arbeitslosigkeit in Bremen bei 53.442 arbeitslosen Menschen, wovon 42.210 Personen länger als ein Jahr arbeitslos sind (Stand 30.06.2019). Der Koalitionsvertrag signalisiert nicht annähernd, wie man diesem Krebsübel des kapitalistischen Systems zu Leibe rücken will.

Bremen unter dem Diktat der Schuldenbremse

Mit dem Koalitionsvertrag hat DIE LINKE sich der sog. „Schuldenbremse“ unterworfen, wenn es dort im Kapitel „Finanzrahmen“ u.a. heißt: „Wir verpflichten uns, ab dem Jahr 2020 unsere Haushalte grundsätzlich ohne neue Kreditaufnahme aufzustellen, sowie es das Grundgesetz und unser Landesrecht in der Verfassung und im Ausführungsgesetz zur Schuldenbremse vorschreiben.“ Mit diesen Vorgaben akzeptiert die Bremer LINKE (wie bereits die LINKE in Berlin, Thüringen und Brandenburg) die wesentliche Säule neoliberaler Haushaltspolitik, die im Bereich der Staatsausgaben darauf ausgerichtet ist, ein Instrument zur Diskreditierung des Staates bzw. des öffentlichen Dienstes und zu einer marktradikalen Politik der Privatisierung und Deregulierung zu erhalten. Es herrscht eigentlich in der linken Diskussion bisher weitestgehend Einigkeit, dass eine Schuldenbremse mit dem Ziel der Senkung der Staatsausgaben ökonomischer und haushaltspolitische Schwachsinn ist, da sie dem Staat die Hände bindet, in notwendige gesellschaftliche Bereiche zu investieren und insbesondere den zunehmenden sozialen Verwerfungen entgegenzusteuern. Eine Linke, die sich diesem Diktat unterwirft, diskreditiert damit nahezu sämtliche in ihrem Wahlprogramm erhobenen Forderungen, da der Kampf gegen Armut und Massenarbeitslosigkeit mit nahezu strangulierten Haushalten nicht ansatzweise Erfolg haben kann. Und diese Selbstaufgabe hat die Bremer LINKE gewissermaßen im vorauseilenden Gehorsam im Koalitionsvertrag bereits unterzeichnet, wenn es im „Finanzrahmen“ weiter heißt: „In der Fortschreibung der Finanzplanung 2020 werden wir die folgenden jährlichen Steigerungsraten zur Grundlage machen: Personal 2,5 Prozent, Sozialausgaben 1,7 Prozent, Investitionsausgaben 2 Prozent und konsumtive Ausgaben 2,5 Prozent.“ Doch mit diesen minimalen Steigerungsraten, insbesondere im Sozialbereich, lässt sich nicht annähernd der immer wieder beschworene Politikwechsel erreichen, sondern der bisherige neoliberale Kurs wird mit hoher Wahrscheinlichkeit unter einer anderen Farbenkombination fortgesetzt.

Neoliberale Politik mit menschlicherem Antlitz

Vor diesem Hintergrund stellt sich für DIE LINKE einmal mehr die Frage, ob mit linker Regierungsbeteiligung in neoliberalen Zeiten überhaupt ein Richtungs- bzw. Politikwechsel möglich ist. Für einen Teil der Repräsentanten der LINKEN stellt sich das Problem seit vielen Jahren offensichtlich überhaupt nicht, da die grundsätzliche Orientierung auf eine Regierung mit linker Beteiligung perse bereits einen Politikwechsel beinhaltet. So der Fraktionsvorsitzende Dietmar Bartsch in seinem euphorischen Statement: „Das erste Mal Regierungsverantwortung im Westen rückt nahe. Die Bremer LINKE kann stolz sein, weil das ein bundespolitisches Signal ist.“  Er wurde umgehend von der Parteivorsitzenden Katja Kipping sekundiert: „Bremen kann ein Signal für den Bund werden. In einem Jahr wird die GroKo Geschichte sein. Wir wollen, dass die nächste Regierung eine progressive Politik macht.“  Und auch die kommentierende Linke signalisiert mit starken Worten: „Bremen: ein Herkulesprojekt für eine progressive Koalition,“  übertiteln die Redakteure des „SozialismusMagazin“, Joachim Bischoff und Bernhard Müller, ihren Beitrag zur Bremenwahl. Der Bremer Landessprecher, Felix Pithan, erklärt die kommende Entwicklung bereits vorwegnehmend: “ „Für mich ist der Koalitionsvertrag die Grundlage für einen Politikwechsel im Land Bremen.“ Und selbst Sahra Wagenknecht als Kritikerin des Kurses der Parteiführung stimmt in diesen Chor bereitwillig ein: „Nach Jahren wachsender Ungleichheit und hemmungsloser Bereicherung der oberen Zehntausend braucht Deutschland dringend eine Regierung, die sich um mehr sozialen Ausgleich bemüht. An einer solchen Regierung würde sich DIE LINKE auch im Bund beteiligen.“

Linke Repräsentant*innen, die im Vorfeld bereits derartige Vorschusslorbeeren verteilen, haben sich offensichtlich inzwischen von den Traditionslinien einer sozialistischen Linken, die den Kapitalismus überwinden will, weitestgehend verabschiedet. Denn ähnliche Entwicklungen gab es bereits Ende des 19. Jahrhunderts, als der Sozialist Millerand in das französische Kabinett eintrat und Rosa Luxemburg diesen „Verrat“ an der sozialistischen Sache massiv kritisierte: „In der bürgerlichen Gesellschaft ist der Sozialdemokratie ihrem Wesen nach die Rolle einer oppositionellen Partei vorgezeichnet, als regierende darf sie nur auf den Trümmern des bürgerlichen Staates auftreten.“ In der frühen SPD rechtfertigten zwei ihrer ideologischen Köpfe wie Eduard Bernstein und Georg von Vollmar eine Regierungsbeteiligung der SPD mit einer Methode der „stückweisen Einführung des Sozialismus in die bürgerliche Gesellschaft“ und phantasierten von einem „friedlichen Hineinwachsen in den Sozialismus mittels Sozialreformen“, so dass unmittelbar nach der Novemberrevolution der Weg der SPD für eine Regierungsbeteiligung unter einer weiterhin monarchistischen Ausrichtung vorgezeichnet war. Dass Noske und die gesamte SPD-Führung dann mit Hilfe der Reichswehr die revolutionären Kräfte im Blut erstickte, war eine nahezu zwingende Folge dieser Kollaboration mit der herrschenden Klasse.

An diesen frühzeitigen Illusionen, die im späteren Verlauf der Geschichte von der Wirklichkeit eindeutig widerlegt wurden, hat sich bis zur heutigen Zeit nahezu nichts geändert. Der Weg der SPD nach 1945 ist ein Beleg für die Einschätzung von Wolfgang Abendroth: „Politische Intelligenz haben die integrationistischen Reformisten, die sich kapitalistischen Denkschemata unterwerfen, niemals besessen.“ Dasselbe Schicksal haben die italienischen und französischen kommunistischen Parteien erlitten, die sich ebenfalls in das Abenteuer einer linken Regierungsbeteiligung begaben und grandios scheiterten. Beide Parteien haben sich nach den gescheiterten Regierungskoalitionen nahezu pulverisiert.

Und auch der Weg der PDS und später der LINKEN beweist, dass sie aus diesen Erfahrungen offenbar nichts gelernt haben. Denn weder die PDS noch später DIE LINKE haben bei ihren Regierungsbeteiligungen ihren proklamierten Anspruch, einen Politikwechsel einzuleiten, auch nicht annähernd einlösen können. Weder in Mecklenburg-Vorpommern, noch in der Berliner Koalition von 2001 bis 2011, noch aktuell in Brandenburg oder Thüringen lässt sich ernsthaft behaupten, dass die neoliberale Entwicklung gestoppt bzw. umgekehrt worden sei. Die Konzerne schalten weiterhin, wie sie wollen, und am Beispiel Brandenburg können wir feststellen, dass die LINKE sogar bereit ist, sich aufgrund ihrer Zustimmung zum neuen Polizeigesetz in den staatlichen Repressionsapparat einbinden zu lassen.

Wenn eine linke Regierungsbeteiligung unter bürgerlichen bzw. neoliberalen Verhältnissen überhaupt sinnvoll sein sollte, dann nur als Ausdruck und Ergebnis einer breiten Widerstands- und Protestbewegung, die eine linke Regierung gewissermaßen „vor sich hertreibt“ und ihr im öffentlichen Raum den notwendigen Resonanzboden verschafft. Alles andere ist frommer Kinderglaube und bahnt für die LINKE den Weg zu einer reformistischen Partei. Da aber diese Politik seit vielen Jahren bereits von der SPD im Interesse der herrschenden Besitz- und Machteliten vertreten wird, wird DIE LINKE für diese Rolle nicht gebraucht, was offensichtlich u.a. ihre Stagnation bei den Wahlergebnissen in der letzten Zeit ausmacht.

* Jürgen Aust ist Mitglied im Bundessprecher*innen-Rat der Antikapitalistischen Linken und im Landesvorstand der LINKEN.NRW Sprecher für Arbeitsmarktpolitik

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————

Grafikquelle    :      Flag of Die Linke

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Überwachung Polizei Aachen

Erstellt von DL-Redaktion am 24. Juli 2019

Infos aus privaten Accounts fließen in die Polizeiarbeit ein

Screenshot des Twitter-Accounts der Polizei Aachen. (Filter/Bearbeitung: netzpolitik.org)

Quelle       :         Netzpolitik. ORG.

Von       

Bei der Klima-Aktion „Ende Gelände“ im Juni passierte etwas Seltsames: Ein Twitter-Account mit dem Namen „Mister X“ postete zum wiederholten Male einen Tweet der Polizei Aachen – bevor dieser auf dem offiziellen Account erschien. So enttarnte sich ein Account, der mutmaßlich Proteste beobachtet. Die Polizei Aachen erklärte damals, ihr Tweet sei irrtümlicherweise mit dem persönlichen Account eines Mitarbeiters veröffentlicht worden.

Eine Informationsfreiheitsanfrage beim Polizeipräsidium Aachen gibt nun weiteren Einblick. Hierbei wiederholt die Polizei, dass es sich um einen Account eines Mitarbeiters handele. Der offizielle Polizei-Account sei hingegen aufgrund eines Erlasses aus dem Innenministerium vom 30. September 2016 erstellt worden. Eine Regelung, wie und ob private Accounts genutzt werden dürfen, sei in diesem Erlass nicht enthalten.

Private Nutzung wichtig für Social-Media-Polizisten

Die Polizei begründet, warum private Accounts für die Polizeiarbeit wichtig seien:

Den Mitarbeiterinnen und Mitarbeitern, die im Bereich ’social media‘ bei der Polizei Aachen tätig sind, obliegen besondere Anforderungen und Kompetenzen. Aus diesem Grunde ist auch die private Nutzung von Twitter und anderen sozialen Medien für diese Mitarbeiter von hoher Bedeutung.

Dass sie Informationen für ihre Arbeit nutzen, die sie über ihre privaten Accounts erhalten, gehöre dazu. Die Rechtsgrundlage steckt laut Polizei in § 9 Abs. 1 Nr. 1 des Polizeigesetzes NRW. Der besagt, dass die Polizei personenbezogene Daten erheben darf, wenn sie für ihre Aufgabenerfüllung notwendig sind.

Blick AC Dom von St Jakob.JPG

„Die Informationen, die der Mitarbeiter oder die Mitarbeiterin über seinen oder ihren Account erlangen, können damit aufgrund der genannten Rechtsgrundlage durch die Polizei genutzt werden.“ Im Polizeipräsidium Aachen gebe es zudem eine Dienstanweisung „Soziale Netzwerke“, die aber die Nutzung privater Accounts von Mitarbeitern nicht ausdrückliche regele. Explizit sei aber festgelegt, dass der offizielle Account der Polizei Aachen nicht privat genutzt werden dürfe.

Monitoring mit privaten Accounts rechtlich unproblematisch

Die Nutzung von privaten Accounts von Mitarbeitern der Polizei zum reinen Monitoring auf Twitter sei „rechtlich unproblematisch“, sagt Ulf Buermeyer, Richter beim Landgericht Berlin und Vorsitzender der GFF, gegenüber netzpolitik.org. Das sei vergleichbar mit einer „Internet-Streife“. Problematisch würde es nur, wenn die Polizei gezielt Desinformation über solche Accounts verbreite, was im Fall Aachen allerdings nicht passierte.

—————————————————————–

Grafikquellen      :

Oben     —          Screenshot des Twitter-Accounts der Polizei Aachen. Quelle —    (Filter/Bearbeitung: netzpolitik.org)

——————————

Unten       —    Wie gut das der olle Vandale Karl  nichts mehr mit bekommt.

This is a photograph of an architectural monument., no. 0

Abgelegt unter Kriegspolitik, Nordrhein-Westfalen, Politik und Netz, Überregional | Keine Kommentare »

Thema: Prekäre Arbeit

Erstellt von DL-Redaktion am 22. Juli 2019

A-typische Beschäftigung verharrt auf hohem Niveau

Quelle      :        Scharf  –  Links

Von Gewerkschaftsforum Dortmund

Quote in westdeutschen Ländern um bis zu 12 Prozentpunkte höher als im Osten.

Die Zahl der atypischen Beschäftigungsverhältnisse in Deutschland verharrt auf hohem Niveau. Besonders stark betroffen sind nach wie vor Frauen in Westdeutschland, die aus familiären Gründen oft in Teilzeit oder Minijobs arbeiten, zudem jüngere Beschäftigte, geringer Qualifizierte und Beschäftigte ohne deutschen Pass. Dementsprechend unterscheiden sich die Quoten in Ost- und Westdeutschland erheblich, und sie haben sich in den vergangenen Jahren noch auseinanderentwickelt: In den ostdeutschen Bundesländern liegt der Anteil atypisch Beschäftigter nach den aktuellen Zahlen überall unter 18 Prozent, in Brandenburg sogar unter 15 Prozent. Im Westen reicht sie von knapp 18 Prozent in Hamburg bis 23 Prozent und mehr in Baden-Württemberg, Rheinland-Pfalz, dem Saarland und Bremen. Das zeigt eine neue Auswertung des Wirtschafts- und Sozialwissenschaftlichen Instituts (WSI) der Hans-Böckler-Stiftung.

Teilzeit, Befristung und Leiharbeit waren von Anfang der 1990er-Jahre bis zur Finanzkrise auf dem Vormarsch. Seit 2010 ist der Anteil dieser atypischen Arbeitsverhältnisse an der sogenannten Kernerwerbstätigkeit – darin sind etwa Auszubildende, Schüler, Studierende oder jobbende Rentner nicht enthalten – wieder ein wenig gesunken und verharrte zuletzt bei rund 21 Prozent. 1991 waren es erst knapp 13 Prozent, auf dem Höhepunkt 2007 22,6 Prozent, geht aus der neuen WSI-Analyse hervor. Bei ihrer Untersuchung stützen sich Dr. Eric Seils und Dr. Helge Baumann auf Sonderauswertungen des Statistischen Bundesamtes. Auf dieser Basis haben die Forscher detaillierte Werte für 2017 berechnet – dem aktuellsten Jahr, für das derzeit Daten vorliegen.

Die WSI-Studie zeigt: Atypische Beschäftigung verteilt sich keineswegs gleichmäßig auf Bevölkerungsgruppen und Regionen. Zwei Drittel des Zuwachses seit der Wiedervereinigung geht auf die Ausweitung der Teilzeitbeschäftigung unter Frauen in Westdeutschland zurück. Dementsprechend sind bundesweit 30,5 Prozent aller kernerwerbstätigen Frauen atypisch beschäftigt, wobei Minijobs und Teilzeitarbeit dominieren. Unter den Männern haben 12,2 Prozent einen atypischen Job. Bei ihnen spielen Leiharbeit und befristete Beschäftigung eine vergleichsweise große Rolle. Das ergibt insgesamt eine durchschnittliche Quote von 20,8 Prozent im Jahr 2017 (siehe auch die Grafiken in der Studie; Link unten).

Schaut man auf den Durchschnitt beider Geschlechter, stecken vor allem jüngere Beschäftigte in atypischen Jobs. Unter den 15-24-Jährigen gilt dies für 30,9 Prozent. Wesentlicher Grund: Berufsanfänger erhalten häufig erst einmal nur einen befristeten Vertrag. Die Quote geht dann in der Altersgruppe zwischen 25 und 34 Jahren auf 22 Prozent zurück, sinkt danach weiter leicht, um in der Altersgruppe 55 Plus wieder etwas anzusteigen. Allerdings sind die Trends unter Männern und Frauen zeitweilig unterschiedlich: Bei weiblichen Beschäftigten steigt die Quote in der Phase der Familiengründung zwischen 35 und 44 Jahren zunächst wieder kräftig an.

Überdurchschnittlich häufig atypisch beschäftigt sind Arbeitnehmerinnen und Arbeitnehmer ohne deutschen Pass. Der Anteil reicht von 25,3 Prozent unter Ausländerinnen und Ausländern aus den „alten“ EU-15-Ländern bis zu 35,3 Prozent unter Menschen, die aus Staaten außerhalb der EU stammen. Während die Zahl atypisch Beschäftigter ohne deutsche Staatsangehörigkeit in den vergangenen Jahre um knapp 500.000 zugenommen hat, ging sie unter deutschen Frauen (-447.000) und Männern (-183.000) um insgesamt 630.000 zurück.

Auch der Bildungs- und Berufsabschluss beeinflusst die Wahrscheinlichkeit, atypisch beschäftigt zu sein. Während 36,6 Prozent der Arbeitnehmerinnen und Arbeitnehmer ohne anerkannte Berufsausbildung befristet, in Teilzeit oder Leiharbeit tätig sind, liegt die Quote bei Beschäftigten mit abgeschlossener Lehre oder Berufsfachschule bei 20,7 Prozent. Am niedrigsten ist sie unter Menschen mit Hochschulabschluss: 14,3 Prozent.

Regional steht das Bundesland Bremen mit gut 26 Prozent atypischer Beschäftigung an der Spitze. Es folgen das Saarland, Rheinland-Pfalz, Baden-Württemberg und Nordrhein-Westfalen mit Quoten zwischen knapp 23 und 24 Prozent. Niedersachsen und Hessen verzeichnen Anteile von rund 22 Prozent, Bayern knapp 20 Prozent. Interessant: Sowohl in Bremen als auch in Bayern geben männliche Beschäftigte den Ausschlag: Ihre Quote atypischer Beschäftigung ist in dem norddeutschen Stadtstaat weit überdurchschnittlich (20,4 Prozent), während sie im Freistaat bei lediglich knapp neun Prozent liegt.

Generell deutlich niedriger sind die Quoten in Ostdeutschland, wo Frauen seit langem weitaus häufiger in Vollzeit arbeiten und die öffentliche Kinderbetreuung stärker ausgebaut ist. Den bundesweit niedrigsten Wert weist Brandenburg mit 14 Prozent auf. Zudem ist die atypische Beschäftigung zuletzt im Osten spürbar gesunken, während sich im Westen nur wenig verändert hat. Daher ist die Differenz zwischen ostdeutschen (durchschnittliche Quote 16,3 Prozent 2017) und westdeutschen (21,8 Prozent) Bundesländern mit aktuell 5,5 Prozentpunkten deutlich größer als Mitte der 1990er (gut 1 Prozentpunkt) oder 2000er (rund 3,5 Prozentpunkte) Jahre.

Dass die atypische Beschäftigung im gesamtdeutschen Durchschnitt in den letzten Jahren zumindest leicht zurückgegangen ist, führen die WSI-Wissenschaftler auf die vergleichsweise gute Konjunktur zurück, die wieder vermehrt Normalarbeitsverhältnisse entstehen ließ. Zudem gehen Frauen in jüngster Zeit etwas seltener Teilzeitbeschäftigungen mit sehr geringer Stundenzahl nach. Dennoch betonen Seils und Baumann, dass das aktuelle Niveau der atypischen Beschäftigung weiterhin hoch sei. Daher raten sie, „den Trend zu längeren Arbeitszeiten teilzeitbeschäftigter Frauen durch politische Maßnahmen zu flankieren“ Ein weiterer Ausbau der Kinderbetreuung sei ein Baustein dazu. Wenn mehr Frauen ihre Arbeitszeit ausweiteten, vergrößere das zum einen ihre wirtschaftliche Unabhängigkeit, auch im Rentenalter. Zum anderen ließe sich damit auch die prognostizierte Verknappung von Arbeitskräften dämpfen.

Quelle: Hans Boeckler Stiftung
https://www.gewerkschaftsforum-do.de 

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————

Grafikquelle       :          Ver.di-Senioren 1. Mai 2015 Hamburg

Abgelegt unter Arbeitspolitik, Gewerkschaften, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Träumen ist Arbeit

Erstellt von DL-Redaktion am 17. Juli 2019

Sterbende Dörfer,  die Krise des Kapitalismus,

FR-43-Pradelles08.JPG

Ein Schlagloch von Georg Diez

Sterbende Dörfer, Klimawandel, die Krise des Kapitalismus, die Proteste der Gilets jaunes – die existenziellen Fragen unserer Zeit hängen zusammen.

Ich sah den Turm der Kathedrale beim Abstieg durch die bewaldeten Hügel rings um Pra­delles, eine braune Spitze, die aus dem Nest brauner Steine herausragte, eines der schönsten Dörfer des Landes, wie es offiziell heißt, ein Cevennendorf mit viel Vergangenheit, aber wenig Zukunft, wie sich herausstellte.

Was braucht es, dachte ich, als ich auf das Dorf zulief, um so eine gemeinsame Anstrengung zu unternehmen, solche eine Kirche zu bauen, über viele Jahrzehnte hinweg? Was braucht es, um eine gemeinsame Geschichte zu schaffen, die so lange hält, die den Einzelnen übersteigt und die Gemeinschaft, das Städtchen, das Dorf trägt? Heute hängt an jedem zweiten oder dritten Haus ein Schild aus schmutzigem Papier, À Vendre, zu verkaufen.

Pradelles stirbt, es stirbt langsam und vor aller Augen, es stirbt an einer Zeit, die sich radikal verändert hat, keine Krankenversorgung, kein Zug oder Bus, kaum Läden, die Schule wird wohl bald schließen, weil es nicht genug Kinder gibt; es ist der Teufelskreis von Dörfern in ganz Frankreich, in ganz Europa, ein politisches Problem, wie nicht nur die Proteste der Gilets jaunes gezeigt haben, weil die Legitimation des demokratischen Systems in Frage steht, wenn es einfach nicht mehr funktioniert für die Menschen.

Die Spaltung von Stadt und Land ist mehr und mehr eine politische Herausforderung für viele westliche Staaten, und das hat damit zu tun, dass die Voraussetzungen fehlen, die ein Leben auf dem Land möglich machen. Es hat aber auch damit zu tun, dass überhaupt die Vorstellung fehlt, was ein anderes, ein neues, ein inklusives, transformatorisches, alternatives Leben auf dem Land sein könnte.

Ein Dorf wie Pradelles stirbt, anders gesagt, auch deshalb, weil den Menschen hier eine Idee fehlt, so etwas wie ein Traum, wie aus dem Vorhandenen etwas Neues entstehen könnte. Der Schriftsteller Robert Louis Stevenson, der hier vor 140 Jahren vorbeikam und dessen Pfad ich für eine gute Woche folgte, beschreibt das Pra­delles seiner Zeit als eingebettet in eine „feine, belebte, atmende, rustikale Landschaft“; heute sieht man niemanden, nicht auf den Feldern, aber auch kaum in dem Dorf, das sich wie in sich selbst zurückgezogen hat, wie in Trauer.

Conques,Pradelles... (oct.et nov. 2012) 161.JPG

Es ist die Abwesenheit eines Traums, glaube ich, die mit zu dieser Traurigkeit beiträgt; und der Mann, der mir im Dorf mit einem Packen Zettel entgegenkam, schien den gleichen Gedanken zu haben. Eine Freundin von ihm, sagte er, sei vor einer Weile wieder hierhergezogen, das Dorf, aus dem sie stammt, und sie habe kaum glauben können, wie leer, schwach und ohne Energie es sei – deshalb wollten sie einen Workshop veranstalten, an dem die Einwohner von Pradelles gemeinsam träumen sollen und die Gesellschaft dieses kleinen Dorfes neu erschaffen.

Ich musste bei dem Wort Traum an einen Artikel des britischen Politikers Ed Miliband im Guardian denken, in dem er beschrieb, warum bei der Klimakatastrophe Albtraumszenarien nicht weiterhelfen und es notwendig ist, „Träume zu malen“. Er greift dabei den Green New Deal auf, den die junge amerikanische Kongressabgeordnete Alexandria Ocasio-Cortez bekannt gemacht hat – eine umfassende Umwandlung der Gesellschaft, die ökologische und sozialen Herausforderungen gemeinsam angeht, Artensterben und Ungerechtigkeit, Extremwetter und extremer Reichtum, eine staatliche Großanstrengung, vergleichbar mit einer Mobilisierung im Kriegsfall, aber das ist auch die Dringlichkeit dieses Augenblicks.

Quelle         :       TAZ          >>>>>         weiterlesen

———————————————————————–

Grafikquellen         :

Oben      —         Pradelles, view toward south-east (Naussac Lake and southern end of the Margeride Mtn.)

Unten      —      Le poilu de Pradelles # Haute-Loire (43) .

Abgelegt unter Europa, Kommunalpolitik, Kultur, Umwelt | Keine Kommentare »

Polizist auf Lebenszeit

Erstellt von DL-Redaktion am 17. Juli 2019

talk of the town aus NRW

Police in front of a motorway junction at Ende Gelände 28-10-2018 01.jpg

Von Daniel Kretschmar

Ausscheidende Polizeibeamte bekommen in NRW künftig einen sogenannten Ruhestands-ausweis. Nur ein Symbol? Ja, aber kein gutes für die demokratische Gesellschaft.

Wie in jedem anderen Beruf, so endet auch für Polizeibeamte der Dienst bei Erreichen des Pensionsalters. Abgabe von Waffe, Uniform und Dienstausweis, ein Händedruck, das war’s. Eben noch mit Sonderrechten ausgestattete Repräsentant*in des staatlichen Gewaltmonopols gewesen und plötzlich auf dem Altenteil. Vom Ort der Autorität hinabgeworfen in die Sphären des Gewöhnlichen, den Alltag der Untertanen, sind sie des Sinns, der Macht und ihrer Insignien beraubt. Zeit, ade zu sagen oder genauer: a. D. Keine Platzverweise mehr für jugendliche Randalierer, keine jovialen Fahrradkontrollen, keine Festnahmen und Dienstbesprechungen, sondern nur noch eine tiefe emotionale Leere.

Diesen bedrückenden Moment erträglicher zu machen hat sich nun das Land Nordrhein-Westfalen auf die Fahnen geschrieben. Seit dieser Woche erhalten ausscheidende Beamte einen sogenannten Ruhestandsausweis. Die Idee ist nicht neu, die Bundespolizei praktiziert das bereits seit 2015, im Saarland wurde der Ausweis 2006 eingeführt. NRW-Innenminister Herbert Reul erklärt den Sinn des Dokuments als „Ausdruck einer Haltung: Einmal Polizei, immer Polizei“. Besondere Rechte sind mit dem Papier nicht verbunden, es solle jedoch die Kontaktaufnahme mit Polizeidienststellen erleichtern. Man darf wohl annehmen, dass Ex-Beamte sich auch bisher schon zu erkennen geben, wenn sie mit den Aktiven zu tun bekommen, aber o. k., ein amtlich gestempelter Berechtigungsnachweis ist den Deutschen eben heilig.

Reul erläutert den größeren Zusammenhang: „Der Ruhestandsausweis verkörpert eine besondere Form des Treueverhältnisses – ein Treueverhältnis, das in keinem Gesetz steht. Ein Treueverhältnis nicht im juristischen Sinne, sondern in Gestalt eines starken Zusammengehörigkeitsgefühls.“ Ach ja, die „Polizeifamilie“, jetzt auch mit Clubausweis, und zwar lebenslänglich.

Herbert Reul DS7 2796 PK groß.jpg

Materiell tut Herbert Reul ja ohnehin alles, was er kann, um seine Treue gegenüber der Polizei zu beweisen. Erinnert sei an die Abschaffung der Kennzeichnungspflicht für die Beamten in NRW. Dieses wichtige Instrument öffentlicher Kontrolle der Polizeiarbeit schien Reul „sachlich nicht begründet“. Dagegen ließe sich der Ruhestandsausweis vielleicht als Petitesse verbuchen, als alberne Sentimentalität. Der Ausweis ist aber nicht nur ein kostengünstiges Zeichen der Wertschätzung für frühere Staatsbedienstete, sondern scheckkartengroßes Symbol für ein sehr viel größeren und nicht ganz ungefährlichen Phänomens. Jenes „Treueverhältnis, das in keinem Gesetz steht“, das der Innenminister da beschwört, statt es einer kritischen Überprüfung zu unterwerfen, wird angelegentlich etwas prosaischer schlicht Korpsgeist genannt.

Quelle       :          TAZ       >>>>>          weiterlesen

—————————————————————–

Grafikquellen      :

Oben     —          Die Polizei vor einer Auffahrt auf eine Autobahn bei einer Ende Gelände Demonstration.

——————————-

Unten        —      Herbert Reul am Freiherr vom Stein-Gymnasium Leverkusen anlässlich des Europatages 2015

Abgelegt unter Nordrhein-Westfalen, P.CDU / CSU, Regierung, Überregional | Keine Kommentare »

Aufruf Journalisten-Verband

Erstellt von DL-Redaktion am 14. Juli 2019

Der Polizei weniger nachplappern

Police in front of a motorway junction at Ende Gelände 28-10-2018 03.jpg

Das Volk bezahlt die Macht – welche sich aber vor dem Mächtigeren verbeugt !

Von Michael Kees

Redaktionen nutzen regelmäßig Informationen der Polizei, ohne sie zu überprüfen. Wegen der Berichterstattung über Ende Gelände gibt es daran Kritik.

Bei Straftaten oder Gefahrenlagen sind Jour­na­lis­t*innen häufig auf Angaben der Polizei angewiesen. Oft behandeln Redaktionen deren Infos als sogenannte privilegierte Quelle – das heißt, dass die Angaben keiner zweiten Prüfung unterzogen werden. Das kritisiert jetzt aber der Deutsche Journalisten-Verband (DJV). Der Verband hat dazu aufgerufen, „Meldungen und Informationen der Polizeibehörden in allen Fällen kritisch zu hinterfragen“.

Ein Aufruf, der Gewicht hat, denn der DJV ist mit rund 33.000 Mitgliedern die größte Interessenvertretung für Journa­list*innen in Deutschland. Die Frage, wie Redaktionen mit Polizeimeldungen umgehen sollen, ist dabei keine neue. Immer wieder gibt es Kritik an einseitigen oder falschen Informationen der Polizei und an den Medien, die diese Informationen ungeprüft verbreiten.

Anlass für die Stellungnahme des DJV sind Berichte über die Ende-Gelände-Proteste im Juni. Die Polizei Aachen sprach nach dem Demowochenende von 16 Polizist*innen, die verletzt worden seien. Der DJV kritisiert, dass einige Medien diese Meldung einfach übernommen hätten. Denn die Polizei machte lange keine Angaben dazu, wie sich die Einsatzkräfte überhaupt verletzt hatten.

Auf Nachfrage eines WDR-Journalisten stellte sich heraus, dass von vier Polizist*innen, die ihren Dienst beenden mussten, nur zwei durch „Fremdeinwirkung“ verletzt wurden. Auf der anderen Seite beklagte das Bündnis Ende Gelände ein übermäßig hartes Vorgehen der ­Polizei. An sich war die Verletztenzahl der Polizei Aachen richtig, aber sie zeichnete ein unvollständiges Bild. Wie neutral kann die Polizei sein, wenn sie sich selbst gegen Vorwürfe verteidigen muss?

Stopped Ende Gelände Demonstration 27-10-2018 05.jpg

„Es war einmal“. Gab es nicht Zeiten da „alle Macht vom Volk“ ausging ? Das war aber bevor die Wirtschaft das Sagen in die Händen gelegt bekam. Also vor Merkel-Kohl-Schröder-Hitler? Heute lässt nur noch ein schlechtes Gewissen die Welt erzittern?

„Die Polizei ist ausnahmslos der Wahrheit verpflichtet“, sagt Victor Ocansey, Pressesprecher des Landesamts für Ausbildung, Fortbildung und Personalangelegenheiten der Polizei Nordrhein-Westfalen. Ocansey weist darauf hin, dass es Ziel der Polizei sei, gründlich und möglichst schnell zu informieren – auch „einsatzbegleitend“. Noch während ein Einsatz läuft, würden oft Presseanfragen gestellt und Falschmeldungen verbreitet, die man korrigieren müsse.

Aufgabe der Medien ist die Kontrolle der Polizei

Quelle          :         TAZ          >>>>>          weiterlesen

————————————————————————

Grafikquellen       :

Oben        —         Die Polizei vor einer Auffahrt auf eine Autobahn bei einer Ende Gelände Demonstration.

Abgelegt unter Kultur, Medien, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Der Kampf geht weiter…

Erstellt von DL-Redaktion am 12. Juli 2019

Pilotabschluss im Einzelhandel NRW

Datei:Obst-supermarkt.jpg

Quelle      :         Scharf  –  Links

Von Herbert Schedlbauer

Der im Einzelhandel seit zwei Monaten geführte Arbeitskampf in Nordrhein-Westfalen ist beendet. Überraschend schnell einigte man sich in der vierten Tarifrunde. Erneut vereinbarte die Dienstleistungsgewerkschaft ver.di mit dem Handelsverband NRW eine zweijährige Laufzeit. Die Allgemeinverbindlichkeit der Entgelttarifverträge (AVE) wurde von der Kapitalseite vom Tisch gefegt.

Löhne und Gehälter steigen für die Beschäftigten, die bis zur Gehaltsgruppe der Verkäuferin im letzten Berufsjahr (2579,- Euro in Vollzeit) eingruppiert sind, um 3 Prozent. Für alle Beschäftigten in höheren Entgeltgruppen gibt es einen Festbetrag von 77,50 Euro brutto. Ab 1. Mai 2020 kommen weitere 1,8 Prozent dazu. Ausbildungsvergütungen werden zwischen 45 Euro und 60 Euro und in 2020 von 50 Euro und 80 Euro jeweils zu Beginn der Ausbildungsjahre erhöht. Der jetzige Abschluss muss noch von der großen Tarifkommission bestätigt werden. Gefordert hatte ver.di 6,5 Prozent mehr für alle, mindestens 163,- Euro und 100,- Euro mehr für Azubis! Eine Laufzeit von zwölf Monaten.

Im jetzigen Ausstand zeigte sich, wie geschlossen der Handelsverband gegen ver.di und die dort organisierten Belegschaften vorging. Bereits seit dem Jahr 2000 versuchen die Waren- und SB-Häuser sowie alle Discounter sich von Flächentarifen zu verabschieden. Mal ist es Karstadt, mal Real oder Kaufhof, in diesem Jahr war es Rewe und Edeka. Sie alle werden in den nächsten zwei Jahren bei dem Versuch einer Tarifflucht in Haustarifverträge nicht lockerlassen. Befürchtet werden muss auch, dass bei einer zukünftigen AVE neue Tätigkeitsmerkmale für Verkaufs- und Warenauffüllkräfte vereinbart werden.

Die Warenhauskonzerne führen von oben einen unerbittlichen Klassenkampf. Die vor zwanzig Jahren begonnene Tarifflucht ist mit die Ursache für die existierenden Armutslöhne und eine massive Arbeitsplatzvernichtung. Ver.di führt dagegen einen nicht widerspruchsfreien Kampf. Einerseits ist das Ziel, neben mehr Lohn und Gehalt, zum Flächentarifvertrag zurück zu kommen, richtig und notwendig. Denn würde eine Allgemeinverbindlichkeit wieder erreicht, müssten auch Online Versandhändler höhere Löhne zahlen. Amazon entlohnt bis jetzt nach Logistiktarif. Der liegt noch unter dem Flächentarif des Einzel- und Versandhandels. Von einer AVE würden rund drei Millionen Beschäftigten im Einzelhandel bundesweit profitieren.

Anderseits zeigt sich eine zunehmende Kritik in einigen Tarifkommissionen. Dort und in anderen Gremien wird unter ehrenamtlichen Funktionären diskutiert, ob und wie weit überhaupt eine Steigerung der Reallöhne und eine Laufzeit von 12 Monaten, nur mit Warnstreiks, durchsetzbar ist. Auch die fehlende Einsicht der Gewerkschaft, die Tarifkämpfe fachbereichsübergreifend zu organisieren, spielt dabei eine Rolle. Mehrere Anträge werden sich deshalb auf dem ver.di Bundeskongress im Herbst in Leipzig damit beschäftigen. Inhalt ist dabei die gemeinsame Solidarität und Mobilisierung über die Fachbereiche hinaus bei Streiks.

Das wird auch dringend notwendig. Denn mit dem einheitlichen Auftreten der Unternehmer haben diese beim jetzigen Abschluss in NRW durchgesetzt, dass in Sachen Flächentarif für die nächsten 24 Monate Ruhe herrscht. Der ver.di Illusion, die Tarifflucht über die Politik per Gesetz zu verbieten, können die Einzelhändler in Ruhe entgegensehen. Die Lobbyarbeit der Kapitalisten in diesem Staat hat dank Bundesregierung noch immer bestens funktioniert.

Wollen ver.di und die anderen DGB-Gewerkschaften dem etwas entgegensetzen, werden sie sich wieder in Richtung Klassenorganisationen der Arbeiter und Angestellten bewegen müssen. Bleibt es bei der Sozialpartnerschaft, bedeutet dies eine weitere Lähmung im Kampf um mehr Lohn und bessere Arbeitsbedingungen. Tarifkämpfe auf gleicher Augenhöhe, wenn es die in der Geschichte der Bundesrepublik jemals gegeben haben sollte, kann es aufgrund der ökonomischen Abhängigkeit der Beschäftigten nicht geben.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————-

Grafikquelle      :         Bilder im Supermarkt

Urheber Ralf Roletschek (User:Marcela)
Genehmigung
(Weiternutzung dieser Datei)
Own work, attribution required (Multi-license with GFDL and Creative Commons CC-BY 2.5)

Abgelegt unter Gewerkschaften, Nordrhein-Westfalen, Positionen, Überregional | Keine Kommentare »

Polizeigewalt-Ende Geländer

Erstellt von DL-Redaktion am 11. Juli 2019

„Natürlich kommt es zu Fehlern“

Ende Gelände crossing wall infront of motorway 06.jpg

Bekommen die Schlägertruppen des Staates ihren Strom Frei Haus ?

Von Anett Sell, Köln

Felix K. sagt, ein Polizist habe ihm bei den Protesten von Ende Gelände den Schädel gebrochen. Die Aachener Polizei erklärt, jede Anzeige werde geprüft.

 „Letzte Woche war ich dreimal im Krankenhaus. Erst haben sie gesagt, der Bruch müsse operiert werden: Augenlid aufschneiden und den Bruch schienen. Jetzt meinten sie, die OP sei zu gefährlich und der Bruch heile vielleicht von selbst. Wegen des Auges soll ich in drei Wochen noch mal kommen. Der Zahnarzt meinte, es könnte sein, dass meine oberen Schneidezähne absterben. Die reagieren zurzeit verzögert auf Kälte – aber das könne auch an der Schwellung liegen.“

Felix K. ist 35 Jahre alt und hat einen Schädelbasisbruch. Die Verletzung habe ihm ein Polizist zugefügt, als er am 22. Juni an einer Aktion von Ende Gelände im Rheinischen Braunkohlere­vier teilnahm, sagt K. Rund 6.000 Kli­ma­aktivist*innen hatten damals nach Angaben von Ende Gelände den Tagebau Garzweiler und die Bahnschienen zu zwei Braunkohlekraftwerken besetzt. Die Polizei Aachen erklärt, sie habe Tausende Beamt*innen im Einsatz gehabt. Einer von ihnen, sagt K., habe ihm den Schädel gebrochen.

„Ich hatte den Zeitpunkt verpasst, um in den Tagebau zu kommen, und war auf dem Rückweg. Zu den Polizisten hab ich gesagt, ‚Ich geh jetzt, ich geh jetzt‘“, berichtet K. der taz. „Die waren aber nicht offen für Kommunikation.“ Einer habe ihn in Disteln geschubst und, als er einen Weg heraus gesucht habe, „den gepanzerten Polizeihandschuh in die Schläfe gedroschen“.

Laut Ende Gelände hat die Polizei fünf Menschen so verletzt, dass sie ins Krankenhaus kamen. K. war einer davon. Die Polizei gibt insgesamt 16 Poli­zis­t*innen an, die verletzt wurden oder sich selbst verletzten – etwa durch Umknicken oder Stürze. Die Beeinträchtigungen seien überwiegend so leicht gewesen, dass die Betroffenen ihre Arbeit fortsetzen konnten. In vier Fällen sei vermerkt worden, dass die Verletzung im Zusammenhang mit einer Widerstandshandlung aufgetreten sei.

Ende Gelände wirft der Polizei vor, „Menschen grundlos verprügelt“ zu haben. Eine Sprecherin der Polizei Aachen sagt der taz: „Die Polizei hat in unserem Rechtsstaat die gesetzliche Legitimation zur Ausübung von Zwang und damit auch Gewalt, um polizeiliche Maßnahmen durchzusetzen.“ Die rechtlichen Voraussetzungen müssten natürlich vorliegen. „Die Polizei ist gesetzlich dazu verpflichtet, falls ein Fehlverhalten von Beamtinnen oder Beamten festzustellen ist, die entsprechenden Konsequenzen folgen zu lassen.“

„Das generelle Gewaltverbot gilt auch für die Polizei“

Police in front of a motorway junction at Ende Gelände 28-10-2018 01.jpg

Als ich noch an der Hand meines Vaters ging stellte er mir den Ordnungshüter in unserer Straße vor. Da sprach die Gesellschaft noch von Polizisten und Wachmänner als Respektspersonen. Heute werden sie abfällig Bullen genannt. Ob dieses wohl einzig ihrer Hörigkeit gegenüber korrupten PolitikerInnen geschuldet ist?

Welche Konsequenzen das in der Regel sind, damit beschäftigt sich Tobias Singelnstein. Der Professor für Kriminologie an der Ruhr-Universität Bochum sowie Strafrechtler führt aktuell eine der größten Studien zu Körperverletzung im Amt, sogenannter Polizeigewalt, durch, die es in Deutschland bislang gegeben hat. Sein Team sei in kontinuierlichem Austausch mit allen Ebenen der Polizei, mit führenden Beamten wie mit Polizist*innen in Einsatzhundertschaften: „Beamte kommen auf uns zu und berichten ihre Erfahrungen, auch Beamte, die selber zu Tätern geworden sind.“

Aus den Statistiken der Staatsanwaltschaften geht hervor, dass jährlich 2.100 bis 2.500 Verfahren gegen Polizist*innen angestrengt werden, denen rechtswidrige Gewaltanwendung vorgeworfen wird. 2017 – das sind die aktuellsten Zahlen – lag die Anklagequote unter zwei Prozent. Der Anteil an Verfahren, die eingestellt würden, sei „praktisch nirgendwo so hoch wie in diesem Bereich“, sagt Singelnstein.

Quelle        :        TAZ       >>>>>        weiterlesen

Ministerin über Ende Gelände

Populismus statt Politik

Sie hat die Haare schön und trat schon mit 15 Jahren in die CDU ein, da sie die „Birne“ verehrte

Ein Kommentar von Malte4 Kreutzfeldt

Bei Protesten gegen Braunkohle-Abbau sind Klimaschützer über zwei Felder gelaufen. Julia Klöck­ner hat sich nun empört darüber geäußert.

Hurra! Endlich nimmt CDU-Landwirtschaftsministerin Julia Klöck­ner die Sorgen der Bauern im Rheinland ernst und spricht sich mit klaren Worten gegen die landwirtschaftlichen Schäden durch Klimawandel und Tagebaue aus …

Ach nein, sorry: gegen die landwirtschaftlichen Schäden durch Gegner von Klimawandel und Tagebauen. Denn die haben etwas Skandalöses getan: Bei ihren Protesten gegen die Klima- und Landschaftszerstörung, die mit dem Abbau der Braunkohle einhergeht, sind sie doch tatsächlich über ein Petersilien- und ein Karottenfeld gelaufen. Landwirtschaftliche Ressourcen zu zerstören sei ein „elitäres, ignorantes Verhalten“, zürnte Klöckner in einer Pressemitteilung und bescheinigte den Klimaaktivisten ein „Glaubwürdigkeitsproblem“.

Quelle     :         TAZ        >>>>>        weiterlesen

——————————————————————-

Grafikquelle        :

Oben     —        Ende Gelände Aktivisten überqueren einen Wall vor einer Autobahn um auf die dahinterliegende Hambachbahn zu kommen. Die Polizei hält einen Teil auf.

2.) von Oben    —     Die Polizei vor einer Auffahrt auf eine Autobahn bei einer Ende Gelände Demonstration.

——————————-

Unten        —       Julia KlöcknerBundestagsbüro Julia Klöckner

Picture of Julia Klöckner, Member of the German Bundestag (CDU/CSU parlamentary group)

Abgelegt unter APO, Köln, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Zurück zur sozialen Frage

Erstellt von DL-Redaktion am 8. Juli 2019

Es fehlt die positive Erzählung

Die Linke Grundrecht Grundeinkommen BGE Berlin 2013.jpg

Gastbeitrag von Dana Moriße und Manuel Huff  –  Mitglieder des Landesvorstandes der LINKEN in Nordrhein-Westfalen.

Anstatt die Grünen nachzuahmen, sollte die Linkspartei die Verteilungsgerechtigkeit in den Mittelpunkt rücken.

Das Ergebnis der Linkspartei bei der zurückliegenden Europawahl stellt eine Zäsur dar und sollte so etwas wie der letzte Warnschuss sein, die strategische und inhaltliche Ausrichtung grundlegend zu überdenken. Mit 5,5 Prozent erreichte Die Linke ihr historisch schlechtestes Ergebnis und konnte selbst von einer massiv gestiegenen Wahlbeteiligung von 48,1 Prozent auf 61,4 Prozent in keiner Weise profitieren. Dabei ist besonders dramatisch, dass sie bei den Erwerbstätigen kaum noch punkten kann. Von den im Bundestag vertretenen Parteien schneidet in dieser Bevölkerungsgruppe lediglich die FDP noch schlechter ab. Bei der Betrachtung dieser Zahlen wäre bei einer Partei, die ihre Existenz stets eng mit der Geschichte der Arbeiterbewegung verknüpfte, eine Schockstarre zu erwarten.

Doch stattdessen sind in weiten Teilen der Partei Analysen zu finden, die das Ergebnis relativieren, bis hin zu Aussagen des Parteivorsitzenden Bernd Riexinger, der Rechtsruck sei vorerst gestoppt. Angesichts des verbesserten Wahlergebnisses der AfD mit einer Verdopplung der absoluten Stimmen auf 4,1 Millionen Menschen ist das eine bemerkenswerte Feststellung.

Weil die Grünen bei der EU-Wahl mit 20,5 Prozent zweitstärkste Kraft in Deutschland wurden, gibt es nun zudem den Ruf innerhalb der Linkspartei, doch endlich die Ökologie als das zentrale Thema der Partei zu deklarieren. Auf diesem Feld ist jedoch wenig zu holen. Die Linke braucht sich hierbei programmatisch nicht hinter den Grünen zu verstecken. Wahlprüfsteine von BUND Jugend oder „Fridays For Future“ zur Europawahl legten sogar eher eine Wahl der Linken nahe. Doch egal, wie gut die Partei hier aufgestellt ist: Klimaschutz wird den Grünen zugeschrieben. Das soll nicht bedeuten, dass man das Thema vernachlässigen sollte, aber hier wäre das Anerkennen der Realität angebracht.

Wer jetzt den Grünen hinterherlaufen will, dem wollen wir entgegenhalten, dass es einen unausweichlichen Zusammenhang zwischen der Zerstörung der Umwelt sowie der Klimakatastrophe und dem Kapitalismus gibt. Sicherlich war Umwelt- und Klimaschutz die zentrale Frage bei der Wahlentscheidung. Doch dicht dahinter rangierten soziale Sicherheit und Friedenssicherung. Also zwei Themen, bei denen Die Linke ihre Kernkompetenzen verortet. Dennoch verliert die Partei an Zustimmung.

Kampf um das Klassenbewusstsein

Wer sich außerhalb linker Kreise bewegt, bekommt schnell mit, warum Die Linke einen schweren Stand hat. Sie wird als eine Partei wahrgenommen, die sich hauptsächlich um Partikularinteressen kümmert. Die große Mehrheit fühlt sich von der Linkspartei nicht angesprochen. Selbst von den eigenen Wählern trauen ihr nur acht Prozent zu, die Probleme lösen zu können. Der Versuch großer Teile der Partei, über Identitätspolitik möglichst viele kleine Gruppen anzusprechen, ist gescheitert. Die Idee, diversen Minderheiten zu ihren gesellschaftlichen Rechten zu verhelfen, ist menschlich nachvollziehbar und ehrenwert. In der Praxis führte sie jedoch immer zu Ausgrenzungserfahrungen eben jener Gruppen, die nicht Bestandteil in der jeweiligen Debatte sind.

UmFairteilen-Demonstration in Erfurt (8043080919).jpg

Dies sorgt dafür, dass sich ein Großteil unserer früheren Wählerklientel mittlerweile so weit von uns abgewendet hat, dass selbst eine im Kern rassistische und neoliberale Partei wie die AfD als Alternative wahrgenommen wird. Um nicht falsch verstanden zu werden: Die Linke war stets eine pluralistische Partei, die genau daraus ihre Stärke sowie Ausstrahlungskraft schöpfen konnte. Eben diese Heterogenität macht es jedoch umso notwendiger, ein verbindendes Element in den Mittelpunkt politischer sowie strategischer Ausrichtung zu stellen.

Quelle        :       Der Freitag        >>>>>         weiterlesen

——————————————————————-

Grafikquellen      :

Oben      —        More than 2.000 people rallying for a Basic Income on the BGE-Demonstration on September 14, 2013 in Berlin

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Das „Epos der Demokratie“

Erstellt von DL-Redaktion am 29. Juni 2019

Politisches Erdbeben in Istanbul

File:İmamoğluJune2019CampaignSilivri (6).jpg

Quelle      :         untergrundblätte ch.

Von Alp Kayserilioğlu / Max Zirngast revoltmag.org

Die regierende AKP und ihr Bündnispartner MHP stecken bei den erneuerten Bürgermeisterwahlen in Istanbul vom 23. Juni eine heftige Niederlage ein. Warum die klassischen Taktiken der AKP diesmal nicht zogen und wovor revolutionäre Linke auf der Hut sein müssen: Eine Analyse.

Die Neuwahl des Bürgermeisteramts von Istanbul am 23. Juni 2019 endete mit einem Erdrutschsieg für den Kandidaten der Opposition, Ekrem Imamoğlu von der Republikanischen Volkspartei (CHP). Laut vorläufigen Ergebnissen wuchs der ursprüngliche Abstand zwischen Imamoğlu und dem Regimekandidaten Binali Yıldırım von 13.000 Stimmenunterschied bei der ersten Wahl vom 31. März auf erstaunliche 806.426 Stimmen an. Während am 31. März die Auszählung der Stimmen für Imamoğlu 48,8 Prozent gegenüber 48,55 Prozent für Yıldırım ergab, ist der Unterschied nun auf 54,21 Prozent der Stimmen gegenüber 44,99 Prozent der Stimmen angewachsen.

Das Ergebnis stellt somit eine vernichtende Niederlage für das Regimelager dar. Das letzte Mal, als ein solch extremes Umschlagen des Wahlverhaltens und überhaupt der Stimmung im Lande stattfand, war bei den Parlamentswahlen vom 7. Juni 2015, bei denen die AKP erstmalig seit ihrem Bestehen eine empfindliche Niederlage einstecken musste. Dabei wurden die Neuwahlen für Istanbul gerade deshalb eingeräumt, um, so Erdoğan, eine Wiederholung eines Ereignisses ähnlich des damaligen Wahldesasters auszuschließen. Was ist diesmal schiefgelaufen aus Perspektive des Regimes?

Das politische Kalkül der Neuwahlen

Wie wir stets hervorheben, befindet sich die Türkei in einer Hegemoniekrise, in der der herrschende Block einen Faschisierungsprozess in Gang setzt, um die kriselnde soziale und politische Ordnung wieder zu stabilisieren. Dabei schaffen sie es aber nicht, gesellschaftlichen Unmut und Opposition auszutrocknen, im Gegenteil: mit jedem neuen Faschisierungsschub verschärfen sich diese. Bei solch fragilen Bedingungen können Wahlen zu einem großen Risiko für den Machtblock werden – und zwar nicht nur in Hisicht auf verändertes Wahlverhalten, sondern im Sinne eines Umschwungs der allgemeinen Stimmung. Tatsächlich wurde vom Regime ja auch die Möglichkeit „unerwünschter“ Ergebnisse bei den Lokalwahlen im März 2019 als einer der Grund dafür angegeben, die eigentlich im November 2019 stattfindenden Präsidentschafts- und Parlamentswahlen auf den Juni 2018 vorzuziehen.

Dennoch waren die Lokalwahlen vom 31. März von großer Bedeutung, da sie zugleich als eine Wahl über den politischen Kurs der Faschisierung oder, um es einmal im Regime-Jargon auszudrucken, als eine Wahl über die „Fortexistenz des Staates“ begriffen wurden. Trotz weitflächiger Repression und Drohgebärden signalisierten die Ergebnisse der Wahlen vom 31. März einen Stimmungsumschwung: Die herrschende Allianz aus der Partei für Gerechtigkeit und Aufschwung (AKP) und Partei der Nationalistischen Bewegung (MHP) unter dem Namen Cumhur Ittifakı (Volksallianz) verlor alle Großstädte an den Hauptoppositionsblock Millet Ittifakı (Allianz der Nation), bestehend aus CHP und der MHP-Abspaltung Gute Partei (IYI) – inklusive der umkämpften Hauptstadt Ankara und dem Zentrum Istanbul. Wie Wähler*innenanalysen aufzeigen konnten, waren es dabei vor allem AKP-Wähler*innen, die zu Hause blieben, sowie kurdische Wähler*innen der explizit von der Allianz der Nation ausgeschlossenen linken, pro-kurdischen Demokratischen Partei der Völker (HDP), die für Imamoğlu wählten, die das Wahlergebnis entschieden.

Noch in der Wahlnacht ließ Erdoğan in mehreren Reden durchklingen, dass er das Ergebnis eventuell anerkennen würde. Er verwies darauf, dass die gewählten Bürgermeister*innen der Opposition sowieso nicht einfach so regieren könnten, da die Volksallianz die Mehrheit in den jeweiligen Munizipalräten hielte. Jene Bürgermeister*innen seien deshalb „lahme Enten“. Andere Fraktionen innerhalb des Regimes lehnten jedoch die Wahlergebnisse in Istanbul vehement ab und sprachen von weitflächigem Betrug und dergleichen. Sie erkannten die Gefahren, die auch schon allein mit „lahmen Enten“ einhergehen würden: Die Opposition hätte dann die Möglichkeit, teils jahrzehntelange Netzwerke der Korruption, Misswirtschaft und Vetternwirtschaft und die stadtplanerischen Desaster Erdoğans beziehungsweise der AKP aufzudecken; sowie die Möglichkeit, den riesigen Apparat der Großstadtverwaltung zu nutzen, um bürgernahe Politik zu machen und sich damit mittelfristig als eine Alternative zu präsentieren. Diesen Stimmen war bewusst, dass all dies vor allem sehr schnell zu einem allgemeinen Stimmungsumschwung von deprimierter Angst hin zu kämpferischem Optimismus führen könnte.

Die AKP reichte zuerst Anträge zu einer Neuauszählung von nur einem Teil der Wahlurnen und später aller Wahlurnen in Istanbul ein. Als all dies das Ergebnis nicht wesentlich änderte, reichte sie einen außerordentlichen Antrag zu Annullierung und damit der Anberaumung von Neuwahlen für Istanbul ein. Dennoch brauchte es mehr als einen ganzen Monat, bis die Entscheidung darüber mit Beschluss der Höchsten Wahlbehörde (YSK) vom 6. Mai Realität wurde. In der Zwischenzeit war Imamoğlu schon für 18 Tage als amtierender Bürgermeister tätig gewesen. Dass das Regime nicht einmal mehr „lahme Enten“ tolerieren kann, zugleich aber mehr als einen ganzen Monat braucht, um eine Wahl zu annullieren, zeigt auf, wie inflexibel einerseits, wie unsicher andererseits ihre Macht geworden ist.

Das Interregnum

Als Erdoğan noch wenige Tage vor der Entscheidung der YSK, die Wahlen tatsächlich im Sinne von Erdoğan zu annullieren, für eine Neuwahl argumentierte, klang er noch recht optimistisch: Er verwies ganz explizit auf den 7. Juni 2015 und sagte, dass sie ja auch damals den Gang der Ereignisse umdrehen konnten. Weil die Periode nach jenem 7. Juni eine Serie an IS-Bombenattentaten, massiven Repressionen, einen rücksichtslosen Krieg in mehrheitlich kurdischen Städten und letztlich tausenden Toten mit sich brachte, gingen Kommentator*innen wie wir davon aus, dass auch diesmal die Gewaltspirale eskalieren würde.

Istanbul collage 5j.jpg

Allerdings blieb es relativ ruhig – bis auf den Versuch eines organisierten Mobs am 22. April, den CHP-Vorsitzenden Kemal Kılıçdaroğlu zu lynchen. Bis auf eine vergleichsweise begrenzte und noch fortdauernde Militäroperation in die Kandilberge im Irak kam auch die Kriegsoption nicht auf den Tisch: Obwohl das Regime seit geraumer Zeit sehr klar artikuliert, dass es auch in die restlichen Teile Nordsyriens/Rojavas einmarschieren will, die sich in der Kontrolle der PYD und der SDF befinden, kam kein grünes Licht für eine solche Invasion seitens Russlands und vor allem seitens der USA. Zu einem Alleingang traute sich die Türkei bisher nicht.

Es ist plausibel anzunehmen, dass eine Gewalt- und Repressionsspirale ähnlich der nach dem 7. Juni 2015 schlicht deshalb nicht einsetzte, weil das Regime nicht mehr die Macht dazu hatte und die Kräfteverhältnisse heute andere sind. Die multiplen Krisen haben sich seitdem verschärft: Die Beziehungen mit den USA sind stark angeschlagen, die ökonomische Krise in ihren alltäglichen Auswirkungen ist viel gravierender geworden und der Unmut auch innerhalb der AKP- und MHP-Basis ist zwischenzeitlich so weit verbreitet, dass die Entscheidung zur Wahlannullierung weitestgehend als illegitim aufgefasst wurde und öffentliche Umfragen ergaben, dass viele Volksallianz-Wähler*innen am 23. Juni anders wählen würden. Dazu kamen Gerüchte, wonach die unterschiedlichen Fraktionen innerhalb der AKP wegen des Umgangs mit den Wahlresultaten einander an die Haare gingen – wobei dieser Konflikt manchmal sogar öffentlich wahrnehmbar über die Medien ausgetragen wurde.

Unter solchen Bedingungen schaffte es das Regime nicht, die Initiative zu übernehmen und nach vorne zu preschen wie in ähnlichen Situationen der letzten Jahre. Erdoğan hielt sich überraschenderweise gleich ganz zurück aus dem Wahlkampf, angeblich, weil ihm seine Berater*innen zu verstehen gaben, sein aggressives und polarisierendes Auftreten habe negative Auswirkungen gehabt. Mit hoher Wahrscheinlichkeit wollte er sich und seine Partei dadurch auch von Yıldırıms Anwärterschaft auf das Bürgermeisteramt distanzieren, um so der Wahlwiederholung einerseits einen Anstrich der „Normalität“ zu geben und andererseits sich und seine Partei vor Schaden zu schützen für den Fall, dass Yıldırım nicht gewinnen würde.

Die AKP schaffte es somit nicht, die Wahlkampagne so zu führen, wie sie es aus den Jahren zuvor gewohnt war. Sie konnte die Initiative nicht ergreifen und machte einen schwachen und verwirrten Eindruck. Die Opposition nutzte die Situation aus und konnte das Narrativ glaubwürdig vertreten, dass ihr das Bürgermeisteramt illegitimerweise genommen wurde. Die letzten Versuche der AKP, den Trend umzukehren – alle Wahlforschungsinstitute kamen zum Ergebnis, dass Yıldırım verlieren würde – waren verzweifelt und halbgar: Zum einen wurde seitens der AKP zum ersten Mal nach 17 Jahren an der Macht ein TV-Duell zwischen dem eigenen Kandidaten und dem Oppositionskandidaten zugelassen. Während das Duell dazu dienen sollte, den „Normalitäts“-Anstrich zu stärken und in Teilen die AKP als „Opfer“ böser Machenschaften darzustellen, ging diese Rechnung nicht auf. Wenige Tage vor den Wahlen kehrte Erdoğan zudem doch wieder zurück auf die Bühne, in gewohnter extrem aggressiver Manier gegenüber der Opposition.

In letzter Minute wurde dann noch der verzweifelte Versuch gemacht, die „kurdische Karte“ auszuspielen: Eine leicht mehrdeutige Botschaft des inhaftierten kurdischen Führers Abdullah Öcalan an die HDP, in der er dieser empfahl, sich auf den Aufbau eines eigenständigen demokratischen Poles zu konzentrieren und „unparteiisch“ zu bleiben, wurde von der regimetreuen Presse als Aufruf Öcalans an die Kurd*innen lanciert, Imamoğlu nicht zu wählen. Erdoğan und Bahçeli meinten sogar, einen „Machtkampf“ zwischen Öcalan und dem Rest der kurdischen Bewegung ausmachen zu können. Als klar wurde, dass sich Öcalans Botschaft hauptsächlich auf strategische Perspektiven konzentrierte und er explizit deutlich machte, dass die HDP selber entscheiden müsse, welche Haltung sie zu den Wahlen einnimmt, gerieten die Regimekräfte in Panik. Alle diese letzten Aktionen nutzten im Endeffekt nichts.

Der Wind dreht sich

Der frische Wind des Wandels, der sich in den Ergebnissen vom 31. März ausdrückte, braute sich am 23. Juni zu einem gewaltigen Sturm zusammen, der das Regime kräftig durchschüttelte. Es bedarf noch detaillierterer und ausführlicherer Untersuchungen zum Wähler*innenverhalten und zur Wähler*innenstromanalyse, aber einige Aspekte können jetzt schon hervorgehoben werden: Imamoğlu erhöhte seinen Stimmenanteil in de facto allen Bezirken um zwischen drei und zehn Prozent. Das zeigt, dass die Abwendung von der AKP mehr oder weniger alle Wähler*innenschichten umfasst, da auch die Wahlbeteiligung nur geringfügig gestiegen war. Imamoğlu gewann letztlich 28 der 39 Bezirke in Istanbul, Yıldırım nur 11.

Am 23. März war Yıldırım noch in 23 Bezirken vorne gelegen und İmamoğlu nur in 16! Der Anstieg der Stimmen in CHP-Hochburgen wie Beşiktaş, Kadıköy oder Şişli liegt sicherlich an der höheren Wahlbeteiligung in diesen Bezirken, was darauf schließen lässt, dass desillusionierte Wähler*innen mobilisiert werden konnten; der Anstieg in konservativ-religiösen Bezirken wie Fatih, Üsküdar oder Eyüpsultan deutet jedoch auf eine massive Abwendung der Basis von der AKP hin. Eine Mikroanalyse einer Hand voll Wahllokale in einigen Vierteln von Fatih, in denen islamische Gemeinschaften dominieren, die der AKP treu verbunden sind, zeigt, dass Imamoğlu selbst dort Stimmen zulegen konnte. Andererseits zeigt der Stimmenzuwachs in Bezirken mit einem großen kurdischen Bevölkerungsanteil, dass die Kurd*innen bei dieser Wahl vielleicht sogar noch resoluter für Imamoğlu gestimmt haben.

Das „Epos der Demokratie“

Anders als die meisten Wahlen in den letzten Jahren war die Wahlwiederholung in Istanbul rasch zu Ende – und zwar ohne wesentliche Zwischenfälle. Während an vielen Orten noch Stimmen gezählt wurden, trat Binali Yıldırım mit der Aufhebung des Verbots, über die Wahlergebnisse zu berichten, vor die Mikrofone und erklärte knapp und kühl, Imamoğlu habe die Wahl gewonnen und er gratuliere diesem dafür. Bahçeli und Erdoğan taten es ihm bald darauf mit kurzen Twitter- Statements gleich. Diese ersten kurzen Statements mögen noch nicht den wirklichen Zugang Erdoğans zu dieser Niederlage reflektieren und es ist durchaus möglich, dass er bald noch andere Töne anschlagen wird.

Er insinuierte unlängst, dass Imamoğlu die Bürgermeisterschaft wieder aberkannt werden könnte, da dieser angeblich den Gouverneur der Schwarzmeerprovinz Ordu beleidigt habe. Vermutlich aber wird er wieder auf die Linie nach dem 31. März einschwenken und die Oppositionsbürgermeister als „lahme Enten“ abkanzeln: Schon in den letzten Tagen vor der Wahl sprach er wieder davon, dass die Wahl bloß „symbolisch“ sei und Imamoğlu als Bürgermeister bloßer „Vitrinenschmuck“ wäre. Höchstwahrscheinlich wird Erdoğan versuchen, die Spielräume der oppositionellen Bürgermeister durch die vom Regime dominierten Stadträte einzuschränken und eventuell Gesetze zu entwerfen, die sowohl diese Räte wie auch seine Präsidentschaft in Hinblick auf die Verwaltung von Städten stärken werden.

Allerdings ist die Ausgangslage eine ganz andere als noch nach dem 31. März. Nach dem Wahldebakel ist Erdoğans Stellung geschwächt, er hat signifikant an Charisma eingebüßt und seine Gegner*innen und vermeintlichen Verbündeten sind in Lauerstellung, um sich noch mehr Macht zu holen. Das Auseinanderbröckeln der AKP dürfte sich jetzt ebenfalls rasch beschleunigen – die Gründung einer oder sogar mehrer Parteien von AKP-Abtrünnigen scheint bereits eine beschlossene Sache und nur mehr eine Frage der Zeit zu sein.

Dagegen gilt Imamoğlu als der große Hoffnungsträger im Kampf gegen Erdoğan. Seine versöhnlerische, inklusive politische Rhetorik stellte sich bei den Lokalwahlen als Erfolgsfaktor heraus. In seiner Siegesrede wandte er sich auch betont an Erdoğan und erklärte seine Bereitschaft, enge Verbindungen und Zusammenarbeit zwischen lokalen und zentralen Verwaltungsinstitutionen zu schaffen, um Lösungen für die drängenden Probleme Istanbuls und des Landes zu finden. Er drohte aber auch, dass er sich an die Bevölkerung wenden würde, wenn er mit „politischen Initiativen zur Beschränkung“ seiner Bürgermeisterschaft konfrontiert wäre. Alle Parteien außer der HDP, darüber hinaus auch die meisten Mainstream-Journalist*innen fabulierten noch am Wahlabend vom „Epos der Demokratie“ und der „langen Tradition der türkischen Demokratie“, die wieder der ganzen Welt gezeigt habe, dass die Türkei demokratisch sei.

Es steckt eine tiefere politische Bedeutung hinter diesem offensichtlichen Versuch, die momentane politische Situation von Hegemoniekrise, Faschisierungsprozess und massenhafter Unzufriedenheit zu „normalisieren“. Wir haben schon mehrfach betont, dass die Hauptoppositionskräfte, das heißt in erster Linie – aber nicht ausschließlich – die Kräfte, die in der Allianz der Nation verbündet sind, die Kräfte der Restauration sind. Angesichts der tiefen Krise repräsentieren und organisieren sie diejenigen Kräfte, die staatliche Institutionen und die neoliberale Hegemonie wieder stabilisieren und die Unzufriedenheit der breiten Bevölkerung in „akzeptable“, das System nicht gefährdende Bahnen lenken wollen.

Die Fundamente von Staat und Kapital sollen nicht gefährdet, eine Radikalisierung der Unzufriedenheit und des Widerstandes verhindert werden. In dem Maße jedoch, in dem das Regime angesichts der sich vertiefenden Krise immer unflexibler wird und die Kräfte der Restauration ihre respektive Position angesichts der steigenden Unzufriedenheit verbessern können, im dem Maße werden sie geradezu dazu gezwungen, eine deutlichere und resolutere Haltung einzunehmen wie derzeit im Rahmen der Kommunalwahlen. Während die Kräfte der Restauration einerseits das oppositionelle Potential in der Gesellschaft zu mobilisieren versuchen, appellieren sie zugleich an das Regime, sie in den Machtblock zu integrieren. Das Gerede vom „Epos der Demokratie“, der „Inklusion aller“ und dem „Ende der Polarisierung“ zielen darauf ab, den Konflikt der Blöcke zu entschärfen und gleichzeitig die oppositionellen und widerständigen Regungen in der Bevölkerung zu integrieren und zu befrieden.

Eine Bresche in der Belagerung?

Das „Epos der Demokratie“ besteht in erster Linie aus einem weiteren Zerfall des Regimes und dem Aufstieg der Kräfte der Restauration. Dieses „Epos“ lässt jedoch in letzter Instanz die politische Einheit und Kohärenz vermissen, die notwendig wäre, um die folgenden drei strukturellen Probleme zu lösen:

Erstens wird sich die ökonomische Krise weiter vertiefen und dabei weiterhin ernste soziale Probleme mit sich ziehen. Der Kampf um die Verteilung der Kosten der Krise zwischen den verschiedenen gesellschaftlichen Klassen wird ein Hauptterrain des politischen Kampfes darstellen. Kein Teil des „Epos der Demokratie“ hat – jenseits der üblichen neoliberalen Plattitüden – einen klaren Plan, um sich diesem Problem zu stellen. Ein radikaleres, transformatives Programm steht sowieso außer Diskussion. Die ökonomische Krise wird der mangelhaften Rechtsstaatlichkeit und Transparenz, der Erosion der demokratischen Institutionen und dergleichen mehr zugeschrieben, womit der Fokus von den zugrundeliegenden Klassenverhältnissen auf Oberflächenphänomene gelenkt wird. Auch innerhalb der HDP gibt es verschiedene Stimmen und einige davon haben sich in diese Reihen des Status quo eingereiht und sich vom radikaleren Programm aus 2015 verabschiedet.

Zweitens bildet das „Präsidialsystem“ den bisherigen Gipfelpunkt einer bestimmten Entwicklung: Alle Formen der Kontrolle von Machtausübung sind zunichte gemacht worden und grundlegende Freiheiten und Rechte werden massiv beschnitten. Eine politische Kultur des Autoritarismus schreitet voran und alle gesellschaftlichen Schichten sind von der offenen Repression in Beschlag genommen. Wenn es im Zuge dieser Wahlen einen „Epos der Demokratie“ zu erzählen gäbe, dann bestünde dieser aus dem Widerstand der demokratischen Kräfte gegen das Regime und den Prozess der Faschisierung. Ein politischer Diskurs, der diese Realität verschleiert und das „Präsidialsystem“ und wofür es steht kaum mehr erwähnt – und das ist genau das, was dieses Gerede eigentlich beabsichtigt –, entlarvt sein Desinteresse an einer genuinen Demokratisierung.

Drittens stellt die „kurdische Frage“ die Achillesferse des „Epos der Demokratie“ dar. Die taktische Allianz, die CHP, IYI und die HDP angesichts des relativ friedlichen Kontexts der Lokalwahlen zusammenbrachte, wird höchstwahrscheinlich im Kontext einer militärischen Operation im In- oder Ausland erneut auseinanderfliegen. Im Zentrum der Politik in der Türkei steht ein Paradox: In der momentanen Lage der Kräfteverhältnisse und Allianzen sind sowohl das Regime, wie auch die restaurative Opposition auf die politische Unterstützung der Kurd*innen angewiesen, um zu gewinnen. Aber keines der beiden Lager hat Interesse an einem substantiellen Friedensprozess, der nämlich ein Programm zur radikalen Transformation und Demokratisierung der Grundfesten der Republik Türkei beinhalten müsste.

Angesichts dieser Konstellation dürfen Sozialist*innen und Revolutionär*innen nicht nur Gehilfen der restaurativen Opposition werden, ihre Funktion wäre dann einzig auf das Einsammeln linker Stimmen reduziert. Während einige linksradikale Organisationen in Abstraktion zu wichtigen konkreten Kämpfen verbleiben und ihre bekannte Unfähigkeit, konkrete politische Konjunkturen zu verstehen, zum Ausdruck bringen, gibt es andererseits innerhalb der Linken in der Tat eine Tendenz zum Parlamentarismus und zur Selbstauflösung in einer diffusen „demokratischen Front“. Eine Integration in eine solche „demokratische Front“ – dominiert von den Kräften der Restauration und wofern ohne einen klaren eigenen Standpunkt hinsichtlich der Notwendigkeit unabhängiger Organisierung der popularen und revolutionären Kräfte – ist dazu verdammt, in einer Niederlage der genuin popular-demokratischen Kräfte zu enden.

Die Aufgabe der Linken ist es, die Möglichkeiten, die auf Grundlage der derzeitigen Situation entstehen, zu nutzen und sich auf den Aufbau unabhängiger popularer Organisationen und ihrer eigenen Alternativen zum Status Quo zu konzentrieren. Dabei sollte die Linke Möglichkeiten des Ausschlachtens von Widersprüchen zwischen den Herrschenden nicht ignorieren und auch Wege für potentielle Allianzen mit den jeweiligen Basen der herrschenden Parteien und der Parteien der Restauration nicht in den Wind schlagen.

In seiner Geschichte hat Istanbul viele stolze Namen geführt. Der vielleicht schönste ist der-i sa’adet, das Tor zur Glückseligkeit. Dieses Tor in eine Bresche in der faschistischen Belagerung des Landes zu verwandeln und gleichzeitig eine popular-revolutionäre Alternative zum kapitalistischen Restaurationsprojekt zu schaffen, ist die historische Aufgabe der Revolutionär*innen. Die Bedingungen für einen Sprung nach vorne sind wieder einmal reif.

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-ND 3.0) Lizenz.

———————————————————————————–

Grafrikquellen      :

Oben    —         Der neue Bürgermeister von Istanbul, Ekrem Imamoğlu von der Republikanischen Volkspartei (CHP), auf Wahlkampftour in Silivri, Juni 2019. / CeeGee (CC BY-SA 4.0

————————-

2.) von Oben      —     Collage of Istanbul (improved version of Istanbul collage 5g.jpg.)

Abgelegt unter Asien, Kommunalpolitik, Opposition, Positionen | Keine Kommentare »

Postenkampf in Brüssel

Erstellt von DL-Redaktion am 29. Juni 2019

Warum nennen wir die EU nicht gleich Deutsch-Europa?

File:Emmanuel Macron and Angela Merkel (Frankfurter Buchmesse 2017).jpg

Dieses ist kein Ausschnitt aus der Fernsehserie : „Der Bauer und das liebe Vieh“ !!

Eine Kolumne von

Lange galt, dass die Franzosen in Brüssel alles Mögliche besetzen. Mittlerweile sind wir Deutschen dabei, Anspruch auf so ziemlich alle Posten in der EU zu erheben. Ein gefährlicher Trend.

Wir Deutschen haben es in Europa nicht immer einfach. Seit zwanzig Jahren gibt es den Euro, und wir haben kein einziges Mal den Chef der Europäischen Zentralbank (EZB) gestellt. Und den letzten deutschen Präsidenten der EU-Kommission gab es irgendwann Ende der Sechzigerjahre. Da gab es noch nicht mal Handys. Höchste Zeit, den Zustand zu beheben.

So oder so ähnlich klingt, was unsere Kanzlerin mit patriotischem Pathos ausgegeben hat: dass bei der für Sonntag geplanten Gipfel-Entscheidung wenigstens einer der beiden gerade zu besetzenden Topposten an einen Deutschen gehen muss. Was anhand oben erwähnter Fakten natürlich auch zwingend erscheint.

Jetzt wollen wir unserer Kanzlerin bei den Gipfel-Verhandlungen nur Gutes wünschen. Könnte allerdings sein, dass nicht jeder in Europa uns anno 2019 noch so richtig zu bemitleiden bereit ist. Um es vorsichtig auszudrücken. Und nicht zu Unrecht.

Gut möglich, dass der eine oder andere beim Brüsseler Feilschen daran erinnert, warum die Deutschen bislang noch keinen Euro-Chef gestellt haben. Immerhin war das der Deal, weil ja die Euro-Notenbank schon nach Bundesbank-Vorgaben konzipiert war, der Sitz in die deutsche Stadt Frankfurt am Main gelegt worden war – und der erste EZB-Präsident zwar nicht Deutscher war, dafür war der Niederländer von einem Deutschen währungspolitisch aber kaum unterscheidbar. Hätte er einen deutschen Pass gehabt, hätte man die Sache gleich Bundesbank für alle nennen können.

Der damalige Kanzler Helmut Kohl ließ zur Sicherheit trotzdem noch dafür sorgen, einen Deutschen zum Chefvolkswirt der EZB zu machen – Otmar Issing. Der wiederum bestimmte für acht Jahre die Strategie der Bank mit. Und auf ihn folgte, raten Sie mal: ein Deutscher. Hatten wir erwähnt, dass in diesen Ur-Eurojahren bei der EU-Kommission ein Deutscher die Generaldirektion für Wirtschaft leitete – die, die über die Politik von Regierungen wachte?

Als bei der EZB der Niederländer Wim Duisenberg ging, folgte ein Franzose, also Jean-Claude Trichet, der allerdings eher als so eine Art deutschester Franzose gehandelt wurde, wenn es um Geldpolitik ging. Ähnlich wie sich in Italien der zwischenzeitliche EU-Wettbewerbskommissar Mario Monti als deutscher Italiener veralberte.

Phänomenale Deutschenvermehrung in Spitzenpositionen

Jetzt könnte man sagen, dass das alles ja schon eine Weile her ist – sodass jetzt mal ein Deutscher EU-Kommissionschef oder EZB-Präsident werden muss. Möglich sogar, dass die Deutschen damit locker durchkämen – wenn es nicht in der Zwischenzeit eine geradezu phänomenale Deutschenvermehrung in etlichen anderen Spitzenpositionen gegeben hätte – und zwar seit Beginn der Eurokrise. Weil die Deutschen das Geld geben. Oder so.

  • Von einem Deutschen wird seit Jahren der riesige Euro-Rettungsfonds ESM gemanagt: Klaus Regling, der qua Amt möglicherweise wichtigste Mann in der kommenden Krise. Das ist der, der lange Jahre die EU-Wirtschaftsabteilung geführt hat.

Werner Hoyer 2017.jpg

  • Bei der Europäischen Investitionsbank (EIB) steht mit Werner Hoyer ebenfalls einer aus Deutschland an der Spitze.
  • Die Chefin des Europäischen Bankenabwicklungsfonds ist: eine Deutsche – Elke König.
  • Und der Präsident des Europäischen Rechnungshofs heißt Klaus-Heiner Lehne – aus dem Land, nach dem sein Name klingt.

Anderswo besetzten die Deutschen mittlerweile die noch wichtigeren Positionen in zweiter Reihe, unkt der langjährige französische Brüssel-Korrespondent Jean Quatremer:

  • Als oberster Beamter der EU gilt der Generalsekretär der Kommission: Martin Selmayr, aus Sie-wissen-schon.
  • Im EU-Parlament heißt der Generalsekretär Klaus Welle.
  • Und die Generalsekretärin beim Europäischen Auswärtigen Dienst ist Helga Schmid. Germany.
  • Die wichtigste Fraktion im Europaparlament wird derweil seit Jahren von einem Landsmann geleitet, das Parlament lange Zeit von einem gewissen Martin Schulz.
  • Selbst der Noch-Kommissionschef Jean-Claude Juncker aus dem schnuckeligen Luxemburg wäre das nicht geworden, so Quatremer, wenn er nicht von der deutschen Kanzlerin dort hingeschickt worden wäre.

Quelle     :   Spiegel-online            >>>>>        weiterlesen

———————————————————————–

Grafikquellen       :

Oben     —        Emmanuel Macron and Angela Merkel (Frankfurter Buchmesse 2017)

Source Foire du Livre de Francfort 2017
Author ActuaLitté

This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.

Checked copyright icon.svg This image, originally posted to Flickr, was reviewed on by the administrator or reviewer Majora, who confirmed that it was available on Flickr under the stated license on that date.

————————–

Unten      —        Werner Hoyer, President, European Investment Bank, EIB

Abgelegt unter Europa, Kriegspolitik, Nordrhein-Westfalen, Positionen | Keine Kommentare »

Klimaproteste Deutschland

Erstellt von DL-Redaktion am 25. Juni 2019

So gut sortiert wie nie

Ende Gelände Demonstration 27-10-2018 02.jpg

Aus Aachen, Viersen und Hochneukirch

von Martin Kaulund Katherina Schipkowski

 Es ist Samstag, 13.09 Uhr, als es an diesem Wochenende dann ausnahmsweise doch einmal unübersichtlich wird: Hunderte Menschen biegen plötzlich auf einer Landstraße in Nordrhein-Westfalen, zwischen Lützerath und Immerath, links ab ins freie Feld. Alle rennen nun so schnell sie können – stolpern, aufstehen –, erst über Sand, dann durch ein Kornfeld und einen Kartoffelacker, zur Tagebaukante hin, in Garzweiler. Ein paar Dutzend Polizisten, wie verloren in der Menge, versuchen zu fangen, was zu fangen ist, aber sie fangen nicht viel. Diese Erstürmung dauert 16 Minuten.

Am Horizont, gleich da vorne, liegt der Tagebau Garzweiler, eines der größten Braunkohlefördergebiete Europas, und schon rutschen die ersten Besetzerinnen und Besetzer hinab. Sie schlittern einen sandigen, steilen Abhang hinunter. Sie haben ihr Ziel erreicht

So eine Hektik, so eine Bewegung: Sie ist zur Ausnahmesituation geworden in einem Protestambiente, in dem fast jede Bewegung inzwischen wohlkalkuliert ist. Über eintausend Menschen erstürmten am Wochenende den Tagebau in Garzweiler, Hunderte blockierten über Stunden und Tage die nahe gelegenen Schienengleise am Kohlekraftwerk Neurath und am rund 40 Kilometer entfernten Hambacher Forst.

Zehntausende gingen zuvor in Aachen und Hochneukirch für ein rasches Ende der Kohleförderung und eine effektivere Klimaschutzpolitik auf die Straßen. Es waren wieder viele Bewegungsrekorde dabei, eine Neugeburt der Anti-Kohle-Bewegung in Deutschland und vor allem: Ausdruck einer Veränderung.

Eine Wachstumsgelegenheit

Die radikale Umweltbewegung ist einfühlsam geworden über die Jahre, erwachsen, etabliert und heute wohl so organisiert wie nie zuvor. Wäre diese Bewegung ein Mensch, dann ein Elternteil. Hätte sie eine Küche, dann eine saubere. Jetzt hat diese Bewegung Nachwuchs bekommen: Die Schülerinnen sind da und die Schüler, die Kinder von Fridays for Future, die in weniger als einem Jahr schafften, was radikale Kraftwerks- und Tagebaubesetzer seit über zehn Jahren versuchen: dass ganz Deutschland über Klimawandel redet.

„Lio“ nennt sich der 18-jährige Junge mit Lockenkopf, der in einem Zirkuszelt im Protestcamp Viersen, 20 Kilometer entfernt vom Tagebau Garzweiler, so wirkt, als wachse er gerade einen ganzen Meter. Er steht kerzengerade und nimmt seine Sache sehr ernst, als er jungen Schülerinnen und Schülern wie ein Lehrer an einer Schautafel erklärt, wie sie gemeinsam nach Aachen kommen am Freitag, zur großen Fridays-for-Future-Demonstration und wie es sich anstellen lässt, dass das Zugticket für sie nur 9,20 Euro kostet statt 18,70 Euro.

„Lio“ ist zum ersten Mal bei einer solch großen Sache dabei und man merkt es ihm an. Links und rechts von ihm finden Protesteinführungen statt und Strategiediskussionen. Das ist ja das Besondere hier: Radikale Umweltschützer aus ganz Europa sind gekommen, aus Italien, Spanien, Frankreich und Großbritannien, viele von ihnen langjährig erprobt in allen möglichen Formen des zivilen Ungehorsams – aber dies ist jetzt ihre Chance: Der Erfolg der jungen Schülerbewegung, die am Freitag in Aachen rund 40.000 Menschen auf die Straße brachte, ist auch für die kapitalismuskritische Linke eine Wachstumsgelegenheit.

Quelle      :          TAZ           >>>>>           weiterlesen

Protestbewegung gegen Braunkohle

Jetzt kommt die Abrechnung

Ende Gelände - controll at Düren trainstation.jpg

Von Bernd Müllender, Köln

Die Aktivisten von Ende Gelände werfen der Polizei unverhältnismäßige Gewalt vor. Gegner machen im Netz indes Stimmung mit einem gefakten Müll-Bild.

Als die letzten der 40.000 Kids von Friday for Future Aachen am Sonntag wieder verlassen hatten, staunten alle nicht schlecht: den Abfall selbst weggeräumt; vorbildlich, hieß es von der Stadt. Im Internet aber wurde ein Bild verbreitet mit tonnenweise Müll am Straßenrand der Demostrecke. Die üblichen Empörungsreflexe kamen prompt: Dreckskids, Schweinerei. Indes: Das Bild war geklaut und stammte vom letzten Rosenmontagszug. Tataaa.

Am Montag sind die HetzerInnen im Netz wieder steilgegangen, kaum dass die Initiative „Ende Gelände“ ihre Besetzungen im Braunkohlerevier Garzweiler beendet hatte. Schimpfe über Müll, zertrampelte Felder mit ungezählten Opfern rheinischer Möhrchen und Zuckerrüben, dazu angeblich viele zurückgelassene weiße Demo-Anzüge, das Markenzeichen der Ende-Gelände-Leute. Bauer Willi Kremer-Schillings aus Rommers­kirchen beklagt sich auf seiner Homepage, ProtestiererInnen seien „über ein abgeerntetes Petersilienfeld gewandert“, nennt das „unfassbar!“ und klagt allgemein: „Asoziale Klimagegner latschen durch Äcker.“ Was nur sind „Klimagegner“?

Kathrin Henneberger, Sprecherin von Ende Gelände, zur taz: „Wenn es Schäden gegeben hat, sollen sich Bauern und Bäuerinnen direkt bei uns melden. Ernteausfälle erstatten wir. So haben wir das schon immer gehalten.“ Gleichzeitig twitterte die Polizei von „zahlreichen Flurschäden auf Feldern ortsansässiger Landwirte“, diese mögen Strafanzeige erstatten. Henneberger sagt: „Die wissen genau, dass wir das selbst regeln. Aber die Polizei will lieber alle jeck machen.“

Quelle      :        TAZ          >>>>>        weiterlesen

——————————————————————–

Grafikquellen     :

Oben     —     Demonstration von Ende Gelände vom Protestcamp südlich von Düren geplant/angemeldet nach Morschenich.

Abgelegt unter Deutschland, Kriegspolitik, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

Herbeigesehnter Bürgerkrieg

Erstellt von DL-Redaktion am 24. Juni 2019

 Eine historische und aktuelle Spurensuche.

Björn Höcke - Juni 2015.JPG

Von David Bebnowski und Dominik Rigoll

Was hat Höckes AfD mit der Hannibal-Affäre und dem Lübcke-Mord zu tun? Eine historische und aktuelle Spurensuche.

Im Jahr 1952 flog eine Gruppe von Veteranen der Wehrmacht und der Waffen-SS auf, die in den hessischen Wäldern für den „Tag X“ einer sowjetischen Invasion trainierte. Die Polizei beschlagnahmte Waffen, antikommunistisches Propagandamaterial, aber auch Proskriptionslisten mit den Namen von Sozial- und Christdemokraten, die dem Widerstand gegen den Natio­nal­sozialismus angehört hatten. Die aufgeflogene Gruppe war davon ausgegangen, dass diese am „Tag X“ mit den Sowjets kooperieren würden.

Die sogenannte Partisanenaffäre wurde nicht als ein großer Skandal wahrgenommen, obwohl der hessische Ministerpräsident eine breite Debatte darüber einforderte. Der Staatsanwalt Fritz Bauer, der gegen einen der Paramilitärs ermittelte, musste den Fall an die Bundesanwaltschaft abgeben. Der Bundesgerichtshof bescheinigte der Gruppe, die „freiheitliche demokratische Grundordnung“ zu schützen. Tatsächlich hatte sie im Dienst der CIA gestanden, deren „Stay Behind“-Einheiten rechtsoffenen Berufssoldaten in den Jahren vor der Bundeswehrgründung einen Job und einen Lebensinhalt boten.

Recherchen der taz ergaben, dass in der Bundesrepublik auch gegenwärtig ein bewaffnetes rechtes Untergrundnetzwerk existiert, das sich auf den „Tag X“ vorbereitet. Mehrere Mitglieder daraus sollen Listen mit politischen Gegnern erstellt haben, gegen sie wird gegenwärtig ermittelt. Erneut scheinen die Paramilitärs von den Geheimdiensten zumindest geduldet zu werden. Als Kopf gilt André S., ein inzwischen ehemaliger Soldat des Kommandos Spezialkräfte, der über gute Verbindungen zum MAD verfügt, zu der für die Kontrolle „extremistischer“ Umtriebe in der Truppe zuständigen Behörde.

Der Deckname von André S. ist Hannibal. Franco A., der Soldat, der 2017 wegen Terrorismusverdacht verhaftet wurde, weil er Mordanschläge auf Linke geplant haben soll, um sie dann möglicherweise Islamisten in die Schuhe schieben zu können und so eine Gewaltspirale in Gang zu setzen, bewegte sich in Hannibals Netzwerk. Er war unter anderem Mitglied in einer Chatgruppe, die Hannibal gegründet hatte.

Wie schon im Fall der Partisanenaffäre ermittelt nun auch in der Hannibal-Affäre die Bundesanwaltschaft. Tatsächlich geben nicht nur die seit den 1990er Jahren erstarkte rechte Gewalt, sondern auch die in der Szene grassierenden Zukunftsszenarien Anlass, die Sache ernst zu nehmen. Bücher mit beschwörenden Titeln wie „Zurüstung zum Bürgerkrieg“ malen das Szenario eines von den „globalistischen“ Eliten gesteuerten oder geduldeten „großen Austauschs“ der Bevölkerungen Europas durch Mi­gran­ten an die Wand.

Der Effekt dieser Fiktion ist die Annahme einer Notwehrsituation: In einem Clash am „Tag X“ sieht sich die extreme Rechte als letzte abendländische Bastion zum gewaltsamen Widerstand legitimiert.

Der Fall erinnert an Franz Oppenhoff

Manche besonders konsequente Rechte, die den Bürgerkrieg nicht abwarten können, fangen schon jetzt damit an und praktizieren ihren ganz persönlichen „Tag X“. Der mit Fantasieorden behangene Anders Breivik ist so ein Typ, aber wohl auch Stephan E., der mutmaßliche Mörder von Walter Lübcke.

Der Mord an dem CDU-Politiker steht in einer langen Reihe rechter Terrorakte, die im März 1945 mit der Ermordung des ersten von den Amerikanern eingesetzten Aachener Bürgermeisters, Franz Oppenhoff, begann. Wie Lübcke war auch Oppenhoff ein Konservativer und Christ, der partout nicht das tat, was Nazis von seinesgleichen erwarten. Wie Lübcke wurde auch Oppenhoff vor seinem eigenen Haus mit einer Schusswaffe „hingerichtet“.

Denkmal Oppenhoffallee.jpg

Den Mord an Oppenhoff besorgte ein Kommando, das aus SS-Männern, Polizisten, einem Hitlerjungen und einer BDM-Führerin bestand, die über Ortskenntnisse verfügte. Es ist zu hoffen, dass es im Mordfall Lübcke keine Absprachen zwischen rechten Aktivisten und rechtsoffenen Angehörigen der Sicherheitsapparate gab. Ob Lübckes Name etwa auch auf einer der Listen stand, die bei dem Bundeswehrsoldaten Franco A. gefunden wurden, wissen wir nicht.

 Unwahrscheinlich ist es leider nicht, denn herbeigesehnt wird der Bürgerkrieg inzwischen nicht mehr nur von ausgewiesenen Rechtsextremisten wie dem ­Mörder von Christchurch oder der „Identitären Bewegung“, sondern auch in einem Gesprächsband, den Björn Höcke letzten Sommer vorgelegt hat – im selben Verlag, der auch Alexander Gaulands „Anleitung zum Konservativsein“ vertreibt.

Höcke kommuniziert in dem Buch quasi auf mehreren Tonspuren gleichzeitig. Wer etwas Bedeutungsvolles hören möchte, wird die richtigen Klänge vernehmen. Einerseits ist das Buch voll von Absagen an Gewalt, gerade auch gegen Migranten, während als eigentlicher Feind der linke oder liberale „Gutmensch“ gezeichnet wird. Andererseits umreißt Höcke ein „großangelegtes Remigrationsprojekt“ zur „geordneten Rückführung der hier nicht integrierbaren Migranten in ihre ursprünglichen Heimatländer“.

Besonders ins Auge fallen zudem jene Stellen, in denen er darüber sinniert, wie wahrscheinlich doch ein künftiger bürgerkriegsähnlicher Konflikt sei, angesichts der „millionenfachen Invasion von Fremden nach Europa“ und des „Totalversagens der politischen Klasse“.

Quelle      :        TAZ         >>>>>         weiterlesen

——————————————————————————–

Grafikquellen       :

Oben      —       Björn Höcke im Gespräch am Tag der offenen Tür im Thüringer Landtag am 13. Juni 2015

Abgelegt unter Deutschland, L. Thüringen, Nordrhein-Westfalen, P.AfD | Keine Kommentare »

Spahns U-Boot-Politik

Erstellt von DL-Redaktion am 24. Juni 2019

Die Kunststücke des Herrn Spahn

EPP Helsinki Congress in Finland, 7-8 November 2018 (30828525517).jpg

Wie der Gesundheitsminister konservative Werte zerstört

von Michael Kanert

Manchmal kann man den Eindruck haben, dass Jens Spahn, wenn er morgens ins Büro geht, einfach die Tür verwechselt. Denn gleich neben dem Bundesgesundheitsministerium steht der Berliner Friedrichstadtpalast. Dort werden prächtige Revuen aufgeführt mit Tanz und Musik und atemberaubenden Effekten. Derzeit auf der Bühne: der Herr Minister.

„In 10 bis 20 Jahren werden wir den Krebs besiegt haben“, ruft er ins Mikrofon. Erster Applaus, das Eis ist gebrochen. Dann seine 300-Millionen-Nummer. Spahn zaubert diese Summe direkt in die Taschen von Krankenhaus-Vertretern in der ersten Reihe. Das Publikum ist begeistert, denn niemand hat etwas gesehen, weil Spahn die Geldscheine geschickt in einem 200-seitigen parlamentarischen Papierberg versteckt hat. Jetzt hält es auch die Apotheker nicht mehr auf ihren Sitzen. „Wir auch“, skandieren sie. Und noch während Jens Spahn sein Autogramm schwungvoll auf einen 150-Millionen-Scheck schreibt, dreht er sich in rasendem Tempo plötzlich um die eigene Achse und schleudert bunte Sprechblasen in die Menge: „Brexit“, „Fettabsaugen“, „Schüler-Demo“, „Abtreibung“. Zugegeben, dieses imaginierte Theater ist ein schräges Bild – und durchaus auch etwas ungerecht, wenn man auf manch sinnvolle Initiative des Bundesgesundheitsministers schaut. Aber warum kommen einem solche Bilder in den Kopf, wenn man an Jens Spahn denkt?

Den Satz mit dem Krebs hat Jens Spahn tatsächlich im Februar gesagt.[1] Allerdings erntete er dafür keinen Applaus, sondern Buhrufe aus dem Fachpublikum. „Unverantwortlich“, kritisierte die Deutsche Stiftung Patientenschutz[2] und von der „Süddeutschen Zeitung“ gab es medizinischen Nachhilfeunterricht. „Krebs ist nicht eine Krankheit. Er summiert tausend verschiedene Krankheiten. Jeder Krebs hat andere molekulare Signaturen und weist andere Zeichen der Bösartigkeit auf.“[3] Doch Jens Spahn jongliert ungeniert weiter mit medizinischen Fachbegriffen und Zahlen. Nächstes Thema: Fettabsaugen. „Bis zu drei Millionen Frauen leiden täglich darunter, dass die Krankenkassen ihre Therapie nicht bezahlen“, behauptete der Gesundheitsminister schon im Januar. Angeblich leiden alle diese Frauen an einer krankhaften Verteilung des Fettgewebes (Fachbegriff: Lipödem).[4] Diese Krankheit kann starke Schmerzen hervorrufen und ist nicht zu verwechseln mit den Fettpölsterchen, die durch zu viel Couch und Chips entstehen. Jede zehnte Frau in Deutschland wird von den Krankenkassen im Stich gelassen? Wenn das stimmt, kann dagegen offenbar nur einer helfen: Jens Spahn. Der erwünschte Eindruck ist klar: Hier agiert ein tatkräftiger Politiker, der wirklich zupackt, um Mitbürgerinnen in Not zu helfen.

Spahns Plan: Er will selbst bestimmen, welche Behandlung die gesetzlichen Krankenkassen bezahlen müssen – ohne Kontrolle durch das Parlament oder ein kritisches medizinisches Fachgremium. Dann will er den drei Millionen Frauen das sogenannte Fettabsaugen bezahlen (Fachbegriff: Liposuktion). Tatsächlich aber gibt es diesen Medizin-Skandal gar nicht in der behaupteten Form. Jens Spahn hat nur ein paar Nullen durcheinandergewirbelt. Vermutlich leidet nicht jede zehnte Frau an einem Lipödem, sondern höchstens jede hundertste, möglicherweise sogar nur jede tausendste. Die falsche Millionen-Zahl wurde vor Jahren in einem medizinischen Fachbuch veröffentlicht, ist aber von der Autorin widerrufen worden – weil sie nach ihren eigenen Angaben auf einer „mangelhaften Doktorarbeit“ beruhte.[5]

Wie aber verhält es sich mit dem Fettabsaugen im Einzelfall, als Nothilfe durch den zupackenden Minister? Mit gutem Grund entscheiden in Deutschland weder die Krankenkassen noch Minister darüber, welche Behandlung von den Kassen bezahlt werden darf oder muss. Darüber wacht ein besonderes Gremium, das mit den gegenläufigsten Interessengruppen besetzt ist: der Gemeinsame Bundesausschuss. Dort sitzen Vertreter der Ärzte, Krankenhäuser und Krankenkassen. Auch die Vertreter von Patienten und die Hersteller von Medizin-Produkten können Anträge auf Zulassung stellen und müssen vor einer Entscheidung gehört werden. Der Gemeinsame Bundesausschuss erteilt nur dann eine Zulassung, wenn genügend wissenschaftliche Studien vorliegen, die Nutzen und Risiken der Behandlung erforscht haben.

Obwohl das Fettabsaugen nach Angaben von Ärzten seit Jahren erfolgreich gegen Lipödeme praktiziert wird, ist die Studienlage erstaunlich dünn. Der Gemeinsame Bundesausschuss hat daher bislang keine Zulassung erteilt. Er gab aber sogar selbst eine Studie in Auftrag, die noch nicht abgeschlossen ist. Das Bundessozialgericht bestätigte mehrfach, dass sich der Gemeinsame Bundesausschuss damit rechtmäßig verhalten hat. Daher ist das Thema „Fettabsaugen“ kein Anlass für Spahnsche Alarmmeldungen. Es ist – im Gegenteil – ein Beispiel dafür, dass das bestehende Kontrollsystem der Krankenversicherung für neue Behandlungsmethoden passabel funktioniert. Dennoch unternimmt Spahn derzeit bereits den dritten Anlauf, um den Bundestag von einer Machtverschiebung zu seinen Gunsten zu überzeugen.

Zugegeben, der direkte Zugriff auf die riesigen Geldströme des Gesundheitswesens ist reizvoll. In Deutschland wird jeden Tag (!) mehr als eine Milliarde Euro für die Gesundheit ausgegeben, überwiegend durch staatliche Einrichtungen. Ein erheblicher Teil der staatlichen Milliarden stammt gar nicht aus Steuergeldern. Es sind die Arbeitnehmer, Rentner, die kleinen Selbstständigen und die Arbeitgeber, die mit ihren Sozialversicherungsbeiträgen die Krankenkassen finanzieren. Deshalb wird diesen Beitragszahlern seit jeher ein besonderes Mitbestimmungsrecht gegeben. Durch die – oft unterschätzten – Sozialwahlen werden die Vertreter bestimmt. Sie sitzen im Verwaltungsrat und wählen den Vorstand jeder kleinen Ortskrankenkasse genauso wie beim einflussreichen Spitzenverband der gesetzlichen Krankenversicherung in Berlin.

Jedem wirklich Konservativen muss bei diesem Modell – eigentlich – das Herz höher schlagen: Der Bürger ist keiner anonymen Staatsbürokratie ausgeliefert. Er kann Eigenverantwortung übernehmen. Das System der gesetzlichen Krankenversicherung wird dadurch auch besser in der Gesellschaft verwurzelt. Die Vertreter von Arbeitgeberverbänden oder Gewerkschaften bringen ihre Sicht ein. Sie sind Vermittler für Verbesserungsvorschläge oder Kritik an verkrusteten Strukturen. Umgekehrt liefern sie in ihre Verbände auch die Rückmeldung, dass manche zunächst unverständliche Verfahrensweise doch ihren guten Grund hat. In der Praxis könnten die gewählten Vertreter durchaus noch selbstbewusster auftreten, damit zum Beispiel die Verwaltung der Krankenkassen bürgerfreundlicher gestaltet wird und nicht den Sparplänen externer Unternehmensberater ausgeliefert ist. Jens Spahn aber geht genau den umgekehrten Weg. Er bläst zum Angriff auf die Selbstverwaltung und fängt beim unbequemen Spitzenverband der Krankenkassen an. Dort sollen künftig nur noch hauptamtliche Mitarbeiter im Verwaltungsrat sitzen, um – so heißt es im Gesetzentwurf – eine „Professionalisierung“ zu erreichen. Man könnte an eine kleine Anleihe bei FDP-Chef Christian Lindner denken, der ja auch den Klimaschutz allein den „Profis“ überlassen will.

Wie Jens Spahn sich den Umgang mit „seinen“ Profis vorstellt, lässt eine Passage aus seiner neuen Biographie erahnen.[6] Dort wird eine E-Mail des Personalrats aus dem April 2018 zitiert: In „gefühltem Minutentakt“ habe Spahn gleich nach seinem Amtsantritt das Ministerium umgebaut. Und alle neuen Mitarbeiter hätten irgendwann vorher schon mal mit Spahn zusammengearbeitet: „Der Personalrat fragt sich, ob die persönliche Nähe zum Minister die neue Interpretation des Hauses bei der ‚Bestenauslese‘ ist.“

Die Profi-Freunde des Jens Spahn

Fehlt Jens Spahn der innere Kompass bei der Abgrenzung von öffentlichem Amt und persönlichen Beziehungen? Kurzer Blick zurück: 2006 war Jens Spahn bereits ein einflussreicher Bundestagsabgeordneter als Obmann der CDU im Gesundheitsausschuss. Da gründete er mit seinem ehemaligen Büroleiter und einem Bekannten namens Max Müller eine Gesellschaft bürgerlichen Rechts, welche die Beratungsagentur „Politas“ verwaltete. Der „Focus“ berichtete später, dass „schwerpunktmäßig Klienten aus dem Medizin- und Pharmasektor“ beraten wurden.[7] Spahn sprach dagegen nur allgemein von „Kunden aus unterschiedlichen Branchen“. Obwohl die Firma die meiste Zeit gar keine Gewinne ausgeschüttet haben soll, ließ Spahn vier Jahre verstreichen, bis er seine Anteile verkaufte. Durch den Verkauf wollte er „den Eindruck eines möglichen Interessenkonflikts vermeiden“. Die Beteiligung war eine „Dummheit“, wird Spahn in seiner Biographie zitiert. Was aber hat er daraus gelernt? In seiner Zeit als Staatssekretär im Finanzministerium hat er sich mit 15 000 Euro an einer Firma beteiligt, die eine Software zur Erstellung von Steuererklärungen entwickelte. Nach öffentlicher Kritik sah er in seiner Beteiligung zwar „kein Problem“[8], verkaufte aber wenige Tage später seine Anteile und zahlte auch die 3000 Euro staatliche Zuschüsse zurück, die er im Zusammenhang mit seiner Investition erhalten hatte.[9]

Wie es bei dieser Art Dummheiten so ist – richtig dumm wird es, wenn sie einen später wieder einholen. Max Müller, der Geschäftspartner aus der „Politas“-Zeit, ist inzwischen „Chief Strategy Officer“ im Vorstand der Versandapotheke DocMorris. Und damit wird die aktuelle Beziehung zwischen ihm und dem Bundesgesundheitsminister ganz amtlich. DocMorris pocht auf ein Urteil des Europäischen Gerichtshofs. Danach muss Deutschland der Versandapotheke die Möglichkeit einräumen, Arzneimittel in Deutschland billiger zu verkaufen, als es die örtlichen Apotheker tun.

Zeichnung: Jens Spahn sagt "Hartz 4 bedeutet nicht Armut"; in seiner Hand ein Bündel Scheine (Monatsgehalt), im Hintergrund sind Dienstwagen und freies Zugfahren angedeutet.

Jetzt ist der Gesundheitsminister in der Zwickmühle: Setzt er das Urteil um, werden alle Apotheker sagen: „Der hilft ja nur seinem alten Kumpel.“ Im Internet werden solche Verschwörungstheorien bereits geäußert. Tut er es nicht, riskiert die Bundesrepublik heftige Strafzahlungen, weil sie gegen Europarecht verstößt. Elf Mal traf sich die Leitungsebene des Gesundheitsministeriums Ende des vergangenen Jahres mit Vertretern der heimischen Apothekerverbände in der Vorbereitung für ein neues Apothekengesetz. Mit den Krankenkassen, die am Ende alles bezahlen müssen, war in diesem Zeitraum kein einziges Treffen dokumentiert.[10] Spahn mäandert seitdem mit den verschiedensten Entwürfen: Erst hieß es 375 Mio. Euro zusätzlich an die Apotheker für besonders wertvolle „Dienstleistungen“ und nur ein begrenzter Spielraum für Rabatte von DocMorris, dann wieder: kein Spielraum für Rabatte von DocMorris, dafür aber nur 150 Mio. Euro für die deutschen Apotheker. Die Europäische Kommission will Spahn mit einem juristischen Hütchen-Trick bezaubern: Offiziell soll der Bundestag den Paragraphen des Arzneimittelgesetzes aufheben, der gegen das Europarecht verstößt. Im selben Atemzug soll aber eine gleichwertige, nur etwas verklausuliertere Regelung im Sozialgesetzbuch wieder eingeführt werden. Das Bundeswirtschaftsministerium hat den Trick mit den unterschiedlichen Gesetzes-Hütchen bereits durchschaut und warnt in einer ungewöhnlich deutlichen Stellungnahme vor einer „offenen Konfrontation gegenüber dem Europäischen Gerichtshof und der Europäischen Kommission“.

Diffuse Wertüberzeugungen

Quelle        :         Blätter          >>>>>           weiterlesen

———————————————————————-

Grafikquellen       :

Oben      —       7 November 2018

Abgelegt unter Gesundheitspolitik, Nordrhein-Westfalen, P.CDU / CSU, Regierung | Keine Kommentare »

DIE LINKE. erneuern

Erstellt von DL-Redaktion am 18. Juni 2019

„Bewegungslinke“ diskutierte  in Düsseldorf

Quelle         :    Scharf  –  Links

Von Edith Bartelmus-Scholich

Für das Wochenende 15./16. Juni  hatte die „Bewegungslinke“ zu einem Ratschlag eingeladen. Auf der offenen Veranstaltung trafen sich ca. 150 Mitglieder des  linken Flügels der Partei DIE LINKE. Vorbereitet und gestaltet hatten den Ratschlag die InitiatorInnen der 2018 begonnenen Sammlung „Bewegungslinke“ (https://bewegungslinke.org ).

Der Ratschlag diente der Vorstellung der „Bewegungslinken“ und der inhaltlichen Verständigung mit Parteilinken, die sich (noch) nicht zugehörig fühlen. Die Debatten erfreuten durch ein ansprechendes theoretische Niveau und eine untadelige Diskussionskultur. Die TeilnehmerInnen waren überwiegend jüngere Menschen darunter sehr viele Frauen.

Zunächst stellte die „Bewegungslinke“ ihre Kritik an der Partei DIE LINKE. und ihre Vorschläge zur Veränderung der Partei dar. In Impulsen wurde herausgearbeitet, dass in der Partei DIE LINKE Verunsicherung um sich greift. Dies betrifft nicht nur die Bewertung der ökologischen Frage,  sondern auch das Zutrauen in die Partei und ihre Möglichkeiten Politik zu gestalten und Gesellschaft zu verändern insgesamt. Verschärfend wirken sich der gesellschaftliche und politische Rechtsruck sowie der Niedergang der SPD und das Schwinden auch nur der rechnerischen Möglichkeit  einer rot-rot-grünen Koalitionsregierung im Bund aus. Die Verunsicherung geht so weit, dass Einzelne in der Vergangenheit schon Werbung für andere Projekte gemacht haben. Angesichts dieser Ausgangslage stellt die „Bewegungslinke“ die Frage,  was für eine Partei braucht es um wirkmächtig zu werden.

Die „Bewegungslinke“ wünscht sich DIE LINKE. als ein nützliches Werkzeug der Lohnabhängigen in den täglichen – nicht nur betrieblichen – Kämpfen. Das verlangt, dass die Partei bewegungsorientiert und organisierend eine verbindende, emanzipatorische Klassenpolitik verstetigt. Die Arbeitsweise der Partei soll sich grundlegend verändern: Weg vom „Sitzungssozialismus“, hin zu partizipativen, kämpferischen Aktionsformen. Die Machtfrage soll DIE LINKE. dabei durchaus stellen, aber parlamentarismuskritisch  jenseits von  Regierungsbeteiligung. Die Basisbewegung der Vielen ist der Schlüssel zur Verschiebung der Kräfte- und Machtverhältnisse. (https://bewegungslinke.org/wp-content/uploads/2014/09/Diskussionsgrundlage.pdf )

Die Vorstellungen von einer verbindenden Klassenpolitik umfassen einmal, den Ansatz Kämpfe zu verbinden und Identität und Klasse, die im Individuum zusammenfallen, nicht etwa auseinanderzureißen. Klassenpolitik soll dabei als Praxis begriffen werden, in der sich über die gemachte Erfahrung das Klassenbewusstsein herausbildet. Darüber hinaus gilt es nicht nur Kämpfe zu verbinden, sondern auch Alltagsrollen.

In Workshops wurden einzelne Fragestellungen von den TeilnehmerInnen bearbeitet. Herausragend besucht waren dabei der von Raul Zelik geleitete Workshop zur Eindämmung der Parlamentarisierung der Partei sowie der Workshop „Wie passen Klassenpolitik und Klimabewegung zusammen?“. Zu diesen beiden Themenkreisen besteht offenbar in der Partei DIE LINKE großer Diskussionsbedarf.

Insgesamt war der Ratschlag eine inspirierende Veranstaltung von der Hoffnung und Mut machende  Signale ausgegangen sind. Die angeschnittenen Themen sollten regional aufgegriffen werden, damit der Kreis der „Erneuerer“ sich verbreitert.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————————

Grafikquelle       :

Medienmarathon 2005 in München, Startblock B

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Wahlen-Kommunistin-Barca

Erstellt von DL-Redaktion am 17. Juni 2019

Gemeinderäte wählten die Bürgermeister in Spanien: Kommunistin gewinnt in Barcelona!

(Ada Colau) 2019. La transformació de la presó de la Trinitat.jpg

Quelle     :    Scharf  –   Links

Von Siegfried Buttenmüller

Am gestrigen Samstag den 15 Juni 2019 traten in Spaniens Kommunen die neu gewählten Gemeinderäte zur erste Sitzung zusammen, vor allem um die neuen Oberbürgermeister zu wählen. Die Wochen seit den Wahlen waren geprägt von Verhandlungen über Bündnisse, da kaum eine Liste irgendwo über absolute Mehrheiten verfügt.

In der mit 1,6 Millionen Einwohner nach Madrid zweitgrößten Stadt Barcelona konnte sich die Kommunistin und Amtsinhaberin Ada Colau-Bolano erneut deutlich durchsetzen.
Das war alles andere als selbstverständlich denn bereits kurz nach den Kommunalwahlen hatte z.B. das Bundesvorstandsmitglied von Die Linke, Raul Zelik, fälschlich gemeldet das Ada Colau-Bolano abgewählt worden sei. Auch die bürgerlichen Medien in Deutschland wurden entsprechend „informiert“ und haben das sehr gerne verbreitet. Auch Linke Medien wie „Neues Deutschland“ und sehr viele Zeitungen in Spanien verbreiteten diese Falschmeldung.

Gestützt wurde diese Behauptung auf die Tatsache, das die Liste der „linksrepublikanischen“ ERC in Barcelona mit Listenführer  Ernest Maragall ganz wenige Stimmen (ca. 4833 bei über 150 Tausend für jede Liste) mehr bekommen hat als die Liste der zum Bündnis Podemos gehörenden Liste der amtierenden Oberbürgermeisterin.

Im Gemeinderat von Barcelona hat die Liste Barcelona en Comú der Oberbürgermeisterin jedoch 10 Sitze, genau wie der ERC von Ernesto Maragall. Als dritte Linke Partei haben die Sozialisten 8 Sitze erreicht. Barcelona en Comú ist jedoch in 6 Stadtbezirken stärkste politische Kraft geworden während der ERC und PSC das nur jeweils in 2 Bezirken geschafft haben, sonstige nur in einem Bezirk. Vor allem aber setzt Barcelona en Comú auf Basisdemokratie und versucht so gut wie möglich die Menschen in den Stadtteilen auf Versammlungen selbst über ihre Belange bestimmen zu lassen und auch dazu zu motivieren. Nach oben hin versucht Barcelona en Comú mit einigem Erfolg und den zur Verfügung stehenden Mitteln den Wohnungsbaukonzernen, Kapital und Bürokratie das Wasser abzugraben und den Menschen damit mehr Mittel zur Gestaltung freizukämpfen. Schulen, Kindergärten, Wohnungen, Einkommen, Gleiche Rechte für Frauen, Unterkünfte für Flüchtlinge und sonstige soziale Forderungen stehen ganz oben auf der Agenda.

Dieser Politik folgen die anderen beiden „Linken“ Parteien wenn überhaupt dann nur widerwillig, stehen jedoch unter Druck der Basisorganisationen und auch von der von Barcelona en Comú geführten Stadtverwaltung. Für den ERC steht hingegen die Abgrenzung von Spanien und auch von den anderen Ländern, der „eigene Staat“, „eigene Sprache an Schulen“ usw. ganz oben auf der Agenda. Die Kommunistin Ada Colau-Bolano aus dem Amt treiben zu können und die Stadtverwaltung der mit Abstand größten Stadt in Katalonien unter Kontrolle bekommen zu können, wäre da eine fette Beute für den ERC gewesen. Die Partei der Sozialisten Kataloniens (PSC) mit 8 Sitzen als dritte große Fraktion in Barcelona steht ebenfalls deutlich Rechts von Barcelona en Comú, ist weniger basisdemokratisch, weniger antibürokratisch und gar nicht antikapitalistisch. Diese Partei hält jedoch nichts vom Separatismus und so gab es keine ernsthaften Gespräche zwischen ERC und PSC. Vielmehr hat sich die PSC als Bündnispartner von Barcelona en Comú Zugeständnisse abtrotzen lassen, um die Oberbürgermeisterin im Amt zu halten. Auch der ERC hatte Barcelona en Comú ein Bündnis angeboten, beanspruchte aber selbst die Führung und vor allem den Oberbürgermeisterposten.

Die Basisorganisationen in den Stadtteilen lehnten dies jedoch entschieden ab und forderten das die Alcaldesa (Oberbürgermeisterin) im Amt bleiben müsse. Ada Colau-Bolano kandidierte somit in der Gemeinderatssitzung erneut für das Amt der Oberbürgermeisterin, hatte jedoch mit den Stimmen der beiden Listen nicht die notwendige absolute Mehrheit. Ernest Maragall hatte auch die einfache Mehrheit im Rat nicht, doch wäre ihm das Amt des Oberbürgermeisters laut Verfassung mit seiner knapp Stimmenstärksten Liste zugefallen, wenn es keine absolute Mehrheit für einen Kandidaten oder eine Kandidaten gegeben hätte. Maragall wurde außer von den Räten des ERC von der Liste des Rechtskonservativen Charles Puigdemont, Junts Catalunia (JC) mit 5 Räten, unterstützt. Zusammen haben die Separatisten jedoch nur noch 15 Stimmen im Gemeinderat von Barcelona statt der 18 bei der letzten Kommunalwahl von 2015. Die „Linken“ der CUP haben ihre 3 Räte verloren und sind nicht mehr vertreten, ansonsten gab es in diesem Lager nur Verschiebungen zugunsten des ERC und JC, mit Xcat verschwand auch die Sammlungsliste der Separatisten aus dem Gemeinderat. Somit führte Ada Colau-Bolano vor der Abstimmung im Gemeinderat mit 18 zu 15 Stimmen vor Ernest Maragal, dieser wäre damit aber Oberbürgermeister geworden da die absolute Mehrheit von 21 Stimmen von keinem erreicht worden wäre. Allerdings ist es klar das die Amtsinhaberin für die restlichen Listen im Gemeinderat das deutlich kleinere Übel ist da sie vor allem gegen den Separatismus sind und erst in zweiter Linie gegen Links. Die Oberbürgermeisterin und ihre Organisation hatte die Sezessionsbewegung nicht unterstützt aber auch die Konservativen wegen ihres Vorgehens und ihrer mangelhaften Dialogbeischaft scharf kritisiert. Somit ist klar das von den restlichen Gemeinderäten keinerlei Unterstützung für Ernest Maragall und die separatistische Bewegung zu erwarten ist und außerdem wurde dieses Lager um 3 Gemeinderäte geschwächt. Die Perspektive dieser nicht antikapitalistischen Richtung ist letztlich das Spanien Jugoslawien in den Untergang und das Chaos folgt, was immer mehr Menschen und auch immer mehr Linke einzusehen scheinen. Kapitalismus kann weder in Spanien oder sonst irgendwo auf der Welt funktionieren und erst recht nicht in einem erst noch neu zu gründenden kapitalistischen Staat wie z.B. Katalonien.

Die meisten kleineren Listen enthielten sich oder stellten eigene Kandidaten auf, ohne das diese eine Chance gehabt hätten. Von der Liste des rechten Sozialdemokraten Manuel Vals enthielten sich 3 Räte und 3 andere Räte Stimmten für Ada Colau-Bolano. Somit hat diese mit 21 Stimmen die absolute Mehrheit im Gemeinderat erreicht und ist für 4 weitere Jahre zur Oberbürgermeisterin von Barcelona gewählt.

Datei:Port of Barcelona from Montjuic.JPG

Die Steigerung von „Wir können es“ (Spanisch Podemos) ist: „Wir tun es“ und in Barcelona machen es Barcelona en Comú und ihre Alcaldesa Ada Colau-Bolano. Es ist dies die Revolutionäre Realpolitik die Rosa Luxemburg immer eingefordert hat und die von der Organisation in Barcelona umgesetzt wird. Es ist der Kampf für Basisdemokratie in der Gesellschaft, der Kampf gegen die privilegierte Bürokratie und der Kampf gegen den Kapitalismus, der nicht mehr über die Interessen der Menschen gestellt wird.

Barcelona wird weiter ein Leuchtfeuer in Richtung antikapitalistischer Weltgesellschaft sein und der Funke greift auf immer mehr Kommunen über, daran arbeitet gerade Ada Colau-Bolano sehr intensiv. „Global denken, lokal Handeln“, dieser Leitspruch der Bewegungen gilt noch immer und in Zukunft erst recht.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————————-

Grafikquellen     :

Oben      —      Canviem presons per vida. El centre penitenciari de la Trinitat Vella i els entorns es transformaran en un gran espai obert amb habitatge, equipaments i espais veïnals en un dels barris històricament oblidats de la ciutat. La Trini importa.

Diese Datei ist unter den Creative-Commons-Lizenzen „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“, „2.5 generisch“, „2.0 generisch“ und „1.0 generisch“ lizenziert.

Abgelegt unter Europa, Kommunalpolitik, Positionen, Regierung | Keine Kommentare »

Neues von Couchreportern

Erstellt von DL-Redaktion am 14. Juni 2019

Jedem Land die Polit-Serie, die es verdient.

Annegret Kramp-Karrenbauer

Wir haben den traurigdoofen Hajo Eichwald

Von Johanna Roth

Das deutsche Fernsehen kann ja eigentlich weder Politik noch Comedy. Umso erstaunlicher, dass „Eichwald, MdB“ beides vereint – und dann auch noch gut. In der ersten Staffel der Miniminiserie konnte man auf ZDFneo dem Bochumer Bundestagsabgeordneten Hajo Eichwald dabei zusehen, wie er von einer Katastrophe zur nächsten trottelte, und schon da waren die Parallelen zur Wirklichkeit verblüffend. Jetzt kommt endlich die zweite Staffel, auf ZDF, und noch mehr als bei der ersten fragt man sich, wie viele Informanten die Macher denn wohl an zentralen Stellen der SPD-Bundestagsfraktion platziert hatten. Zwar wird in der Serie nicht gesagt, für welche Partei Hajo da eigentlich sitzt, aber groß herausgefordert wird die Fantasie diesbezüglich nicht.

Staffel zwei, geradezu prophetisch, spielt kurz nach einer Bundestagswahl, Hajo Eichwald hat sein Bochumer Revier gerade nochmal so gegen einen 24-jährigen rechtspopulistischen YouTuber verteidigt. Die Fraktion hat sich in eine Große Koalition gerettet, um nicht komplett abzurauschen. Eichwald wittert seine Chance in einem großen Dopingskandal, für den er einen Untersuchungsausschuss anleiert. Vor dem landet er dann bald selbst.

Dazu muss man wissen: Eichwald sitzt nicht auf der Hinterbank, er reitet sie. Und zwar seit Jahrzehnten. Immer, wenn er kurz vorm politischen Durchbruch steht, stolpert er entweder über sich selbst oder seine Mitarbeiter, die es immer gut mit ihm meinen und also sein Untergang sind.

Zwei Vorläufer : Der Rechts-Aussen K.G. Kiesinger und der Runde  Ludwig Erhardt.

Der bitterschwarze Humor erinnert an britische Serien wie „Blackadder“ oder „The Office“, die von der genialen Bescheuertheit ihrer Figuren in ausweglosen Situationen leben. Hajo ist im Grunde ständig damit beschäftigt, Brände, die er selbst gelegt oder indirekt in Auftrag gegeben hat, wieder auszutrampeln. Sein Darsteller Bernhard Schütz ist zudem der wohl einzige, dem man eine Frage wie „Schenkt man da was?“ abnimmt, wenn er darauf hingewiesen wird, dass heute der erste Todestag der Frau eines Fraktionskollegen sei – und dann sogar noch lachen muss.

Quelle      :        TAZ         >>>>>         weiterlesen

————————————————————————-

Grafikquellen       :

Oben         —         Unterzeichnung des Koalitionsvertrages der 19. Wahlperiode des Bundestages: Annegret Kramp-Karrenbauer

——————————

Unten     —        Ludwig Erhard (links) und Kurt Georg Kiesinger (rechts), 25. November 1966

Abgelegt unter Deutschland, Nordrhein-Westfalen, P.CDU / CSU, Regierungs - Werte | Keine Kommentare »

Saar – ’Pest’ oder ’Cholera’ ?

Erstellt von DL-Redaktion am 10. Juni 2019

’Pest’ oder ’Cholera’ für Saarbrücker Bürger:
und zudem ist der gewählte Kandidat nicht demokratisch legitimiert!

Quelle       :     Scharf  –  Links

Von Dr. Nikolaus Götz

Noch bis vor 15 Jahren wurde der Oberbürgermeister der Stadt von Saarbrücken vom Saarbrücker Stadtrat gewählt und das war gut so, damals! Schon bei der „wegen der Bürgernähe eingeführten“ ersten Direktwahl am 5. 9. des Jahres 2004 kehrten die wahlberechtigten Bürger den Kandidaten den Rücken zu und wählten die ’Abstinenz’, die Stimmenthaltung. So lag die Wahlbeteiligung damals bei 38,3%. Jetzt am 9. Juni des Jahres 2019 übertrafen die verantwortlichen politischen ’Strippenzieher’ das Ergebnis noch und wurden mit einer Wahlbeteiligung von 33,3% belohnt. Es muss klar gesagt werden, dass eigentlich in einer funktionierenden Demokratie, ein solches Wahlergebnis eine Schande ist! 67,7% aller Bürger in Saarbrücken, sehen sich nicht durch die von den Parteien präsentierten KandidatenInnen repräsentiert. Hier sei deshalb nochmals an den französischen Demokratietheoretiker Jean Jacques Rousseau erinnert, der die Legitimation im Amt bei einem ’Mehrheitsvotum’ fixiert.

Die Auswahl der Kandidaten um den Job ’Oberbürgermeister’ bei der Vorrunde am 26. Mai 2919, wobei dessen Grundgehalt bei (Besoldungsgruppe B7, Grundgehalt 8.745,43 Euro monatlich) liegt, war auch stark ernüchternd. Wie damals vor 15 Jahren Hecken und Britz überboten sich die aktuellen ’Restkandidaten’ aus CDU und SPD gegenseitig mit ihrem politischen Traumprogramm für Saarbrücken! Die im OB-Amt ergraute SPD Kandidatin Charlotte Britz versprach „100%“ (Siehe: Plakatwerbung), wobei jeder Saarländer weiß: MO=6%, DI=30%, MI=35%, DO=25 und endlich FR=4% SA und SO sind bekanntlich frei! Die Argumentation des Herausforderers von der CDU war in seiner Logik jedoch absolut bestechend, wobei der jungfrische Dreamboy Uwe Conradt erklärte: „Uwe ist Saarbrücker, Uwe kann es, Uwe will es, Uwe bindet Dich ein, Saarbrücken braucht den Wechsel!“ (Siehe Wahlwerbung: Uwe Conradt Oberbürgermeister für Saarbrücken). Nach diesen unverfälschten, typisch treudoof-saarländischen aber inhaltlosen Parolen folgte konsequent die Aufforderung von UWE an die Bürger: „Geh zur Wahl!“ und natürlich: „Wähl Uwe Conradt! Uff! Dieser Aufforderung kamen die „Mehrheit“ der 33,3% (33,3 : 2= 16,65%) oder 50,3% Saarbrücker nach, während sich Frau Britz mit 49,7% geschlagen geben muss. Der Stimmenunterschied zwischen beiden OB-Kandidaten war mit „274“ Wählerstimmen knapp, aber eindeutig (Siehe: www.SR-mediathek.de)!

Doch welch ein Jubel in der Mainstreampresse über dieses ach so blamable Wahlergebnis! Von nur runden 17% der gesamten Wählerschaft wurde dieser Kandidat in Saarbücken bestimmt. Ein neuer Tiefpunkt in der Demokratie ist erreicht! Die Wahl war zwar legal, der gewählte Kandidat hat jedoch keine demokratische Legitimation erreicht! Doch wen interessiert schon die Ansicht von J. J: Rousseau, wenn es um Amt und Würden geht! Und natürlich wird der so Gewählte sein Amt annehmen. Ob es aber für Saarbrücken und die Demokratie nicht besser wäre, das Amt des Oberbürgermeisters wieder aus dem Stadtrat heraus zu vergeben, dieser Rat sei den politisch Verantwortlichen von Saarbücken und dem Saarland wie schon 2004 nochmals gegeben.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————-

Grafikquelle         :

Scharf – Links              —       Bildmontage: HF

Abgelegt unter Kommunalpolitik, Medien, Saarbrücken, Überregional | 1 Kommentar »

Einfach Rassismus in Köln

Erstellt von DL-Redaktion am 6. Juni 2019

Polizei fixiert Unschuldige in Köln
Rennende Muslime? Gefährlich!

Hbf Köln Eingangsbereich.jpg

Von Sibel Schick

In Köln wurden zehn Muslime in der Wahrnehmung von Fahrgästen am Bahnhof zur Terrorgefahr. Dabei wollten sie nur ihren Zug erreichen.

Wer kennt das nicht: Es ist Weihnachten, Familienbesuche. Eigentlich hat man keine Lust, aber was muss, das muss. Fertiggemacht, losgefahren, die Zeit aber doch unterschätzt und am Hauptbahnhof muss man rennen, um schnell noch den Zug zu bekommen.

Ja, alle kennen das. Aber nicht alle machen dieselbe Erfahrung, wenn sie es eilig haben. Zumindest nicht in Deutschland. So sperrte am Dienstag die Polizei beide Ausgänge des Kölner Hauptbahnhofs und fixierte zehn „verdächtigte“ Männer auf dem Boden, nur um herauszufinden, dass es keine Terroristen sondern ganz normale Typen waren. In einem Tweet erwähnt die Polizei Köln, dass die Männer „im Laufschritt“ unterwegs waren. Warum soll das Rennen an einem Bahnhof verdächtig sein? Weil es Muslime sind, die rennen und dabei noch weiße Gewänder tragen. Mehr trägt die Polizei zur Begründung nicht vor. Ganz so als wäre es selbsterklärend, worin das „Missverständnis“ liegen könnte.

An jenem Tag handelte es sich um den ersten Tag des Ramadan-Festes am Ende der Fastenzeit in einem der drei Heiligen Monate des Islams. Es ist Tradition, sich an Festtagen schick anzuziehen und Verwandte zu besuchen. In meiner Kindheit war es üblich, dass Kinder „Bayramlık“ geschenkt bekamen – schicke Kleidung extra für die Festtage. Ein Blick auf die betroffenen Männer reicht aus zu verstehen, dass es genau darum ging. Auf dem Foto, das die Bild in ihrer Meldung einbettete, sieht man einen jungen Mann von hinten, der mühsam frisiert, und sauber und frisch angezogen ist. Er trägt eine traditionelle Weste, die man von Festtagen und Hochzeiten kennt.

Estación central de Colonia.JPG

Stellen Sie sich vor: Sie machen sich schick für einen festlichen Besuch und werden gerade deshalb mit Gewalt auf den Boden geschmissen. Es sollen andere Bahnfahrer*innen gewesen sein, die die Polizei alarmierten. Sie sahen also festlich gekleidete Männer und dachten gleich an Terroristen. Wir wissen nicht, wer diese Männer sind. Es ist gut möglich, dass es Deutsche sind. Deutsche, die in Deutschland geboren und aufgewachsen sind, arbeiten gehen, Steuern zahlen.

Rassistische Karikatur

Laut einer Rechnung des Bamf aus 2015 lebten dato circa 4,7 Millionen Muslim*innen in Deutschland, darunter auch Deutsche. Auch wenn das Grundgesetz das Deutschsein mit der Staatsangehörigkeit begründet, herrscht in der Mehrheitsgesellschaft ein anderes Bild: Deutsche sind jene mit blonden Haaren, blauen Augen, heller Haut und angeblich keiner Zuwanderungsgeschichte. Wer außerhalb dieser Beschreibung bleibt, ist entweder minderwertig oder gefährlich. Rassismus wie aus dem Schulbuch.

Quelle        TAZ           >>>>>           weiterlesen

———————————————————————

Grafikquellen         :

Oben        —          Eingangsbereich des Kölner Hauptbahnhofs

Abgelegt unter Köln, Kriminelles, Kultur, Religionen | Keine Kommentare »

Kommentar EU-wahl 2019

Erstellt von DL-Redaktion am 4. Juni 2019

Denk ich an Europa in der Nacht…

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Quelle       :         AKL

Kommentar zur Europawahl 2019 von Jürgen Aust

Sie waren sich nahezu alle einig:  diese Wahl wird eine „Schicksalswahl“, die uns alle zu einer großen europäischen Familie zusammenschweißen muss. Flammende Appelle von Gewerkschaften, den Parteien bis zu den großen Kirchen, die das Wahlvolk auf eine gemeinsame Botschaft einschwören sollten:  nur Europa verheißt uns eine lebenswerte und friedliche Zukunft. Man fühlte sich an den historischen Ausruf von Kaiser Wilhelm II. erinnert: ich kenne keine Parteien mehr, ich kenne nur noch Deutsche. Mit einer „Allianz für Weltoffenheit“ rief in seltener Einmütigkeit eine ganz große Koalition aus Gewerkschaftern, Arbeitgebern, Kirchen und Kukturschaffenden zur Europawahl auf: „Stärken wir mit unserer Stimme eine Europäische Union, die für Demokratie, Weltoffenheit, Solidarität, nachhaltiges Wirtschaften und Wohlstand steht!“ Auch die obersten Kirchenfürsten wie Reinhard Marx (Vors. der Deutschen Bischofskonferenz) wollten bei diesen gemeinschaftsstiftenden Appellen nicht abseits stehen, wenn er deklamierte: „Die Europäische Union ist ein einzigartiges Friedensprojekt und eine starke Wertegemeinschaft.“ Da das Kapital und seine Parteien sich seit vielen Jahren auf „ihre“ Gewerkschaftsführungen verlassen können, wenn es um das große Ganze geht, wollte auch der DGB-Vorsitzende Reiner Hoffmann sich als guter Europäer erweisen, wenn er empathisch erklärte: „Nur gemeinsam können wir die großen Umbrüche unserer Zeit …. erfolgreich bewältigen. Dafür brauchen wir ein soziales Europa, das die Menschen schützt….Und wir müssen Europa schützen vor denen, die heute mit ihren nationalistischen Parolen wieder nach neuen Grenzzäunen schreien.“

Doch am Abend des 26. Mai 2019 kam aufgrund des Wahlergebnisses statt Euphorie eine massive Katerstimmung auf, als die ersten Hochrechnungen den Groko-Pateien deutliche Verluste bescherten. Während die CDU/CSU mit 28,9% noch mit einem blauen Auge davon kam, stürzte die SPD mit lediglich 15,8% regelrecht ab. Auch die Linkspartei musste ihre Wunden lecken, da sie mit lediglich 5,5% noch deutlich unter dem Ergebnis von 2014 (7,4%) lag. Im Gegensatz dazu hielt sich der befürchtete Aufwind der AfD mit 11% im deutlichen Unterschied zu den Ergebnissen der Rechtsparteien in Frankreich, Italien oder Großbritannien in Grenzen. Doch der Medienhype hofierte am Wahlabend hauptsächlich Die Grünen, die mit 20,5% (+ 9,8% im Vergleich zu 2014) der eigentliche Gewinner dieser Europawahl sind und bei einer aktuellen Wahlumfrage mit 25% sogar erstmals stärkste Partei. Dass die Grünen derart zulegen konnten, dürfte ihre zentrale Ursache darin haben, dass sie im Gegensatz zu allen anderen Parteien bei ihren Medienauftritten und in der Außenwerbung die Europawahl zur „Klimawahl“ gemacht haben und die (insbesondere auch jüngeren) Wähler*innen ihnen dafür ihr Vertrauen schenkten. Das kommt u.a. darin zum Ausdruck, dass sie bei den unter sechzig Jährigen zur stärksten Kraft wurden. Sie profitieren auch insbesondere davon, dass sie auf Bundesebene seit vielen Jahren keine Regierungsverantwortung mehr mittragen. Dass sie in vielen Bundesländern jedoch für die neoliberale Politik mitverantwortlich sind, wie z.B. beim Stuttgart21-Projekt, die Abholzung des Hambacher Forstes oder die Elbvertiefung in Hamburg, scheinen die Wähler*innen entweder nicht zu registrieren oder eher als kleineres Übel zu werten.

Auf gesamteuropäischer Ebene liegt das konservative Parteienbündnis der Banken und Konzerne, die EVP (Europäische Volkspartei), mit ca. 180 Sitzen deutlich vor der Sozialdemokratischen Allianz mit ca. 150 Sitzen und dem rechtsliberalen Bündnis ALDE, dem auch Macron’s Bündnis „En marche“ angehört, mit 109 Sitzen. Die Grünen konnten auf europäischer Ebene ihre Sitze im Europaparlament zwar auf 69 Sitze (2014: 50 Sitze) erhöhen, blieben aber mit insgesamt lediglich 9,19% deutlich unter ihrem deutschen Ergebnis. Die Ursache dafür liegt darin, dass sie in 13 EU-Staaten überhaupt keinen Sitz und in weiteren 8 Staaten lediglich ein bis zwei Sitze erringen konnten. Das linke Bündnis GUE/NGL hat auf der europäischen Ebene mit lediglich 5,06% deutliche Einbußen zu verzeichnen und und hat im neuen Europa-Parlament nur noch 38 Sitze (2014: 52 Sitze), da zahlreiche linke Parteien wir z.B. die holländische SP völlig leer ausgingen. Auch wenn die extreme Rechte mit ihren Wahlsiegen in Frankreich, Italien und Großbritannien deutliche Stimmenzuwächse zu verzeichnen hat, liegt sie mit ca. 23% der Sitze doch deutlich unter dem, was das pro-europäische Lager in Allianz mit allen bürgerlichen Medien an Gefahren heraufbeschworen hatte, um nahezu vor dem Untergang des wertebasierten Abendlandes zu warnen.

Der eigentliche Wahlsieger der Europawahl ist jedoch ein breites Bündnis für die Fortsetzung neoliberaler Politik in der EU. Dieses Bündnis (einschließlich Sozialdemokratie und auch den Grünen) steht weiterhin für mehr Militarisierung und westliche Kriege, mehr Frontex und Absicherung der europäischen Außengrenzen, eine repressive Asyl- und Migrationspolitik sowie, und das ist das Entscheidende, die Absicherung der Macht der Banken und Konzerne. Dass sowohl die deutschen Gewerkschaften („Europa. Jetzt aber richtig!“), als auch der Europäische Gewerkschaftsbund diese desaströsen politischen Zustände bzw. Entwicklungen in ihren flammenden Europa-Bekenntnissen nahezu tabuisieren, ist nahezu ein politischer Skandal und lässt erahnen, was auf uns zukommt, wenn die Kriegsgelüste der deutschen Besitz- und Machteliten stärker werden sollten.

Was bedeutet das Wahlergebnis für die LINKE ?

Zweifellos hat die LINKE einen engagierten Wahlkampf gemacht, der aber einmal mehr die Frage aufwirft, warum ist dann das von Parteichef Riexinger vorgegebene Wahlziel von 10% noch nicht einmal annähernd erreicht worden? Eine differenzierte Analyse sollte zunächst einmal feststellen, dass die LINKE in nahezu allen westlichen Bundesländern an absoluten Stimmen deutlich zulegen konnte, während sie in allen östlichen Bundesländern einschließlich Berlin massiv eingebrochen ist. Die LINKE ist also in den Bundesländern, in denen sie sich in Regierungskoalitionen befindet, deutlich abgestraft worden und zwar sowohl prozentual, als auch nach absoluten Stimmen. Im einzelnen: in Thüringen von 22,5% auf 13,8% (- ca. 60.000), in Brandenburg von 19,7% auf 11,3% (- ca. 36.000) und in Berlin von 16,2% auf 11,9% (- ca. 10.000). Ähnliche Abstürze erfolgten auch in den anderen östlichen Bundesländern. Auch wenn Europawahlen unter anderen Vorzeichen als Landtagswahlen stehen, lassen diese massiven Einbrüche doch offenbar den Schluss zu, dass die im Rahmen der Regierungskoalitionen stattfindende grundsätzliche Zustimmung zur neoliberalen Politik bei der Bevölkerung das Gefühl bzw. die Überzeugung auslösen, dass der immer wieder behauptete Richtungswechsel auch mit der LINKEN nicht eintritt und sich ihre Lebensverhältnisse nicht entscheidend verbessern.

Der Wahlkampf und das Ergebnis haben aber noch ein weiteres Dilemma der LINKEN deutlich gemacht: mit ihren zentralen Wahlkampfparolen war sie offenbar nicht in der Lage , sich als eine Alternative zu den herrschenden bzw. systemtragenden Parteien zu präsentieren. Denn ihre zentralen Slogans „Europa nur solidarisch“ oder „Macht Europa sozial“ bzw. „Wir kämpfen für ein wirklich demokratisches Europa“ hatten auch SPD oder Die Grünen in ihrem Repertoire, wenn es z.B. bei ihnen hieß „Für ein soziales Europa – Europa ist die Antwort“ (SPD) oder „Nur ein soziales Europa ist ein starkes Europa“ (Die Grünen). Und auch der Aufruf der LINKEN zur Teilnahme an den Demonstrationen am 19. Mai, zu denen auch SPD und die Grünen unter dem Motto „Ein Europa für alle – gegen Nationalismus“ aufgerufen hatten, war ein Bekenntnis dafür, dass wir alle in einem gemeinsamen europäischen Boot sitzen, wenn es um die angeblich nationalistische Hauptgefahr geht. Damit wird die LINKE nicht nur als Teil eines großen parteiübergreifenden Blocks zur Verteidigung der EU wahrgenommen, sondern sie versteht sich bedauerlicherweise auch in weiten Teilen der Partei selbst so. Und dann haben die zweifellos richtigen Themenplakate zum Kampf gegen Rechts, gegen die zunehmende Militarisierung oder gegen die zunehmende Verarmung breiter Bevölkerungsschichten nicht die Wirkung gehabt, die man sich von ihnen erhoffte.

Das Dilemma der LINKEN in der Europa-Debatte besteht aber darin, dass diese grundsätzlich pro-europäischen Orientierung sich von einer banalen sozialistischen Erkenntnis verabschiedet, nämlich dass die gesellschaftliche Spaltung nicht zwischen den Nationen bzw. den hier nationalen und dort internationalen Linien, sondern nach wie vor zwischen oben und unten verläuft. Der auch weiterhin bestehende Klassenwiderspruch zwischen Kapital und Arbeit wird entsorgt zugunsten einer pro-europäischen Schicksalsgemeinschaft, was schon immer mit dem Niedergang von ehemals kommunistischen bzw. sozialistischen Parteien verbunden war. Es reicht dann auch nicht, dass die LINKE in ihrem Europa-Wahlprogramm zwar auch die Politik der EU und ihrer Institutionen scharf kritisiert, jedoch im Ergebnis die EU mit Hilfe eines sog. „Neustarts“ retten will. Denn wenn diese EU in ihrer politischen Ausrichtung grundsätzlich zutiefst neoliberal, undemokratisch und militaristisch ist, dann lautet die richtige Konsequenz daraus, dass eine radikal linke Politik mit ihr brechen muss, statt quasi durch die Hintertür aus der EU dann doch wieder ein soziales und friedliches Projekt zu machen. Dieser Spagat kann nicht funktionieren und wird von den potentiellen Wählerinnen und Wählern, wie das Ergebnis der Europa-Wahl und zwar europaweit nahe legt, auch nicht honoriert.

Vorläufiges Fazit: eine Linke, die sich zumindest programmatisch als Systemalternative darstellt, muss deutlich radikaler die neoliberale Parteienlandschaft angreifen, da diese hauptsächlich für die ökonomischen und sozialen Verwerfungen und Katastrophen verantwortlich ist. Dazu müsste selbstverständlich auch die ständig zunehmende Militarisierung der EU gehören, die aber leider im Wahlkampf nur eine untergeordnete Rolle gespielt hat. Und schließlich ist es immer wieder eine Illusion zu glauben, dass es maßgeblich darauf ankomme, im Wahlkampf nur so viel Wahlzeitungen wie möglich zu verteilen und an jeder dritten Laterne ein Plakat aufzuhängen, dann würde sich der Erfolg schon nahezu automatisch einstellen. Eine radikale linke Politik muss vor allem außerhalb der Wahlkämpfe stattfinden, und zwar entschieden oppositionell und bewegungsorientiert, sonst macht die LINKE sich von dem herrschenden Parteienkartell nicht unterscheidbar. Aber darauf sollte es doch eigentlich entscheidend ankommen.

akl - Antikapitalistische Linke

————————————————————————–

Grafikquelle      :

Oben     —      Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom

Autor    —    Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg
  • Created: 10 May 2014

Abgelegt unter Europa, Nordrhein-Westfalen, P. DIE LINKE, Positionen | Keine Kommentare »

Linker Besuch in Venezuela

Erstellt von DL-Redaktion am 27. April 2019

Die seltsame Reise eines deutschen Linken-Politikers zu Maduro

Nicolás Maduro 2019 Inauguration.jpg

V

Die Bundesregierung erkennt Maduro nicht mehr als Venezuelas Staatschef an. Den Linken-Politiker Andrej Hunko schert das nicht.

Nicolas Maduro hat nicht mehr viele Verbündete, aber auf wen er sich verlassen kann, ist die deutsche Linke. Da die meisten Staats- und Regierungschefs einen großen Bogen um Venezuelas Machthaber machen, hat Maduro den in Deutschland eher unbekannten Linken-Abgeordneten Andrej Hunko nun wie einen Staatsgast empfangen, vor Fahnen beider Länder. „Wir hatten ein wichtiges Treffen, um die Beziehungen mit der europäischen Gemeinschaft zu stärken und  um die Anerkennung des internationalen Rechts zu fördern“, sagte Maduro nach dem Treffen.

Nun ist Hunko nicht gerade der Chef der EU-Kommission, aber immerhin europapolitischer Sprecher seiner Fraktion im Bundestag. Beide scherzen, wie auf Fernsehbildern zu sehen ist. Die staatlichen TV-Nachrichten berichten groß über das Treffen. Maduro liebt ja die Inszenierung, mal tanzt er Salsa oder wenn mal wieder der Strom ausgefallen ist, spielt er Föhngeräusche nach, um die Frauen dazu zu animieren, auf das Föhnen zu verzichten, um den Stromkollaps im Land mit den größten Ölreserven der Welt zu verhindern.

Und während viele hungernde Menschen zehn Kilogramm und mehr an Gewicht verloren haben, gönnte sich Maduro bei einem Besuch in der Türkei ein riesiges Steak, bei Starkoch Nusret Gökce („Salt Bae“), der auch das Goldsteak für Bayern-Fußballer Frank Ribery serviert hat. Ohnehin scheint der frühere Busfahrer mit dem markanten Schnäuzer in der Krise eher noch an Körperfülle zuzunehmen.

Recep Tayyip Erdoğan ist neben Russlands Präsident Wladimir Putin und Chinas Staatschef Xi Jinping sein wichtigster Verbündeter – und etwas in der Rangfolge dahinter nun offenbar Andrej Hunko. Der bezieht nun Prügel von Union, Grünen und SPD („skandalös“, „peinlich“), denn die Bundesregierung erkennt Maduro nicht mehr an, sondern unterstützt den Präsidenten des entmachteten Parlaments, Juan Guaidó, als Übergangspräsidenten.

A Miami protestor dressed as Maduro Jan 2019.png

Endlich ein Aufzug welcher zum Typen passt

Toma de Posesión de Presidente de Venezuela, Nicolas Maduro. (46702012471).jpg

Es  tritt sich – was sich treten läßt – ein Arschloch in das vor ihm gehende.

Aber immerhin: Den traf Hunko auch. Das wurde über das Auswärtige Amt und die Deutschen Botschaft in Caracas organisiert – die nach dem Rauswurf von Botschafter Daniel Kriener nur noch im eingeschränkten Betrieb arbeitet. Das Treffen mit Maduro wurde über die venezolanische Botschaft in Berlin eingestielt.

Die Sanktionen müssten gestoppt werden, so Hunko

Hunko bereist das Land seit dem 16. April für elf Tage. Da die Lufthansa schon 2016 die Flüge eingestellt hat, reiste Hunko mit TAP über Portugal in das Krisenland, aus dem bereits mehr als drei Millionen Menschen geflohen sind. Hunko betont, die Sanktionen gegen die Maduro-Regierung müssten gestoppt werden. Wie Maduro sieht er besonders die einseitige Anerkennung Guaidós durch viele westliche Staaten als völkerrechtswidrige Einmischung in innere Angelegenheiten – viele Linke fragen, warum man sich nicht ähnlich stark in innere Angelegenheiten wie zum Beispiel in Saudi-Arabien einmischt.

Und mit Blick auf US-Präsident Donald Trump, der auch die militärische Option offen  lässt, betont der 55-Jährige: „Eine Lösung der Krise kann nicht gewaltsam von außen herbeigeführt werden.“ Guaidós Ausrufung zum Interimspräsidenten nennt Hunko schlicht einen „Putschversuch“.

Nach dem außerordentlich kumpelhaften Treffen Hinterbänkler/Staatspräsident betont Hunko bilanzierend: „Wir hatten einen langen Austausch über die internationale Lage und insbesondere über die Erosion des Völkerrechts“, sagte Hunko mit Blick auf die Anerkennung Guaidos durch zahlreiche westliche Staaten.

So sind sie, die Politiker und wundern sich dann das sie niemand mehr wählt. Nach vielen Jahren des Hoffens, und einer Wahl zwischen Not und Elend werfen viele Bürger ihre Wahlbenachrichtigung direkt zum Altpapier.

Maduro habe die Unrechtmäßigkeit der Sanktionen und der Beschlagnahmungen venezolanischen Vermögens durch internationale Banken auf Druck der USA betont, „die die Lage im Land verschlimmert“; berichtete Hunko nach dem Treffen mit dem Sozialisten, der sich auch dank üppiger Zuwendungen an das Militär weiter an der Macht hält.

Und der steigende Ölpreis spielt ihm in die Karten. „Ich habe meinen Wunsch verdeutlicht, dass Venezuela keine No-Go-Area werden darf und dass ich deshalb erwarte, dass viele Abgeordnete, Journalisten und interessierte Menschen das Land in dieser schwierigen Zeit besuchen würden und sich ein umfassendes Bild der Lage machen“, sagte Hunko. Maduro habe gesagt, „alle sind willkommen.“

Zahlreiche Oppositionelle sitzen in Haft

Quelle        :          Der Tagesspiegel           >>>>>        weiterlesen

——————————————————————-

Grafikquellen         :

Oben        —       Nicolás Maduro holding his declaration after being sworn in for his second term

Unten         —      Andrej Hunko, 2014

Autor   –   Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deHinweise zur Weiternutzung
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -147.jpg
  • Erstellt: 21. Mai 2014

Abgelegt unter Medien, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

„Dr.“ Spahns W. – Regelung

Erstellt von DL-Redaktion am 9. April 2019

Rechtsaußen Spahn + Halblinker Lauterbach wollen Organspendeausweis und die Informationspflichten der Krankenkassen abschaffen!

WLP14-ri-0211- Kathrin Vogler (Die Linke), MdB.jpg

Quelle     :        Scharf  –  Links

Von Kathrin Vogler, MdB

Nach detaillierter und fundierter Analyse des am vergangenen Montag vorgelegten Gesetzesentwurfs zur Einführung der Widerspruchsregelung bei der Organspende, erklärt Kathrin Vogler MdB DIE LINKE und Mitinitiatorin eines interfraktionellen Gegenentwurfs:

„Nachdem der gesamte Gesetzestext vorliegt, habe ich mich detailliert damit befasst und stelle mit blankem Entsetzen fest, was jenseits der wohlfeilen Worte auf der Pressekonferenz darin verborgen ist. Bereits die Eckpunkte habe ich öffentlich kritisiert, doch Spahn und Lauterbach beweisen Schwarz auf Weiß: schlimmer geht immer!“

Kathrin Vogler erläutert: „Im bisherigen § 2, (1), Satz 1 des Transplantationsgesetzes ,sollen‘ die Bundeszentrale für gesundheitliche Aufklärung (BzgA) sowie die Krankenkassen über die Organspende aufklären. Die Soll-Bestimmung würde hier zwar zu ,haben‘ werden, was aber auch keine rechtsverbindliche Verpflichtung zur Folge hätte. Der Pferdefuß kommt jedoch später: Der alte §  2 (1a) soll gänzlich neu gefasst werden: Die Pflichten der Krankenkassen sind dort bislang ganz konkret verankert. Diese Vorgaben soll, geht es nach Spahn, Lauterbach u.a., ersatzlos entfallen. Damit würden auch die turnusgemäßen, im Detail formulierten Aufklärungspflichten der Krankenkassen komplett abgeschafft. Am Anfang des Paragraphen bleibt der schöne Satz und Anschein ohne jeglichen Umsetzungszwang und ohne weitere Bestimmungen.“

Kathrin Vogler weiter: „Das Organspenderegister, in dem nach Spahn, Lauterbach u.a. ein Widerspruch gegen die Organentnahme eingetragen werden müsste, würde für die Betroffenen nur auf dem Umweg über eine Behörde und ein Formular möglich sein. Eine eigenständige Eintragung und eventuelle Veränderung der Willenserklärung wäre damit nicht möglich. Die Behörden sollen zudem auch keine Informationen mehr bereithalten. Alle Menschen würden also zunächst der Annahme und dem Zwang unterfallen, sie seien nach ihrem Tod Organspender, nur die  Eintragung eines Widerspruchs in das Register kann davor schützen.“

Kathrin Vogler hebt hervor: „In dieser Logik ist es schlüssig, dass der Gesetzesentwurf das Ziel hat, möglichst wenige Menschen in das neu einzurichtende Register aufzunehmen. Dass er die Hürden für einen Widerspruch so hoch hängt, korrespondiert mit der Streichung der ,informierten und unabhängigen Entscheidung jedes Einzelnen‘ aus der Zielsetzung des jetzigen Transplantationsgesetzes in §1 (1).

Kathrin Vogler kritisiert scharf: „Bei dem Gesetzentwurf von Spahn, Lauterbach u.a. stört der bekannte Organspendenausweis, der bislang in § 2 (5) geregelt ist und als Mittel der Selbstbestimmung dient. Der Organspendeausweis soll ersatzlos gestrichen und damit abgeschafft werden. In einem neu geplanten § 25a wird die Ausgabe von Organspendenausweisen definitiv zu dem Zeitpunkt eingestellt, an dem das Transplantationsregister eingerichtet ist.“

Kathrin Vogler problematisiert: „Wenn man 16 Jahre alt ist und im Übrigen noch nicht einmal den Bundestag wählen darf, wollen Spahn, Lauterbach u.a. die Jugendlichen innerhalb eines halben Jahres gleich drei Mal mit einer Papierflut zuschütten. In diesem Alter denkt man kaum an den Tod, die Jugendlichen müssen sich jedoch, da weder Hausärzte noch Krankenkassen mehr kontinuierlich informieren, schriftlich gegen die staatliche Inanspruchnahme ihrer Organe aktiv zur Wehr setzen. Die bereits über 16-Jährigen, also alle Erwachsenen, würden ebenfalls nur unmittelbar nach Inkrafttreten des Gesetzes informiert, weil ja die regelmäßigen Aufklärungspflichten der Krankenkassen entfallen. Besonders perfide ist ist es ferner, dass Aufklärung über die Organspende auch nicht mehr ,ergebnisoffen‘ erfolgen soll, wie es bisher noch der Fall ist. Es geht also nicht mehr um Aufklärung, sondern um Manipulation.“

Kathrin Vogler betont: „Angehörige von hirntoten Menschen würden nicht mehr das Recht haben, einer Organentnahme zu widersprechen, wenn ihnen kein entsprechender Wille ihres Verstorbenen bekannt ist. Die Bezeichnung ,doppelte Widerspruchslösung‘ ist also schieres Polit-Marketing,  das eine nicht vorhandene Sicherheit vorgaukeln soll.“

Kathrin Vogler abschließend: „Der gesamte Gesetzesentwurf basiert auf dem Motto: Möglichst gar nicht über das Thema (insbesondere das Hirntod-Konzept) aufklären und die Hürden für einen Widerspruch möglichst hoch hängen, so dass möglichst viele ihren Widerspruch nicht artikulieren. Damit wäre der Freifahrtschein für die Organentnahme nach ihrem Tod ausgestellt. In dieser zutiefst sensiblen Frage mit Desinformation und Manipulation zu arbeiten, wie Jens Spahn, Karl Lauterbach u.a. es tun, ist schlicht schäbig und wird auch keine Mehrheit im Bundestag finden.“

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

Zum Thema auf DL :    Töten ein Staatsmonopol !!

—————————————————————-

Grafikquelle      :     Kathrin Vogler (Die Linke), MdB

Abgelegt unter Bundestag, Gesundheitspolitik, Nordrhein-Westfalen, P. DIE LINKE | Keine Kommentare »

Polizeiskandal in NRW

Erstellt von DL-Redaktion am 6. April 2019

An der Wand​

2019-01-23-Herbert Reul-Maischberger-1544.jpg

Herbert Reul, hört ihr sein Geheul ?

Von Andreas Wyputta

Manipulationsvorwürfe, ein erneut verschleppter Kindesmissbrauchsskandal: NRW-Innenminister Herbert Reul (CDU) muss um sein Amt kämpfen​.

Nordrhein-Westfalens CDU-Innenminister Herbert Reul gerät wegen Polizeiversagens und Manipulationsvorwürfen immer stärker unter Druck. Im Innenausschuss des Landtags musste Reul am Donnerstag Nachmittag einräumen, dass Nordrhein-Westfalens Polizei nach dem tausendfachen sexuellen Missbrauch auf einem Campingplatz im ostwestfälischen Lügde in einem zweiten Fall von Kinderpornografie massiv geschlampt hat.

Außerdem könnten Beamte bei Ermittlungen gegen den grundlos inhaftierten und in seiner Zelle verbrannten syrischen Bürgerkriegsflüchtling Amad. A. IT-Systeme der Polizei manipuliert haben, um seine Festnahme nachträglich zu rechtfertigen.

Im Mittelpunkt des zweiten Kinderpornografie-Skandals steht ein Physiotherapeut und Heilpraktiker aus Bad Oeynhausen: Während Behandlungen soll er pornografische Fotos von mindestens zwei Kindern gemacht haben. Schon im November 2017 hatte ein IT-Spezialist aus Baden-Württemberg, der die Bilder bei einer Fernwartung der Rechner des 60-Jährigen fand, die Polizei alarmiert.

Hausdurchsuchungen scheiterten

Doch in Haft sitzt der Physiotherapeut erst seit einer Woche: Bei der zuständigen Kriminalpolizei Minden-Lübbecke passierte zunächst monatelang nichts, dann scheiterten drei Durchsuchungsversuche – weil der Beschuldigte nicht zu Hause war.

Beim vierten Anlauf fand die Polizei prompt „umfangreiches Beweismaterial“. Dass bis dahin 16 Monate vergingen, erklären die Beamten mit dem Hinweis, sie hätten den Beschuldigten persönlich antreffen wollen – schließlich habe der Kinderporno-Dateien auch auf seinem Mobiltelefon mit sich herumtragen können.

Rosenmontagszug Köln 2019-6212.jpg

(Perlen) Kamelle unter die Säue werfen !

Innenminister Reul hält das für einen „klaren Fehler“: Die Ermittlung hätte „höher priorisiert“ werden müssen, klagt er. Parallelen zum Skandal von Lügde, in dem mittlerweile gegen acht Beschuldigte ermittelt wird, die mindestens 40 Opfer missbraucht haben sollen, sind damit unverkennbar: Dort waren zwischen ersten Hinweisen und Festnahmen sogar 17 Jahre vergangen.

Verdacht der nachträglichen Fälschung

Quelle    :        TAZ        >>>>>       weiterlesen

——————————————————————

Grafikquellen      :

Oben      —        Herbert Reul in der WDR-Sendung „Maischberger“ am 2019-01-23

Abgelegt unter Innere Sicherheit, Nordrhein-Westfalen, P.CDU / CSU, Überregional | Keine Kommentare »

Die Atom-Mafia …

Erstellt von DL-Redaktion am 22. März 2019

… lügt sich in die Klimabewegung

'Balletje balletje' Parijs.jpg

Quelle         :    Scharf – Links

Von Walter Schumacher

Ein Versuch mit Fake-News die „FridaysForFuture“-Bewegung zu spalten

In Aachen kursieren aktuell im Netz panikartige Fragen, ob denn die Atomkraft WIRKLICH ein Mittel gegen den Klimawandel sein könnte?

Ein link auf eine Seite der Atom-Lobby-Gruppe „Nuklearia.de“ wird verschickt, auf dem mit Logos und Namen von KlimaktivistInnen operiert wird, ohne dass irgendeine Berechtigung dafür besteht.

Hier kommt ein Nachteil der eigentlich doch sehr charmanten, ungeregelten Strukturen der freien AktivistInnen zum Tragen, bei denen es eben keine Führungsebenen oder juristisch einklagbare Rechte gibt. Das haben sich die professionellen und gut bezahlten Atommafiosi bzw. ihre Lobbygruppen zunutze gemacht und versuchen aktuell zu verwirren.

Vorweg: Das was im Folgenden dokumentiert wird, ist sicher KEINE relevante Meinung oder Strömung in der Klimabewegung!! Das ist entweder ein reiner FAKE, eine kommerzielle Auftragsarbeit – und/oder etwas von staatlichen Diensten lanciertes, um die Klimabewegung zu spalten.

 Aber die KlimaaktivistInnen müssen WISSEN, WIE diese Mafia uns verwirren will!!
==> Warnt also bitte eure Kontakte vor diesem Unsinn!
( Es gibt leider schon x-mails – selbst von kritischen Leuten – die darauf reingefallen sind!)

==> Dann zwei Hinweise auf Argumente zur Klimabelastung von AKWs:
1. Ganz unten ein Text unserer belgischen Freunde (unten)
2. Hier ein link auf einen Flyer „Atomkraft ist kein Klimaretter“  von „ausgestrahlt“

Hier der Text der Atom-Lobby:

Greta, go nuclear!
Veröffentlicht am 2019-03-14 von Rainer Klute

Die #FridaysForFuture-Bewegung streikt gegen Treibhausgas-Emissionen und gegen den Abbau von Kohle, Öl und Gas. Wie sich das erreichen lässt, verrät eine neue Postkarte des Nuklearia e. V.

»Greta, do nuclear« fordert die Nuklearia-Postkarte und empfiehlt Kernkraftwerke als wirksamste Waffe gegen den Klimawandel.

Warum das so ist, erläutert die Postkarte auf der Rückseite: Kernkraftwerke produzieren CO2-freien Strom, kommen mit minimalem Platz aus und garantieren eine umweltverträgliche, sichere und bezahlbare Stromversorgung. Industrieländer, die auf eine Kombination von Kernenergie und Erneuerbaren setzen, erreichen ihre Klimaziele besser als Deutschland.
Daher lauten die Forderungen der Nuklearia:
•    Lasst die Kohle in der Erde!
•    Weg mit dem Atomausstieg! Wir brauchen moderne Kernkraftwerke!

Hier der Werbetext (als Postkarte) der Nuklearjünger:

— Hier ein INHALTLICHER Text zur Wirklichkeit der CO2-Emmission durch Atomkraftwerke (von unseren belgischen Freunden) —

Atomkraft als “Rettung des Klimas”?

Zur Zeit erleben wir in Belgien “erstaunlich Bewegung”, um das Klima zu retten; Es zeichnen sich eine Vielzahl von Vorschlägen aber auch Ablehnungen ab. Jeder versucht, die Aufmerksamkeit der Teilnehmer zu einem Gedankenaustausch anzuregen, manchmal konstruktiv, manchmal antagonistisch.

Im Kampf um das Klima gibt es mehrere Ansatzpunkte: Die wichtigsten sind Industrie, Dämmung, Verkehr, Landwirtschaft und Stromerzeugung. Im Bereich der Stromerzeugung gibt es einen breiten Konsens, die Nutzung von Kohle und Öl – den umweltschädlichsten fossilen Brennstoffen – zu verurteilen. Erdgas, auch fossiler Herkunft, produziert deutlich weniger CO2 pro Kilowattstunde (kWh) und könnte die Zeitlücken überbrücken, die die aktuellen Erneuerbaren je nach Wind und Sonnenschein hinterlassen.

FridaysForFuture Hamburg (cropped 2).png

Pro-Atom Strömungen haben in jüngster Zeit “klimafreundliche” Tugenden bei den Atomreaktoren entdeckt und versuchen nun, die Nukleartechnik als eine Variante im Kampf gegen die Klimakatastrophe zu etablieren.

Was ist davon zu halten? Wir stellen elf Argumente vor:

1. Atomkraft erzeugt auch CO2, ist also keineswegs CO2-frei.

Atomkraft ist nicht CO2-emissionsfrei! Derzeit wird während des gesamten Lebenszyklus von spaltbarem Material – also von der Mine bis zum Abfall – zwischen 88 und 146 g CO2 durch Kernmaterial emittiert, viel mehr als Wind (10 g), Photovoltaik (32g) oder Geothermie (38g),. Der CO2-Ausstoß ist vergleichbar mit einem Gaswerk des Typs ‚Turbine Gas Steam‘ (TGV). Die thermische Verunreinigung von Druckwasserreaktoren ist nicht unerheblich: Nur ein Drittel der Wärmeenergie des Reaktors wird in Strom umgewandelt, die restlichen zwei Drittel werden in Form von Wasserdampf in die Atmosphäre, den angrenzenden Fluss oder Meer ausgestoßen.

2. Die Atomkraft hat nur einen bescheidenen Platz bei der globalen Energieversorgung.

„Nuclear“ werden weltweit nur 10% des Stroms und weniger als 5% der Gesamtenergie produziert. 85 Prozent der weltweiten Energie stammt aus Öl, Kohle und Gas. Auf globaler Ebene betrachtet, könnte die Atomkraft gleichzeitig mit Fossilien aufgegeben werden. In Belgien, das heute bei seiner Stromversorgung zur Hälfte von Atomkraft abhängig ist, wird es einen mehrjährigen Plan brauchen, um aus der Atomkraft auszusteigen, ohne den Haushalten das Recht auf Strom zu entziehen.

3. Die Atomenergie verunreinigt die Umwelt und das Trinkwasser.

Die Atomindustrie erzeugt für jedes Kilo spaltbares Material pro Jahr 4 bis 5 Tonnen Uranabfälle. Ein Teil davon vergiftet Erde, Luft und Trinkwasser. Die Reaktoren produzieren weltweit 10.500 Tonnen verstrahltes Kernbrennstoffe sowie eine Vielzahl weiterer radioaktiver Abfälle und Emissionen. Reaktoren benötigen für ihre Kühlsysteme gigantische Mengen Wasser, bis zu 4.000 Millionen Liter Wasser pro Tag, was die Trinkwassermenge reduziert und die aquatischen Ökosysteme schädigt.

4. Die Atomkraft ignoriert die Menschenrechte und das Recht auf Land.

Die meisten Uranminen befinden sich in Gebieten, die von indigenen Völkern, Ländern der Dritten Welt oder einkommensschwachen Bevölkerungen bewohnt werden. Strahlen sind für Frauen und Mädchen im Vergleich zu Männern doppelt schädlich. Und sie sind besonders schädlich für Föten und Babys, deren Pflege meist in der Verantwortung der Frauen liegt.
Radioaktive Verseuchung wird der Umwelt (und den Menschen) für Hunderttausende von Jahren schaden.

5. Die Atomenergie blockiert den Einsatz erneuerbarer Energien.

Die Kernkraft benötigt direkte und indirekte hohe Subventionen. Dabei handelt es sich um Finanzierung, Forschung und Entwicklung, Steuervorteile, Verlagerung der Haftpflichtversicherung, staatliche Versicherung, und letztendlich die Sorge um die von Abfällen und den Abbau der AKW durch die Allgemeinheit: Die Liste ist nicht vollständig. All dies lenkt das Eingreifen des Staates von dem Feld ab, wo es wirklich nützlich wäre: Die Suche nach erneuerbaren Energiequellen.

6. Atomkraft ist gefährlich.

Katastrophen wie Three Mile Island (1979), Tschernobyl (1986) und Fukushima (2011) untergraben eine nationale Wirtschaft oder können sie sogar stoppen, unerwünschte politische Instabilität schaffen und die Energiepolitik zum Scheitern bringen, die eigentlich notwendig wäre, um der Klimakatastrophe entgegenzuwirken. In Belgien steht das AKW-Doel mit vier Reaktorblöcken nur 12 km vom Grote Markt in Antwerpen entfernt. Es stellt in einer potenziell gefährlichen petrochemischen „SEVESO“-Zone eine ständige Bedrohung auch für unser Land dar. Die durch Risse geschwächten Atomreaktoren Doel 3 und Tihange 2 müssen sofort und endgültig schließen!

7. Die ‚zivile Atomenergie‘ ist untrennbar mit dem Militär verbunden.

Die Druckwasserreaktoren wurden ursprünglich aus den Anlagen der nordamerikanischen U-Boote entwickelt, aber auch von den Erkenntnissen aus den Atombomben Hiroshima und Nagasaki abgeleitet. Die Wiederaufbereitungsanlagen liefern aus dem Abfall der zivilen AKW die Materialien, um Atombomben herzustellen. Oft werden militärische Argumente vorgeschoben, um dadurch nuklearen Probleme als „Verteidigungsgeheimnis“ zu verschleiern und die Einrichtungen vor der Öffentlichkeit geheim zu halten. Zwanzig US-Atombomben sind in Kleine-Brogel (unweit von Roermond) stationiert, unter dem Befehl des obersten Befehlshabers der US-Armee: Präsident Trump.

8. Atomenergie ist teuer für Haushalte.

Weil die zwei Firmen ENGIE-Electrabel und 10% mit Anteil EDF-Luminus ALLE belgischen Atomkraftwerke besitzen, und weil diese die Hälfte des belgischen Stroms produzieren, können die beiden Unternehmen den Strompreis bestimmen, ohne dass eine Konkurrenz sie daran hindern kann. Der Strompreis für private Haushalte ist sehr hoch, während die Großindustrie von einem niedrigen Tarif profitiert, um zu verhindern, dass Wettbewerber (ws: welche denn ??) auf den Markt kommen. Der freie Markt funktioniert in der Praxis nicht.

9. Die Atomkraft bedroht unsere demokratischen Rechte.

ENGIE-Electrabel hat eine so große finanzielle Macht und einen so starken Einfluss auf den Strom-Markt, dass das Unternehmen vom Parlament schon verabschiedete Gesetze ignorieren kann, oder sogar die Gestaltung von Gesetzen so beeinflussen kann, dass diese ihren Interessen entsprechen. So schreibt das Gesetz aus dem Jahr 2003 den Ausstieg aus der Atomkraft dadurch vor, dass die Atom-Reaktoren nach 40 Betriebsjahren stillgelegt werden müssen. Und dann wurde die Laufzeit der drei Reaktoren, die diese 40 Jahre erreicht haben, auf einmal um zehn Jahre verlängert! Es wurde ein Sondergesetz verabschiedet, um das vom Staat getragene nukleare Risiko festzuschreiben (Pariser Konvention 1960, belgisches Gesetz 1964-85). Die Bundesagentur für Atomsicherheit (FANC) ist nicht in der Lage, notwendige Kontrollen in den AKW durchzuführen. Und selbst eine Menschenkette von 50.000 Menschen zwischen Tihange und Aix (Juni 2017) sowie eine Petition von 500.000 Unterschriften (übergeben Juli 2018) haben für unsere Behörden bisher keine Auswirkungen gehabt.

10. Atomkraft ist schlecht für die Gesundheit.

In jeder Phase der Erzeugung von Atomstrom, in jedem Schritt des „nuklearen Lebenszyklus“ kann die Gesundheit von Mensch und Tier langfristig beeinträchtigen werden. Dabei handelt es sich vor allem um Krebserkrankungen wie Schilddrüsenkrebs oder Leukämie, aber auch um andere Krankheiten und genetische Probleme wie angeborene Fehlbildungen; selbst bei minimalen Dosen aber langer Strahlungsexposition.

11. Die Atomkraft ist zu „langsam“.

Der Bau neuer Reaktoren – die weniger gefährlich als die aktuellen Modelle wären – ist deutlich zu langsam, um die Klimaherausforderung zu bewältigen, wenn die bestehenden Reaktoren endgültig in 2025 abgeschaltet würden. Das geplante AKW Flamanville EPR, dessen Inbetriebnahme in 2011 für den Preis 2,5 Milliarden € erwartet wurde, soll nun 2020 – und jetzt zu einem Preis von 11 Milliarden Euro! – angeschaltet werden.

Fazit: Lösungen für die Klimakatastrophe sind leicht zu finden …

… Und schwer anzuwenden.
Eine schnelle und sozial gerechte Lösung für die Klimaherausforderung wäre es, die Produktion von fossiler UND von nuklearer Stromerzeugung zu beenden.
Es ist stattdessen notwendig, ein intelligentes Netz zu etablieren, das es ermöglicht, die zwölf Quellen erneuerbarer Energien: den Wind, das Meer, die Sonnenstrahlen, die Erdwärme, die Energie der Flüsse hinzuzufügen, damit sie sich gegenseitig die Lücken füllen. Der Einsatz von Elektrizität muss reduziert werden, indem unnötige und sogar schädliche Nutzung beseitigt und die Effizienz von Strom in allen Anwendungen erhöht wird.

Wir sind hier, wir sind laut, weil ihr unsere Zukunft klaut, Berlin, 25.01.2019 (cropped).jpg

 Wir nennen das die „Negawatt“, also die 30% der Stromnutzung, der überflüssig ist.
All dies muss Teil eines gesellschaftlichen Plans der belgischen Elektro-Industrie sein, der sich über fünf Jahre erstrecken sollte und zig Milliarden Euro kosten wird. Ein solcher Plan ist zu wichtig, als dass er dem Verwaltungsrat der ENGIE in Paris übertragen werden sollte, der sich seit 2003 weigert, solche Ideen umzusetzen, damit dadurch der von unserem Parlament beschlossene Atomausstieg bewältigt werden kann.
Die Bürger müssen gemeinsam ihre Bedürfnisse und die Mittel bestimmen, um sie umzusetzen. Inzwischen müssen die gefährlichsten Reaktoren, Doel 3 und Tihange 2, sofort und dauerhaft abgeschaltet werden.
Leo Tubbax – Sprecher Nucléaire stoppt Kernenergie – 06.03.2019

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/

—————————————————————-

Grafikquellen      :

Oben     —     Hütchenspieler unter uns?     —   Shell Game

Abgelegt unter Deutschland, Kriegspolitik, Nordrhein-Westfalen, Positionen, Umwelt | Keine Kommentare »

UAA – Urenco Gronau

Erstellt von DL-Redaktion am 21. März 2019

Atomausstieg mit einer Ausnahme

Transportwaggons Urananreicherungsanlage Urenco Gronau.jpg

Aus Berlin, Gronau und Schüttdorf

Malte Kreutzfeldt und Andreas Wyputta

Kritiker fürchten, Uran von Urenco aus Gronau werde künftig militärisch genutzt. Eine dubiose Stellungnahme spricht dagegen.

Ein unscheinbares Gewerbegebiet im nordrhein-westfälischen Gronau zeigt, wie ernst der deutsche Atomausstieg zu nehmen ist. Neben einer Spedition, dem TÜV und dem Zentrallager des Lebensmittelhändlers Klaas & Kock breitet sich auf einem rund 60 Hektar großen Gelände die einzige Urananreicherungsanlage (UAA) der Bundesrepublik aus. Auf Grünflächen zwischen Stacheldraht und Überwachungskameras weiden Rinder. Am Tor der Anlage prangt das EMAS-Umweltsiegel der Europäischen Union.

Mit Umweltschutz aber hat diese UAA im Westmünsterland nichts zu tun. Die Atomfabrik an der niederländischen Grenze hat die Kapazität, mehr als 30 große Atomkraftwerke mit Brennstoff zu versorgen – das sind knapp 10 Prozent des Weltmarkts. Aus dem knapp 50.000 Einwohner zählenden Städtchen Gronau geht angereichertes Uran zur Weiterverarbeitung in die USA, nach Schweden, Brasilien, Südkorea – und in die rund 40 Kilometer entfernte Brennelementefabrik in Lingen im Emsland (siehe Kasten).

Beliefert werden auch die belgischen Bröckelreaktoren Doel und Tihange, in deren Druckbehältern Tausende Risse entdeckt wurden und die in Nordrhein-Westfalen für massive Unruhe sorgen – der Oberbürgermeister der Grenzstadt Aachen hat bereits Jodtabletten verteilen lassen, die im Fall eines Super-GAUs die Anlagerung radioaktiven Materials in der Schilddrüse verhindern sollen. Auch Tepco, verantwortlich für das japanische Katastrophen-AKW Fukushima, wurde vom hinter der UAA stehenden Urananreicherungskonzern Urenco versorgt. Und selbst mit Lieferungen für die Atomwaffen des US-Militärs wird die Gronauer Anlage immer wieder in Verbindung gebracht.

Wer aber glaubt, mit der Urananreicherung sei spätestens mit dem Abschalten der letzten deutschen Atomkraftwerke Isar 2, Neckarwestheim 2 und Emsland am 31. Dezember 2022 Schluss, irrt: Die UAA hat wie die Lingener Brennelementefabrik eine unbefristete Betriebsgenehmigung – und das soll nach Willen einer breiten Bundestagsmehrheit auch so bleiben. Ein von den Grünen eingebrachter Gesetzentwurf zur Änderung des Atomgesetzes und ein Antrag der Linken, die beide die Stilllegung der Anlagen zum Ziel hatten, wurde in der vergangenen Woche von CDU, SPD, FDP und AfD abgeschmettert.

„Bigott“ sei das, fand nicht nur Grünen-Fraktionsvize Oliver Krischer. Schließlich macht sich vor Ort nicht nur Nordrhein-Westfalens CDU-Ministerpräsident Armin Laschet, sondern auch die ebenfalls aus NRW stammende SPD-Bundesumweltministerin Svenja Schulze für eine Schließung der aus Gronau belieferten AKW Doel und Tihange stark.

Der aus Köln stammende CDU-Abgeordnete Karsten Möring, Mitglied im Bundestagsausschuss für Umwelt und nukleare Sicherheit, verweist dagegen auf die im Koalitionsvertrag von CDU und SPD vereinbarte Prüfung eines Brennstoffexportverbots, das die Lieferungen nach Belgien stoppen soll – doch ob überhaupt ernsthaft geprüft wird und wann ein Exportverbot umgesetzt werden könnte, ist fraglich. Dafür spricht, dass Möring gleichzeitig vor dem Verlust von „Kompetenz“ warnt, „die wir im Bereich Urananreicherung haben“.

Auch in Gronau muss UAA-Betreiber Urenco nur wenig Widerstand fürchten. Zwar demonstrierten im Fukushima-Jahr 2011 mehr als 15.000 Menschen gegen die Anlage. Und in diesem Jahr wird es am 19. April einen Osterprotestmarsch zur Urananreicherungsanlage geben. Im Wahlkampf vor der Bürgermeisterstichwahl in der kommenden Woche aber ist die Urananreicherung kein Thema: „Die SPD-Amtsinhaberin Sonja Jürgens vermeidet Kritik“, sagt Udo Buchholz, Sprecher des Bundesverbands Bürgerinitiativen Umweltschutz, der in Gronau nur zwei Kilometer von der UAA entfernt wohnt. „Und CDU-Mann Rainer Doet­kotte ist wie der unabhängige Kandidat Christoph Leuders voll auf Urenco-Linie.“

Großzügiger Uran-Anreicherer

Verwunderlich ist das nicht: Mit rund 20 Millionen Euro sorgt Urenco für rund ein Drittel der Gewerbesteuereinnahmen Gronaus. Auch 250 oft gut bezahlte Arbeitsplätze zählen viel in einer Stadt, in der die Ruinen der Textilindustrie noch immer Teil des Stadtbilds sind – der Zusammenbruch des Spinnereikonzerns van Delden brachte in den Achtzigern Tausende um ihren Job.

Die Urananreicherer geben sich dagegen großzügig. Urenco sponsert den Fußballverein Fortuna Gronau, den Segelverein Stormvogel Steinfurt und die Freiwillige Feuerwehr. Auf dem Weihnachtsmarkt und in Kindergärten tritt eine nach dem englischen Wort Enrichment (Anreicherung) „Richie“ genannte lebensgroße Plüschfigur auf und verteilt Geschenke. Dafür gibt es schöne Bilder in der Lokalpresse.

Dabei setzt der UAA-Betreiber Urenco Limited längst nicht mehr allein auf die Belieferung von klassischen Atomkraftwerken. Im Februar hat der Konzern angekündigt, in den USA den Anreicherungsgrad seines Urans von bisher 5 auf 19,75 Prozent steigern zu wollen. „High assay low-enriched uranium“ (HALEU) nennt die Atomfirma ihr neues Produkt – ab 20 Prozent gilt Uran als hoch angereichert. „HALEU dient definitiv nicht der Nutzung in einem zivilen Leistungsreaktor“, warnt der Atomkraftgegner Matthias Eickhoff von der Initiative Sofortiger Atomausstieg aus Münster, der Urenco seit Jahren beobachtet.

Kritik kommt auch vom Internationalen Netzwerk der Ärzte für die Verhütung des Atomkrieges (IPPNW): Bisher habe die 5-Prozent-Grenze als Beleg für die rein zivile Nutzung des Urans gedient, sagt deren Sprecherin Angelika Clausen und fragt: „Warum soll dies jetzt nicht mehr gelten? Wie kann die Bundesregierung einen derart dramatischen Kursschwenk bei Urenco billigen?“

Denn schon heute zeigt das US-Verteidigungsministerium Interesse an dem neuen Urenco-Produkt etwa für kleine mobile Reaktoren, die in sogenannten Rapid Response Scenarios eingesetzt werden könnten: Damit könnten die US-Streitkräfte auch in abgelegenen Regionen wie etwa Afghanistan ohne Dieselnachschub drei Jahre lang energieautark werden.

Image

„Beunruhigend“ seien die neuen Urenco-Pläne, findet auch Hubertus Zdebel, Bundestagsabgeordneter der Linken aus Münster. Die Firma steuere in eine „militärische Richtung“. Die Bundesregierung als Kontrollbehörde dürfe „nichts zulassen, was den Ausbau der Atomenergie sogar noch fördert“. Aus den Berliner Ministerien hieß es dagegen, die Pläne Urencos zur Produktion von HALEU seien „bekannt“: Nach einer „Prüfung von Wirtschaftlichkeit, Marktumfeld und Bedarf“ könne „Urenco auf dem US-Markt als Bieter auftreten“.

Der erste Vorstoß in Richtung US-Militär wäre die HALEU-Produktion nicht. Schon 2017 berichteten der WDR und das Fachblatt Nuclear Intelligence Weekly, Urenco habe zur Belieferung der Atomkraftwerke Watts Bar und Sequoyah einen 500 Millionen Dollar schweren Deal mit der Tennessee Valley Authority (TVA) geschlossen. In den beiden AKWs wird auch Tritium hergestellt, das als Zünder für die Sprengköpfe der US-Atomraketen benötigt wird.

Quelle        :       TAZ        >>>>>         weiterlesen

————————————————————–

Graqikquelle        :

Oben        —      Waggons mit Uran an der Urananreicherungsanlage Urenco in Gronau

—————————

Unten      —        Fotoquelle   : Indimedia org.

Dieser Inhalt ist unter einer
Creative Commons-Lizenz lizenziert.

Creative Commons-Lizenzvertrag

Abgelegt unter International, Nordrhein-Westfalen, Regierung, Umwelt | Keine Kommentare »

Aachener Radler auf Tour

Erstellt von DL-Redaktion am 19. März 2019

Rad ab

File:Trierer Straße in Aachen-Brand - panoramio.jpg

Trierer Straße in Aachen-Brand

Aus Aachen von Bernd Müllender

Zum Beispiel Aachen: Wie eine Stadt versucht, dem Verkehrsinfarkt zu begegnen: inkompetent, feige, zeitweilig lachhaft – und selbst bei geplanten Radvorrang- routen immer dem Götzen Auto zu Diensten, der sich gerade sein nächstes Todesopfer unter den Radlern geholt hat.

as hätte ich nicht für möglich gehalten. Das ist ja völlig verrückt. Und so was in unserem schönen Aachen.“ Die CDU-Vorsitzende des Bezirksausschusses Mitte steigt entsetzt vom Sattel, als wir den nächsten grotesken Radwegabschnitt in der Innenstadt queren. Der markierte Weg endet, bei vorbeibrausendem Autoverkehr, abrupt vor einer Warnbarke. Sie schiebt. „Das ist mir zu gefährlich.“

Acht Mitglieder aus dem 19-köpfigen Gremium sind meiner Einladung gefolgt, eine Radtour durch Aachen zu machen. Um unmittelbar zu erleben, welch unsinnige und teils lebensgefährliche Radwege angelegt sind. Wenn es welche gibt.

Wir strampeln weiter, über unübersichtliche Pisten mit jahrzehntealten Schlaglöchern und wackelndem Gestein, über Radwege, die wie ein Trichter verschlankend in eine vielbefahrene Fahrspur übergehen, die in einer Bushaltestelle enden oder ansatzlos in einer Rechtsabbiegespur für Autos. Fotografien all dieser Stellen würde sich der Leibhaftige hohnlachend als Patchwork des Horrors ins Wohnzimmer hängen.

Vor einer Ampel ist ein Sozialdemokrat fassungslos: „Hier überkreuzen sich bei Grün ja zwei Radwege. Das ist“, er ringt nach Worten, „wie Hilfestellung zum Unfall. Wer denkt sich so was aus?“ Niemand antwortet.

Am Ende zählen wir durch: Alle sind durchgekommen. „Puuuh“, sagt die CDU-Frau.

Die Radtour mit den politisch Mitverantwortlichen hat es nie gegeben. Es sollte sie geben, nur: auf meine Einladung reagierte zunächst niemand; erst auf Nachfrage, ob man Angst habe vor Unfall oder vor Blamage, antworteten genau zwei. Der junge Mann von den Piraten schrieb, er sei sich als passionierter Radler der „Unzulänglichkeiten der Radverkehrsinfrastruktur durchaus bewusst“. Der Abgeordnete der Linken meldete, dass er „vom Naturell her ungern Fahrrad fahre“. Ein Blick auf sein Bild: So dick ist er gar nicht. Vielleicht heißt Naturell: Überlebenslust statt Hasardeurtum.

Aachen Hauptbahnhof

Am 12. Februar wurde mitten auf einem Radweg eine 53-jährige Psychologin von einem rechts abbiegenden Sattelschlepper getötet. Die Polizei sprach von „Kollision mit einem Lkw“. Madeleine B. war Aachens viertes Radopfer binnen gut zwei Jahren. Einen Abbiegeassistenten, der hätte warnen können, hatte der Kipper nicht. Ist ja auch kein Muss.

Madeleine B.’s Leben endete auf einem abgestrichelten Radsicherheitsstreifen. Die sind beliebt, weil schnell gepinselt, preiswert und weil sie Fürsorglichkeit vorgaukeln. Nur: Radsicherheitsstreifen führen oft direkt längs parkender Automobile. Geht eine Tür abrupt auf, ist man schnell Door­ing-Opfer. Fährt man zur Sicherheit weiter links, spürt man die Wut der Automobilisten schon bevor sie hupen. Dann quetschen sie sich vorbei, um schneller die nächste rote Ampel zu erreichen. In Flandern heißen diese Radsicherheitsstreifen Moordstrookje: Todesstreifchen. Moordstrookje wurde dort zum Wort des Jahres 2018 gekürt.

Bernhard Schlag, 68, Seniorprofessor für Verkehrspsychologie an der TU Dresden, ist Aachener. Die Dauerfehde zwischen Zwei- und Vierrädern sei „ein klassischer Ressourcenkonflikt“, sagt er, befeuert durch „gegenseitige falsche Wahrnehmungen, weil jeder den anderen verdächtigt, ihm Räume wegzunehmen“. Folge: Neid, Stress, Aggression. „Der Staat hat die Pflicht, Verkehre sicher zu gestalten, verantwortungsvoll an die Geschwindigkeit der langsameren Verkehrsteilnehmer angepasst.“

Schlag publizierte schon 2010 die Idee, innerorts höchstens Tempo 30 zu erlauben („selbst das kann noch zu viel sein“) und Tempo 50 nur, sofern ein ausgebauter, abgetrennter Radweg angelegt ist. „Wir brauchen eine Umkehrung der Beweislast. Eine verantwortungsbewusste Stadt muss erst belegen, dass eine Straße sicher genug ist für mehr als Tempo 30.“

Der Verkehrssicherheitsrat, erzählt Schlag, sei damals sehr interessiert gewesen. Aber: „Umgesetzt hat die Idee niemand.“ Warum? „Politik hat immer Angst vor Gegenwehr, weil jede neue Regel als Einschränkung interpretiert wird. Verwaltungen sind oft beratungsresistent, auch da herrschen Bedenken und Angst vor Veränderungen.“ Fazit: „So kommt nichts in die Gänge.“

In Deutschland investieren die Kommunen meist weniger als fünf Euro pro Kopf pro Jahr in die Radinfrastruktur (Aachen 3,40 Euro). In Kopenhagen sind es 35, im niederländischen Venlo waren es zuletzt 60. In Deutschland starben 2018 fast 450 RadfahrerInnen, das ist jeder siebte Verkehrstote. Die Zahl stieg um 13 Prozent. Aachen muss bei verunglückten RadfahrerInnen 22 Prozent Plus vermelden.

Die Städte gehören längst nicht mehr den BewohnerInnen. Fußgänger oder Zweiradfahrer sind nur Hindernisse des lärmenden und stinkenden Blechs. Viele AachenerInnen sagen: Vom Naturell her würde ich ja sehr gern Rad fahren. Aber auf diesen Straßen? Bei dem Autoverkehr? Ich bin doch nicht lebensmüde! Sie haben völlig recht. Sicherlich braucht man vielerwegs Mut und eiserne Nerven. Sicher ist auch: Gäbe es eigene Radtrassen, viele Autos blieben in den Garagen.

Bernhard Schlags Wunsch: „Autofahrer müssen lernen, dass sie Gast sind in den Städten. Und dass das nicht das eigene Biotop ist.“

Die Viertelmillionenstadt Aachen ist hügelig und fast überall eng. Der Stress radelt immer mit. Stets muss man unmittelbar auf alles gefasst sein, Hände auf der Bremse, die Fahrigkeit der Autofahrer immer mitdenkend. Schlechte Voraussetzungen für boomenden Radverkehr; umso mehr müsste die Stadt tun. Sie redet auch seit Jahrzehnten von Anreizen und Verkehrswende. Doch Reden fruchtet nicht.

Die existierenden Radwege scheinen nur angelegt, um Dritten zu dienen: als Zwischenablage für Mülltonnen und Straßenschnee, als Zwischenparkplätze sowieso und als Habitate von Verkehrsschildern, Laternen, Bushäuschen und Stromkästen. RadlerInnen in Aachen machen seit Jahren elf Prozent des Verkehrs aus – in gleichgroßen Unistädten sind es 34 Prozent (Freiburg) und 38 (Münster).

Typisch in Aachen sind vierspurige Straßen mit schmalen Bürgersteigen, die zudem oft beparkt werden. Und da will man mehr von diesem Störenfried Radverkehr zwischenquetschen? Und wenn, werden Radwegstücke gestrichelt. Das gilt nur als Bitte freizuhalten, ist also fast sinnlos: Wenn, bremsten nur durchgezogene Linien die Autolenker aus. Und selbst neue Ummarkierungen gibt es nur, so ein Verwaltungspapier, wenn „die Spitzenbelastungen des Kfz-Aufkommens dies zulassen“. Das ist Kotau, keine Wende.

Aachen ist stolz zertifizierte „EU-Klimaschutzkommune“, dazu Mitglied der „Arbeitsgemeinschaft Fahrradfreundlicher Städte und Kreise in NRW“ – und, wie viele andere Städte, in erster Instanz zu Dieselfahrverboten verurteilt. Aachen hat Rechtsmittel eingelegt. Im Sommer entscheidet das Oberverwaltungsgericht. Bis dahin gilt es „Hausaufgaben zu machen“, wie man das putzig nennt. Grenzwerte sollen anders unterschritten werden: Appelle zum Radeln, Autofasten-Vorschläge oder die finanzielle Unterstützung des privaten Velocity-Leihnetzes für Pedelecs.

Oder eine bis 2030 geplante Radvorrangroute. Diese wurde jetzt vorgestellt: Sie besteht aus zehn Planstrecken von Außenbezirken Richtung City, meist über Nebenstrecken. Keine Autopiste wird angetastet. Radler werden im Abseits versteckt und stören das Gerase nicht mehr. Parkplätze aufgeben? Gehe oftmals nicht wegen der Bäume zwischen den Parkbuchten, schulterzuckt ein Stadtbediensteter. Für die enge, verstopfte Innenstadt gibt es überhaupt noch keine Lösung.

Datei:Muenster Bahnhof Fahrraeder 4805.jpg

Blick nach Münsters Hauptbahnhof

Oder: E-Busse. Die sind seit Jahren avisiert. Nur: Niemand liefert sie. Die deutsche Autoindustrie hat auch hier den Gong nicht gehört. Und mit Zulieferern aus anderen Ländern haben Niederländer und Belgier schon längst Lieferverträge.

Man könnte auch die lächerlichen Parkgebühren erhöhen, derzeit ein Viertel verglichen mit dem angenehm autobefreiten Maastricht nebenan. Die Verwaltung schlug neulich zwei Euro pro halbe Stunde vor. Empörung allerorten. Die CDU argumentierte, dann zahle keiner mehr, weil Verwarnungsgelder kaum noch teurer sind.

Wahrscheinlich hat sie sogar recht. In Holland kostet Falschparken zwischen 50 und 140 Euro, bei uns bekommen „Parksünder“ für schlanke 10 Euro ihre Absolution. Aachens FDP hatte eine besonders bizarre Idee: Gebühren in den Parkhäusern runter. Dann gäbe es weniger Parkplatzsuchverkehr.

Zwei Parkplätze gegen 300 Meter ­Radschutzstreifen

Quelle        TAZ           >>>>>           weiterlesen

——————————————————-

Grafikquellen      :

Oben        —         Trierer Straße in Aachen-Brand

This file is licensed under the Creative Commons Attribution 3.0 Unported license.
Attribution: qwesy qwesy
This image, which was originally posted to Panoramio, was automatically reviewed on by Panoramio upload bot, who confirmed that it was available on Panoramio under the above license on that date.

———————

2. ) von Oben        —      Aachen Hauptbahnhof 01.05.2007

———————-

Unten     —     Ein Blick nach Münster   –  Fahrradabstellplatz am Hauptbahnhof in Münster

Quelle photo taken by Rüdiger Wölk, Münster, Germany
Urheber Rüdiger Wölk

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 2.5 generisch“ (US-amerikanisch) lizenziert.

Abgelegt unter Deutschland, Kultur, Nordrhein-Westfalen, Überregional | Keine Kommentare »

Quergelegen statt Aufstehen

Erstellt von DL-Redaktion am 18. März 2019

STATT „AUFSTEHEN“ NUR QUERGELEGEN…

Liebe Genoss*innen

Die Initiative „Aufstehen“ ist in eine, womöglich finale, Krise geraten. Viele haben das so wie ich kommen sehen. Dennoch ist jeder Niedergang von linken politischen Initiativen immer auch ein Stück weit von uns allen mitzutragen. Ich habe auf Facebook folgende kurze Einschätzung der Lage gegeben. Sie darf gerne kritisiert, aber auch gelobt und weiterverbreitet werden.

Grüße in die Runde

Thies

Quelle     :      Rundmail

Von: Thies Gleiss

Die politische Initiative „Aufstehen“ ist nach der Rückzugserklärung von Sahra Wagenknecht in ihre wahrscheinlich finale Krise geraten. Mehrere Personen aus der ersten Reihe distanzieren sich und enthüllen Abläufe und Defizite, die zwar aus Berichten von einzelnen Basisaktiven und Gruppen schon bekannt waren, aber in ihrer jetzt quasi offiziellen Bestätigung nur abschreckend sind.

Wenn linke Irrtümer sich als solche in der Praxis erweisen, ist selten Anlass für Freude oder Häme. So auch jetzt. Aber so vorhersehbar die Schwächen von „Aufstehen“ waren, so wichtig wäre jetzt, die richtigen Lehren zu ziehen.

Hier zum Verständnis der Dinge meine Kritik an „Aufstehen“, die ich seit Anbeginn freundlich, sachlich, aber deutlich vorgetragen habe:

– „Aufstehen“ war und ist keine Bewegung, sondern Parteiersatz.

– Dieser Parteiersatz steht programmatisch rechts von der LINKEN und nur möglicherweise links von der SPD.

– Für die LINKE bedeutet dies deshalb einen programmatischen und auch organisatorischen Rückschritt, sich auf diesen Parteiersatz einzulassen. Deshalb ist die Zurückhaltung bei großen Teilen der Partei verständlich.

– Deshalb waren und werden GRÜNE und SPD relativ unbeeindruckt von „Aufstehen“ bleiben und nur die LINKE wird aufgemischt und in Richtung Spaltung getrieben.

– „Aufstehen“ ist auch eine Rot-Rot-Grün-Perspektive und gleichermaßen irreal. Will der eine LINKE-Flügel ein SPD-GRÜNE-LINKE-Bündnis von oben, als Absprache der aktuellen Parteieliten und in Form von Regierungskoalitionen und -versprechen erreichen, so will der „Aufstehen“-Flügel ein solches Bündnis von unten, durch Appelle an die Mitgliedschaft schaffen, aber gleichermaßen auf Regierungsbündnisse gerichtet.

– „Aufstehen“ ist hinter seinen dünnen ideologischen Kulissen vor allem ein Machtkampf zwischen den parlamentarisch verblödeten Fraktionskräften einerseits und der Partei als Mitglieder orientierte Kraft andererseits.

– „Aufstehen“ hat sich zusätzlich gleich nach den ersten Anläufen selbst kastriert, weil so ein Projekt nur als Wahlinitiative funktionieren kann (wenn überhaupt), aber genau das heftigst dementiert und damit vorerst unmöglich gemacht wurde.

– „Aufstehen“ ist unheilbar undemokratisch und politisch eine Beleidigung für den für linke Politik sehr bedeutenden Begriff „Bewegung“.

– „Aufstehen“ gelingt es nicht, die Grenzüberschreitungen nach rechts in den Griff zu bekommen.

– „Aufstehen“ ist (war bisher) ein Ego-Projekt von Sahra Wagenknecht, das, wenn sie von ihren Vertrauten nicht gebremst wird, in einer persönlichen Tragödie enden wird.

Meine Empfehlung für die Zukunft:
Statt Schlammschacht, politischer Instrumentalisierung von persönlichen Krankheiten und neues Gerangel um Führungspositionen, lieber die Sache bewusst und gemeinsam beenden, die richtigen Lehren ziehen und den nächsten Irrtum auf jeden Fall gemeinsam vorbereiten…

————————————————————–

Gradikquelle        :     Scherbenhaufen

Stefan-XpEigenes Werk

Scherben, die bei einem Polterabend angefallen sind.

Abgelegt unter Berlin, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Über 1000 Menschen

Erstellt von DL-Redaktion am 17. März 2019

gegen radikale Abtreibungsgegner*innen auf der Straße

Quelle      :      Scharf – Links

Von Bündnis für sexuelle Selbstbestimmung Münster

Das Bündnis für sexuelle Selbstbestimmung zeigt sich zufrieden mit dem Protesttag gegen den sogenannten „1000-Kreuze-Marsch“ in Münster. „Mit über 1000 Menschen haben wir heute deutlich gemacht, dass in Münster kein Platz für reaktionäre Frauenbilder ist“, so Eva Ehlers, Sprecherin des Bündnis für sexuellen Selbstbestimmung in Münster. „Wir bedanken uns bei den Teilnehmer*innen. Auf dem Prinzipalmarkt wurden die etwa 150 „Tausend-Kreuze“-Marschier*innen mit Trillerpfeifen, lauten Sprechchören und vielen selbstgebastelten Plakaten konfrontiert. Der Plan der Abtreibungsgegner*innen, gegenüber den Betroffenen Macht zu demonstrieren und für ihre menschenverachtende Ideologie zu werben, ist nicht aufgegangen. Stattdessen wurde der Prinzipalmarkt in ein Fest für Frauenrechte verwandelt. Auf der Abschlusskundgebung kamen nicht nur unterschiedliche Organisationen, sondern auch Betroffene zu Wort. Zudem begeisterte die feministische Liedermacherin Dota die Kundgebungsteilnehmer*innen. Die Münsteraner Zivilgesellschaft hat sich heute eindrucksvoll auf die Seite von ungewollt Schwangeren gestellt und ist für das Recht der Betroffenen, sich für oder gegen einen Schwangerschaftsabbruch entscheiden zu können, auf die Straße gegangen.“

Das Bündnis kritisiert den engen Schulterschluss der Abtreibungsgegner*innen mit der extremen Rechten. So wurden auch in diesem Jahr wieder bekannte Verteter der AfD auf dem 1000-Kreuze-Marsch erkannt, beispielsweise der stellvertretende AfD-Vorsitzende aus Münster, Alexander Leschik. Dazu Bündnisaktivistin Eva Kubitz: „Da wächst zusammen, was zusammen gehört. Die Ansätze einer rassistischer Ausleseideologie vertragen sich gut mit den Ansätzen der Abtreibungsgegner*innen.“

Zugleich zieht sie ebenfalls eine positive Bilanz vom heutigen Tag: „Unsere heutige Demonstration gegen die Abtreibungsgegner*innen ist für uns zusätzliche Motivation, jetzt nicht nachzulassen im Kampf für sexuelle Selbstbestimmung.“ so Kubitz. Denn: „Wer Frauen verbietet, über ihren Körper selbst zu bestimmen, spricht ihnen nicht nur die Fähigkeit ab, verantwortungsvolle Entscheidungen zu treffen, sondern nimmt zur Verteidigung eines rückständigen Frauenbildes die Gefährdung von Gesundheit und Leben ungewollt Schwangerer in Kauf“, so Kubitz abschließend.

Datei:Muenster Bahnhof Fahrraeder 4805.jpg

Wer mit den Rad anreist wird es schwer haben dieses später wieder zu finden.

Dennoch kritisiert das Bündnis das Verhalten der Polizei im Rahmen des Protestes: „Das massive Polizeiaufgebot war völlig unverhältnismäßig und wirkte abschreckend auf unsere Demonstrationsteilnehmenden. Außerdem wurde die Demonstration zu Beginn mit völlig sinnlosen und rechtlich unhaltbaren Ordner-Auflagen fast 30 Minuten aufgehalten“, kritisiert Versammlungsleiter Hannes Draeger. Zugleich liegen dem Bündnis mehrere Augenzeugenberichte vor, wonach Gegner des 1000-Kreuze-Marsches Opfer von Polizeigewalt geworden sind. „Wir hoffen, dass es den Opfern dieses unverhältnismäßigen Polizeieinsatzes den Umständen entsprechend gut geht und wünschen ihnen von hier aus alles Gute“, so Draeger abschließend.

Das nächste Offene Bündnistreffen findet am 25. März statt. Weitere Infos unter muenster.sexuelle-selbstbestimmung.de

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————-

Grafikquellen     :

Oben      —     Übernahme von Scharf-Links  /  Foto : Bündnis für sexuelle Selbstbestimmung Münster

——————————

 Unten     —       Fahrradabstellplatz am Hauptbahnhof in Münster

Quelle photo taken by Rüdiger Wölk, Münster, Germany
Urheber Rüdiger Wölk

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 2.5 generisch“ (US-amerikanisch) lizenziert.

Abgelegt unter Medien, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »

Aufstehen: Leute, forget it

Erstellt von DL-Redaktion am 5. März 2019

Wir besuchen ein Treffen in Dortmund

Bunte Westen 01.jpg

Von   Timon Karl Kaleyta

Wie geht es denn wohl der linken Sammlungsbewegung von neulich?

Man kann ja bloß raten oder eben verächtlich daherreden, warum es mit „Aufstehen“, der linken Sammlungsbewegung, die Sahra Wagenknecht im September vergangenen Jahres prominent aus der Taufe gehoben hatte, dann am Ende doch nicht so richtig was geworden ist – oder, um es vorläufiger zu sagen, warum es in den letzten Monaten nach einem doch irgendwie verheißungsvollen Beginn immer ruhiger geworden war um dieses „Aufstehen“. Binnen weniger Tage, das sollte man nicht vergessen, hatten sich da rund 100.000 Interessierte auf der Homepage der Bewegung registriert und damit zumindest vages Interesse bekundet.

Als Vorbild galten Kampagnen wie „The People for Bernie Sanders“ oder „La France Insoumise“ des französischen Sozialisten Jean-Luc Mélenchon – die bestimmenden Themen waren auch hier soziale Gerechtigkeit, ökologische Wende und Friedenspolitik. Mittlerweile sollen es gar 170.000 registrierte „Unterstützer“ sein, aber irgendwie war von dem Ziel, urlinke Themen wieder massiv in den Diskurs pumpen zu können, bald nicht mehr viel übrig geblieben.

Die Kritiker der ersten Stunde überraschte das Abebben des Engagements nur wenig oder sie freuten sich heimlich darüber, den Hoffnungsfrohen hingegen schwand bald jede Zuversicht – und diejenigen, die vor allem Sahra Wagenknecht schon immer für eine Gefahr, mindestens aber für eine Blenderin gehalten hatten, erhielten endlich Satisfaktion. Überdies hatten ganz andere Ereignisse, die instantanen Proteste der „Gilets Jaunes“, letztlich jedes verbliebene Interesse an „Aufstehen“ erstickt.

Bei den französischen Nachbarn brauchte es für die Artikulierung von Missstand nicht die Gründung eines recht undurchsichtig organisierten „eingetragenen Trägervereins“, sondern dort zog man sich eine Warnweste an und ging mit der entsprechenden Wucht auf die Straße. Das Einzige, was man über „Aufstehen“ zuletzt mitbekam, waren die immer verbissener geführten Streitereien der Unterstützer, die fragten, wie es nun weitergehen und wie man sich denn organisieren und das System zum Umstürzen bringen würde.

Trägheit des Trägervereins

Selbst der friedliebende Gregor Gysi erklärte die Bewegung öffentlich für „politisch tot“, was dann einen Brandbrief gegen seine Person zur Folge hatte, der mittlerweile auf der Startseite von „Aufstehen“ einzusehen ist. Da heißt es: „Wir haben (…) noch die Kraft, zu demonstrieren, auch wenn Herr Gysi so was keine Chance gibt. Uns wundert es nicht, dass Herr Gysi die unteren Schichten, die sich bei AUFSTEHEN gesammelt haben, nicht unterstützt. Herr Gysi gehört eben auch zur deutschen Mittelschicht, ähnlich wie Herr Merz, die die Unterschicht nicht unterstützen.“

Der Prediger welcher immer aus der Bütt fällt

Um aber noch einmal zu retten, was noch zu retten ist, vor allem aber gegen jede Wahrscheinlichkeit der Aufmerksamkeitsökonomie, sollte am vergangenen Wochenende mit einer Veranstaltung in Dortmund noch einmal frischer Wind in die Segel kommen. Gründungsmitglied Marco Bülow – Teil des irgendwie auch nicht ganz nachvollziehbaren „vorläufigen Vorstands“–, der im November letzten Jahres wegen der „Visions- und Haltungslosigkeit“ seiner Partei die SPD verlassen hatte und seither fraktionslos im Bundestag sitzt, hatte zu einem „Aktionscampus“ geladen.

Aufgerufen dazu waren überhaupt zum ersten Mal Vertreter und Gesandte der Basisgruppen aus dem ganzen Bundesgebiet. Nicht nur sollten sich jetzt, ein halbes Jahr nach Gründung, die Menschen tatsächlich mal kennenlernen, auch hatte man die Notwendigkeit erkannt, als Bewegung aktiv zu werden – in der Pressemitteilung hieß es, dass mit dem heutigen Tag die Vernetzung beginnen und ein neuer Hashtag gestartet werden würde. Nach dem Vorbild des durch den Freitag initiierten #unten sollte fortan in den sozialen Medien darüber diskutiert werden, was #Würdeist.

Eingeladen zur Mittagszeit hatten Bülow und seine Mitstreiter in das etwas seltsam, aber einladend klingende BierCaféWest, einen groben, unprätentiösen Versammlungsort im Hinterhof einer Arbeiterwohlfahrt-Zentrale am Rande der Dortmunder Innenstadt. Man muss sich diesen Ort als das maximal Andere vorstellen, so maximal anders, wie die Lebenswelten von, sagen wir mal, Fließbandarbeitern und Hauptstadtjournalisten ausfallen dürften.

Nicht zuletzt diese unausgesprochene Barrierefreiheit des BierCaféWest hatte dafür gesorgt, dass tatsächlich viele Vertreter der Basisgruppen gekommen waren – es war laut und voll, mit Filzstift auf Kreppband hatten sich die Teilnehmer ihre Vornamen auf die Kleidung geklebt, um auch die Hürden des Kennenlernens niedrig zu halten. Auf einem Informationszettel, der auf den 150 Holzstühlen auslag, war der bisherige Unmut über den Zustand der Bewegung noch einmal in mindestens Arial 14 festgehalten: „Es ist eine unverzeihliche Belastung für ,Aufstehen‘ “, stand dort zu lesen, „dass zumindest einige von denen, die Führungsaufgaben für sich reklamiert haben, in weiten Teilen nicht nur versagt haben, sondern die Basis sogar aktiv oder durch Untätigkeit boykottieren.“

Auf dem Zettel außerdem eine saubere Liste der gröbsten Fehler, die vor allem auf Versäumnisse seitens des Trägervereins verwiesen – auf diesen Verein, dessen Mitglied Sahra Wagenknecht offiziell nicht ist, ist hier niemand gut zu sprechen. Viel ist da die Rede von Missgeschicken, unangekündigten Gruppen-Schließungen bei Facebook, nicht herausgegebenen E-Mail-Adressen, vergessenen Mailings, ausbleibenden Mobilisierungen, verschlampten Homepage-Aktualisierungen. Das Problem besteht anscheinend in der Trägheit des Trägervereins.

Um dieser Trägheit etwas entgegenzusetzen, um der Bewegung neuen, vor allem basisdemokratischen Schwung mitzugeben, waren sie also gekommen, mehrheitlich Männer und Frauen zwischen 40 und 60, manche mit BVB-Mützchen, einige in neongelben, mit „Aufstehen“-Logo beflockten Westen, ein paar gar schon in Faschingskostümen – jeder für sich aber unübersehbar hochmotiviert und von dem Willen getrieben, dem Unmut Luft zu machen, gleichsam hier und jetzt endlich mit irgendwas anzufangen.

Versager welche im Leben immer davon liefen und nichts geleistet haben.

Warum man so ein Treffen indes „Campus“ nennen muss, bleibt fraglich – die allermeisten Teilnehmer hier haben ja eher nie eine Universität besucht und dürften, was zu begrüßen ist, auch kein Studium der Geisteswissenschaften abgeschlossen haben. Dafür aber ist hier, anders als in jedem Germanistik-Proseminar, eine grenzenlose Mitmachbereitschaft zu bestaunen, ein Engagement, eine Leidenschaft und eine Lust zur aktiven Teilnahme, die nur vital und wahrhaftig zu nennen ist.

Quelle       :    Der Freitag           >>>>>           weiterlesen

Weitere auf DL erschienene Artikel  zur Sammelbewegung „Aufstehen“ :

Bewegung „Aufstehen“

Die Krise beim „Aufstehen“

Offener Brief an #Aufstehen

Wer aufruft + hocken bleibt-

Wagenknechts Bänkelsänger

„Aufstehen“ & Realsatire

Wagenknecht und Migration

NRW-LINKE fordert Dialog

Wagenknechts Dämmerung

Die Linke und Wagenknecht

Showdown für Wagentaine?

Die Linke zur EU-Wahl

Die Linke vor der Spaltung?

Abrechnung mit Wagentain

AKL – Teilen statt Spaltung?

Wie das Rad, so der Wagen

Wagenknechts „Bewegung“

Linkenposse in der Fraktion

Linker Cäsarismus :

Betreutes Linksseinwollen

Wagentains Auferstehung

Wagentains Sammlungen

Liebe Sahra Wagenknecht

Aufstehen – wofür?

Bleibt Aufstehen sitzen?

„Sahra muss entscheiden“

—————————————————————-

Grafikquellen      :

Oben      —     „Bunte Westen“ protest in Hanover, 16th february 2019

——————————-

2. von Oben      —     Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

————————————–

Unten       —         Den Rechte Flügel ? Blogsport  / Ein ganzes Leben wie Göttin und Gott in Frankreich  – andere Arbeiten lassen !

Abgelegt unter APO, Nordrhein-Westfalen, P. DIE LINKE, Saarland, Überregional | Keine Kommentare »

DIE LINKE. : KV Gütersloh

Erstellt von DL-Redaktion am 5. März 2019

Attac und die Bertelsmann-Stiftung –
wer ist gemein, wer ist nützig?

Gorbatschow in Gütersloh 1992.jpg

Mikhail Gorbachev, Reinhard Mohn and Liz Mohn in the foyer of the Bertelsmann Foundation

Qelle     :        Scharf   –    Links

Von DIE LINKE. Kreisverband Gütersloh

Der Bundesfinanzhof hat in dieser Woche dem globalisierungskritischen Netzwerk Attac die Gemeinnützigkeit entzogen. Im Urteil heißt es, Attac beeinflusse die politische Willensbildung und die öffentliche Meinung „im Sinne eigener Auffassungen“ und die Arbeit der Organisation sei zu „tagespolitisch“. Der Kreisverband DIE LINKE Gütersloh sieht darin einen weiteren Versuch jene Gruppen zu schwächen, die sich für eine solidarische, ökologische und friedliche Welt einsetzen. Es ist kein Zufall, dass die Gemeinnützigkeit der Bertelsmann-Stiftung nicht angezweifelt wird.

Dazu Uschi Kappeler, Sprecherin des Kreisverbandes DIE LINKE: „Lobbyisten und deren Politiker würden am liebsten auch der Deutschen Umwelthilfe die Gemeinnützigkeit entziehen. Anfang dieser Woche drohten die Finanzämter in NRW der Vereinigung der Verfolgten des Naziregimes – Bund der Antifaschistinnen und Antifaschisten e.V. (VVN-BdA), mit dem Entzug der Gemeinnützigkeit. Vor zwei Wochen debattierte der Finanzausschuss des Bundestages auf Antrag der FDP über die Gemeinnützigkeit von Tierschutzorganisationen. Bereits im Dezember kündigte Bundesinnenminister Horst Seehofer an, die linke Solidaritätsorganisation Rote Hilfe e.V. zu verbieten. Wen trifft es als nächstes? Den BUND, die Gewerkschaften und Fridays for Future? Demokratie und ziviles Engagement werden den Profitinteressen und damit dem Kapitalismus geopfert.“

Auch wenn die Verantwortlichen des Bundesfinanzhofes glauben mit einer derartigen Maßnahme Attac und anderen den Mund verbieten zu können, so werden sie nicht den Widerstand unterbinden können, der sich zurzeit in der Gesellschaft erhebt. Fridays for Future ist der beste Beweis dafür, dass die junge Generation eben nicht zusehen wird, wie man ihnen die Zukunft kaputtregiert,“ so die stellvertretende Kreissprecherin der Linken, Camila Cirlini, die auch als Kandidatin zur Europawahl an den Start geht.

1. Mai 2012 Klagesmarkt063.jpg

Michael Pusch, Sprecher des Kreisverbandes: „Während sozial- und umweltpolitisch, aber auch friedenspolitisch die Notwendigkeit eines grundlegenden Kurswechsels immer offensichtlicher wird, betreiben die Regierungen weiterhin eine Politik, die sich den Kapitalinteressen unterordnet. An den Drehbüchern dieser Politik, sei es für die Agenda 2010 oder für Reformen in der Bildungs- und Gesundheitspolitik, war die Bertelsmann-Stiftung maßgeblich beteiligt. In Ministerien und Behörden kümmern sich hunderte Mitarbeiter der Stiftung um die politische Umsetzung. Für die öffentliche Akzeptanz sorgt der Mutterkonzern als eines der weltweit größten Medienunternehmen. Kaum einer von uns, der von diesen „tagespolitischen“ Maßnahmen der Bertelsmann-Stiftung nicht betroffen ist. An der Gemeinnützigkeit der Bertelsmann-Stiftung haben aber weder der Bundesfinanzhof noch die Bundesregierung Zweifel.“

Uschi Kappeler, Michael Pusch, Camila Cirlini, Ludger Klein-Ridder, Aleksandar Mitrovic, Emanuel Zurbrüggen

Kreisvorstand DIE LINKE. GÜTERSLOH

http://www.dielinke-guetersloh.de

————————————-

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————

Grafikquellen  :

Oben      —       Mikhail Gorbachev, Reinhard Mohn and Liz Mohn in the foyer of the Bertelsmann Foundation

————————————–

Unten     —      Sie haben ein besseres Bild? Sogar ein historisches! Zeigen Sie’s uns. Wikipedia gehört uns. Allen Menschen.

Abgelegt unter Attac, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Wagenknechts Abschied ?

Erstellt von DL-Redaktion am 3. März 2019

Linker Europaparteitag: Wagenknechts Abschied

Sahra Wagenknecht bei der Bundestagswahl 2017 Wahlabend Die Linke (Martin Rulsch) 39.jpg

Ein  letztes werfen mit Blumen ?

Von jpsb

Es mag immer wieder Beobachter geben, die nur Abstimmungssiege für entscheidend halten. Wer Politik als Prozessereignis betrachtet, der kann sich solch kruder Betrachtungen kaum anschließen. Auch vermeintliche Niederlagen können Anstöße in die richtige Richtung sein. Der Europarteitag der Partei Die Linke hat am letzten Wochenende gezeigt, dass es Niederlagen gibt die dennoch Siege sind. Denn der Reformflügel hat mit einer programmatischen Fleißarbeit und seinem Antrag für ein Europa der Regionen den Akzent des Parteitages gesetzt.

Dass mag nicht jedem im bürgerlichen Pressebetrieb aufgefallen sein. Für den oberflächlichen Kommentar sorgte der Journalismus, der die linke Zusammenkunft in Bonn als Stillstandsparteitag analysiert wissen wollte (Spiegel). Richtiger lagen da die Experten, die die Partei schon lange und bisweilen kritisch solidarisch begleiten (taz, Tagesspiegel). Dass der Antrag, für den das Forum des demokratischen Sozialismus (FdS) verantwortlich zeichnete, nur knapp die Mehrheit des Delegiertenzuspruchs verpasste, darf für langjährige Begleiter der Partei nicht weniger als eine Sensation gewertet werden.

Wer Siegen will muss auch manchmal auf etwas verzichten !

Ein klares Bekenntnis zu Europa. Die bestechende Erkenntnis, dass Europa auch links gedacht werden kann, wenn es nationale Regierungen mit linken Mehrheiten gibt, das alles wurde mit einer programmatischen Grundlage kombiniert, die eindeutig das Beste ist, was bisher von Links zur europäischen Entwicklung zu Papier gebracht wurde. Die Tatsache, dass Europa als linkes Projekt gedacht werden kann, wenn die Lebensgrundlagen in der Union einer einheitlichen Idee sozialstaatlicher Standards folgen, ist zwar nicht neu. Sie wurde aber bisher zu selten in einer programmatischen Basis zusammengeführt, die neben ihrer bestechenden inhaltlichen Idee auch noch höchst lesenswert ist. Eine reformerische Fleißarbeit die Hoffnung macht.

Quelle      :          Potemkin          >>>>>          weiterlesen

———————————————————-

Grafikquellen         :

Oben      —         Sahra Wagenknecht auf der Wahlparty der Linken zur Bundestagswahl 2017 in der Arena Berlin.

Abgelegt unter Nordrhein-Westfalen, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

Ein Verlag im letzten Akt

Erstellt von DL-Redaktion am 3. März 2019

Der Aufstieg und Fall von DuMont

Alfred Neven DuMont - Empfang im Rathaus.JPG

Von Steffen Grimberg

DuMont ist an der digitalen Zeitungswende gescheitert. Das traditionsreiche Verlagshaus hat in den vergangenen Jahren nicht alles falsch gemacht.

Wenn es um Alfred Neven DuMont ging, wurde die Wortwahl gern ein wenig üppiger – etwa als DuMont-Aufsichtsrat Hans-Werner Kilz den 2015 verstorbenen Verleger würdigte. Von der „monumentalen Lebensleistung“ eines Sprosses, der aus den „glanzvollen Verhältnissen einer alten Kölner Patrizierfamlie“ stammt, war die Rede. In der Domstadt herrschte stets ein gesundes Selbstbewusstsein.

Entsprechend groß ist nun die Aufregung, dass das Medienhaus, das seinen Namen trägt, Abschied nehmen will von dem, was es einst groß machte, als es noch stolz „M. DuMont Schauberg – Expedition der Kölnischen Zeitung“ hieß. Thomas Manns Buddenbrooks kommen einem in den Sinn, wobei es hier nicht nur „Verfall einer Familie“, sondern „Verfall eines Verlags“ heißen müsste.

Was ist passiert? Eigentlich nichts Ungewöhnliches, mitten in der digitalen Zeitenwende: Ein altehrwürdiger Verlag hat es versucht. Hat sich nach allen Regeln der Kunst, mit viel Trial und noch mehr Error mit der digitalen Welt zu arrangieren bemüht, neue Geschäftsfelder erspäht, konsolidiert und sich zum Medienhaus umgebaut – auf dem Papier zumindest.

Und ist dabei von ebendiesem Papier und der gedruckten re­gionalen Zeitung doch weiter so abhängig geblieben, dass man nun den Schlussstrich zieht. Einen Schluss, den andere schon hinter sich haben: Springer ist längst aus diesem Markt ausgestiegen und hält auch nur noch aus übergeordneten Gründen an Bild und Welt fest.

Doch als sich nach einigem Hin und Her Isabella Neven DuMont und Christian DuMont Schütte Mitte dieser Woche „in eigener Sache“ in ihren Blättern zu Wort melden, bekommen sie natürlich gleich wieder ihr Fett weg: Viel zu unkonkret und hinhaltend, gar konfus sei das alles im Namen der dem Aufsichtsrat vorsitzenden Familienstämme formuliert. Schließlich fänden sich ganze Passagen des dürren Briefleins, das komischerweise das Wort „Verkauf“ der Zeitungen gar nicht erst enthalte, schon in den Ansagen an die eigenen MitarbeiterInnen und in Pressestatements wieder.

Von der Wirklichkeit überrollt

Auf den zweiten Blick offenbart der Text aber die tiefe Ehrlichkeit eines Hauses ohne Verleger: „DuMont ist ein über Jahrhunderte hinweg erfolgreiches Unternehmen, weil es sich zu jeder Zeit der Wirklichkeit der Märkte gestellt hat. Die jeweiligen Bedingungen zu identifizieren und auf dieser Grundlage nachhaltige Geschäftsmodelle zu realisieren, ist die Verantwortung eines jeden Unternehmers“, heißt es da. Und nun sind die Wirklichkeiten der Märkte über das seit elf Generationen familiengeführte Haus hinweggerollt.

Der letzte Verleger, Alfred Neven DuMont selbst, hat das alles schon geahnt. Und durch seine Entscheidungen bzw. Nichtentscheidungen in der letzten Dekade seines Lebens befördert. Dieser bürgerliche Fürst, dem alle zu Füßen lagen, hatte viel zu lange keine natürlichen Feinde mehr. Im Verlag versuchte seine Entourage die möglichen Gedankengänge des Alten zu erahnen, wenn der mal wieder auf seiner mallorquinischen Finca statt am Rhein weilte.

Alfred Neven DuMont - Empfang im Rathaus-0473.jpg

Widerspruch hat DuMont zwar geduldet, aber nur in Maßen, und seine „despotischen Züge“ haben es sogar in Kilz’ Trauerrede geschafft: Sie würden ihm „nicht zu Unrecht nachgesagt, beschreiben aber nur die eine Seite seines Wesens“. Die andere, das war vor allem der „echte“ Verleger, über den sich die Berliner Zeitung so freute, als er sie 2009 im dritten Anlauf übernahm. „Alfred Neven DuMont hatte immer höhere Ziele als nur Rendite. […] Das Herzblut seiner Zeitungen war für ihn das geschriebene Wort. Das hat ihn zuletzt auch verleitet, notleidende Blätter zu kaufen, um sie zu erhalten“, fasste Kilz dieses Verlegercredo damals zusammen.

Ein Wunsch nagte an ihm

Quelle         :       TAZ          >>>>>          weiterlesen

————————————————————–

Grafikquellen     :

Oben     —         Der Kölner Oberbürgermeister Jürgen Roters empfängt den Verleger Alfred Neven DuMont im Hansasaal des Kölner Rathauses zu Ehren seines 85. Geburtstages. Dankesrede von Alfred Neven DuMont

Abgelegt unter Köln, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »

99 illegale Waffenexporte

Erstellt von DL-Redaktion am 2. März 2019

Skandalurteil trotz 99 illegaler Waffenexporte in den Bürgerkrieg: „Schlag ins Gesicht der Opfer des Waffenschmuggels“

Kathrin Vogler 3.jpg

Quelle     :       Scharf   –   Links

Von Kathrin Vogler, MdB

Zur Absprache zwischen dem Oberstaatsanwalt und den SIG-Sauer-Managern, die sich seit Dienstag wegen illegaler Waffenexporte in das Bürgerkriegsland Kolumbien vor dem Landgericht Kiel verantworten müssen, kommentiert Kathrin Vogler, Mitglied des Bundestages und friedenspolitische Sprecherin der Linksfraktion im Bundestag:

„Es ist nicht zu fassen, dass sich die Staatsanwaltschaft in diesem Verfahren auf einen Handel mit den Angeklagten eingelassen hat. Die von ihnen vorsätzlich und skrupellos organisierte Ausfuhr von 38.000 Handfeuerwaffen aus Deutschland über die USA in das damalige Bürgerkriegsland Kolumbien ist kein Kavaliersdelikt, sondern Beihilfe zum Massenmord: Die SIG-Sauer-Pistolen sind inzwischen über ganz Kolumbien verteilt. Nicht nur Polizeiangehörige und Soldaten, sondern auch Drogenbanden und Straßengangs benutzen sie. Die Zahl der Opfer dieser Waffen ist immens hoch. Die Bewährungsstrafen für die Mitverantwortlichen an den Morden in Kolumbien sind ein brutaler Schlag ins Gesicht für alle Angehörigen dieser Opfer.“

Dass nur einer der angeklagten Topmanager vom Landgericht Kiel neben der Bewährungsstrafe mit einer Geldbuße in Höhe von maximal 900.000 Euro belegt werden soll, kritisiert Kathrin Vogler scharf als „symbolischen Akt“, der in keinem Verhältnis zum angerichteten Schaden und der umgesetzten Pistolenmenge steht: „Wir haben es hier mit dem größten illegalen Export von Kleinwaffen in ein Bürgerkriegsland in der Geschichte der Bundesrepublik Deutschland zu tun. Der Wert der illegal nach Kolumbien geschmuggelten Pistolen beträgt bis zu 16 Millionen US-Dollar. Aber anstatt auf Abschreckung zu setzen und den unrechtmäßig erworbenen Umsatz abzuschöpfen, lässt das Gericht unverhältnismäßige Milde walten. Das Urteil signalisiert: gesetzwidriger Waffenexport lohnt sich und wird höchstens sachte bestraft. Es lädt geradezu dazu ein, es den SIG-Sauer-Managern gleich zu tun.“

Kathrin Vogler weiter: „Die einzig sichere Strategie, mit der ausgeschlossen werden kann, dass Rüstungsunternehmen aus Krieg, Gewalt und Mord Profit schlagen, ist ein umfassendes Rüstungsexportverbot. Als ersten Schritt dahin muss der Export von Kleinwaffen, den Massenvernichtungswaffen des 21. Jahrhunderts, gestoppt werden.“

Kathrin Vogler, MdB | Friedenspolitische Sprecherin der Fraktion DIE LINKE.

Mitglied im Auswärtigen Ausschuss | Stellv. Mitglied im Verteidigungsausschuss | Obfrau im Unterausschuss Zivile Krisenprävention | Stellv. Vorsitzende der deutsch-ukrainischen Parlamentariergruppe | Stellv. Vorsitzende der Parlamentariergruppe der arabischsprachigen Staaten des Nahen und Mittleren Ostens | Mitglied der deutsch-iranischen Parlamentariergruppe

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————–

Grafikquelle        :        Kathrin Vogler. Foto: Niels Holger Schmidt

Abgelegt unter Bundestag, International, Nordrhein-Westfalen, P. DIE LINKE | Keine Kommentare »

Europaparteitag der LINKEN

Erstellt von DL-Redaktion am 1. März 2019

Liebesgrüße aus Bonn“

DIE LINKE Bundesparteitag 10. Mai 2014-59.jpg

(Katja Kipping)

Quelle        :        Scharf  –  Links

Von René Lindenau

Anstrengend waren die Tage (22.02.-24.02. 2019) schon. Das begann mit der Anreise aus Cottbus und endete mit der Rückreise aus Bonn. Zuletzt unter ganz anderen Vorzeichen war ich unter anderem mit dem heutigen Büroleiter des ersten linken Ministerpräsidenten in der letzten Bundestagssitzungswoche in der alten Hauptstadt gewesen. Nun trafen wir uns erneut – in der bundesdörflichen Umgebung. Insofern waren diese Partei-Tage – für mich nicht nur hoch politisch. Sie vermochten aufgrund zahlreicher Begegnungen und Wiedersehensfreuden mit lieben Menschen, die ich im Laufe der Jahre kennen und schätzen lernen durfte, mich auch menschlich zu erfreuen. Wenn dieser Kitt nicht wäre…Danke EUCH! Denn eine Mitgliedschaft in dieser Partei ist nicht immer vergnügungssteuerpflichtig. Was nicht heißen soll, das ihre Parteitage durchweg einen vergnüglichen Charakter haben müssen, aber manches Vorgehen und inhaltlichen Debatten sind aus meiner Sicht schwer zu verstehen. Von dieser schon vielfach geprobten Regel wich man gelegentlich auch in Bonn nicht ab. Man wählt jedoch eine Partei nicht wegen Geschäftsordnungsdebatten, Rückholanträgen oder mit Realitätsverweigerung. Explizit letzteres war in der linken Geschichte der Schlüssel für Niederlagen. Konkret? Nun, was hätte man sich abgebrochen, wenn eine Delegiertenmehrheit für den Antrag des Forums Demokratischer Sozialismus (fds) für eine Republik Europa zugestimmt hätte? Immerhin waren es knapp 44 Prozent, aber vernünftige Gründe dagegen kann ich nicht (!) erkennen, sollte es doch eine Vision sein, mit der man offensiv für ein linkes Europa streitend, in den Wahlkampf hätten gehen können. Doch so sind wir tatsächlich bei der (Schmidt) SPD, der empfahl, bei Visionen zum Arzt zu gehen. Zu welchem Arzt schicken wir jetzt jene Delegierten? Zumal er sich gegen die einseitige Macht Brüssels wandte, für das Grundrecht auf Asyl eintrat, sich gegen Rassismus aussprach, für Freiheitsrechte und Demokratie eintrat und neben vielen anderen Punkten, der Militarisierung Europas Widerstand entgegen setzten wollte. Im Detail kann man sich über diesen republikanischen Text streiten, aber ablehnen, und wie danach geschehen, die Autoren der antragstellenden Strömung fds als Karrieristen zu titulieren, das geht gar nicht. Alles muss raus, verkündete einmal der Langzeitkanzler Helmut Kohl. In diesem Fall wohl der Pluralismus.

Der Maler und Kommunist Pablo Picasso hat gesagt: „Wenn es nur eine Wahrheit gäbe, dann könnte man nicht 300 Bilder über ein und dieselbe Sache malen“. Nach über neun Stunden Debatte war es gelungen, die vielen Wahrheiten dieses politisch so komplexen Kontinents zu einem für die Delegierten tragfähigen programmatischen Gebilde fertig zu malen. Deutlich wurde dabei; nationale Abschottung und eine geradezu fundamentalistische Ablehnung der EU und ihrer Institutionen sind nicht die Lösung. Nicht, das dieses Europa keine Kritik verdient. Aber Linke stehen in der Verantwortung, ihre Kritik mit einem alternativen Gegenentwurf zu verbinden. Dies nicht zu tun, ist das Geschäft von faschistischen und rechtspopulistischen Kräften. Überschrieben mit „Für ein solidarisches Europa der Millionen, gegen eine Europäische Union der Millionäre“ ist das Wahlprogramm nun. Mit ihm fordert man einen „Neustart“ mit umfassenden Reformen hin zu mehr sozialer Gerechtigkeit, und eben nicht die von wenigen geforderte komplette Zerschlagung der Europäischen Union. Angeknüpft und erinnert wurde hierbei unter anderem auch an das Manifest von Ventotene (1941), das Antifaschisten um Altiero Spinelli, einem späteren Mitglied der Europäischen Kommission und Mitglied des Europäischen Parlaments als Gefangene einer KZ-Insel auf Zigarettenpapier aufschrieben. Die LINKE sollte also auf keinen Fall hinter Ventotene sowie hinter andere progressive linke, sozialistische europapolitische Denkvorstellungen zurückfallen.

In einem Text der DDR-Rockband „Keimzeit“ heißt es.: „Die Irren ins Irrenhaus, die Schlauen ins Parlament“. Passt zum zweiten Teil der Bonner Tage, als es darum ging die Aufstellung der Europaliste der Partei in Angriff zu nehmen. Wer zieht für DIE LINKE in das Europäische Parlament ein? Zu Spitzenkandidaten wurden Martin Schirdewan und Özlem Alev Demirel gekürt, die man zwar bislang kaum kennt, aber das kann sich sicher noch ändern. Brandenburg hat beispielsweise für die kommenden Landtagswahlen auch zwei weitgehend unbekannte Linkspolitiker ganz vorn platziert. Vielleicht hilft hier Gramsci, dieses Defizit mit seinem „Pessimismus des Verstandes – Optimismus des Willens“ – aufzuholen.

Abgesehen von dem Versuch einer Berliner Genossin nach einem unsauberen Vorlauf in einem Wahlgang gegen eine bewährte Europapolitikerin anzutreten, den sie mehrfach verlor, um letztlich gar nicht mehr auf die Wahlliste zu kommen hat gezeigt: Wer sich für auserwählt hält, wird schnell ganz abgewählt. Ansonsten haben die Vertreter eine gute, bunte, breit aufgestellte, Kandidatenliste nominiert, die dann am 26. Mai für DIE LINKE auf dem Wahlschein zum Europäischen Parlament stehen wird.

Abweichend von der Tradition Parteitage der LINKEN mit dem Gesang der Internationale zu beenden, was auch per Tastendruck nicht praktikabel ist, möchte ich mit Zeilen des Songwriters Holger Biege schließen, indem ich seine Zeilen aus „Reichtum der Welt“ in die Tastatur drücke. Darin stellt er die Frage: „Gibt es den Reichtum der Welt morgen noch, oder ist er schon hin. Gehört der Reichtum der Welt allen schon, oder bleibt vielen nicht viel versagt.

Ersetzten wir Welt mit Europa und stellen uns als linke Partei inmitten Europas die Fragen, die vor Jahren schon Biege sang. Da gibt es doch eine Menge an Herausforderungen und Aufgaben, wo die LINKE aktiv werden müsste. Nicht nur als Fragesteller, sondern auch als politische Kraft mit Gestaltungsanspruch.

Cottbus, 26.02.2019 René Lindenau

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————

Grafokquellen      :

Oben    —         Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom: Katja Kipping

Autor    —   Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-59.jpg
  • Created: 10 May 2014

—————————————

Unten       —       scharf-links           /    Foto :   René Lindenau

 

Abgelegt unter Europa, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Ahlen – Stadt pfändet Hund–

Erstellt von DL-Redaktion am 27. Februar 2019

Neues aus der alten „Heimat“
– und verkauft ihn privat bei Ebay

Quellbild anzeigen

Die Stadt Ahlen hat die Mopsdame Edda gepfändet und bei Ebay verkauft. (Symbolfoto)

Von Marvin Dominique Birkelbach

  • Die Stadt Ahlen hat Hund Edda gepfändet und bei Ebay verkauft
  • Die Sache wäre nie ans Licht gekommen, hätte sich der Käufer nicht über den schlechten Gesundheitszustand geärgert
  • Die Familie vermisst die Mopsdame schmerzlich

Manchmal offenbaren sich die Ausmaße eines Ebay-Kaufs erst im Nachhinein.

Die Stadt Ahlen pfändet Hund Edda und verkauft ihn anschließend bei Ebay. Eine Polizeibeamtin aus dem Rheinland stößt auf die Anzeige und schlägt zu. Doch schnell muss sie feststellen: Hund Edda ist – anders als angegeben – nicht kerngesund. Die Käuferin geht juristisch gegen die Stadt vor.

Hinter der Pfändung und dem Verkauf verbirgt sich eine unglaublich Geschichte, wie die Zeitung „die Glocke“ berichtet.

Hund gepfändet und bei Ebay verkauft

„Ich verkaufe eine 1 Jahr alte Mopsdame mit Stammbaum. Der Name der Hündin lautet Edda vom Kappenberger See“, heißt es in der Kleinanzeige bei Ebay. „Edda wurde am 20.06.2017 geboren. Sie ist geimpft und gechippt. Nach Rücksprache mit dem Tierarzt ist Edda kerngesund!“ Letzteres, so weiß die spätere Käuferin Michaela Jordan, ist wohl gelogen.

Seit Dezember ist die Polizeibeamtin aus Wülfrath Besitzerin der Mopsdame.

Quelle      :     Der Westen         >>>>>         weiterlesen

—————————————————————————

Grafikquelle         :         Mops Falk vom Mägdebrunnen ist Internationaler Champion der FCI aus der Mopszucht vom Mägdebrunnen aus Deutschland.

Abgelegt unter Kultur, Nordrhein-Westfalen, Überregional, WAF | Keine Kommentare »

Die Linke Partei in Bonn

Erstellt von DL-Redaktion am 25. Februar 2019

„Nicht die EU ist schuld,
dass Menschen Flaschen sammeln“

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -44.jpg

Das Interview mit Gabi Zimmer führte Anna Lehmann

Die Linke müsse lernen, die deutsche Brille mal abzulegen und andere Erfahrungen anzuerkennen,sagt Gabi Zimmer. Die Politikerin saß 15 Jahre für ihre Partei im Europaparlament. Nun scheidet sie aus.

taz: Frau Zimmer, nach 15 Jahren kandidieren Sie nicht mehr fürs Europaparlament. Welches Gefühl überwiegt: Erleichterung oder Bedauern?

Gabi Zimmer: Beides, doch 15 Jahre sind genug. Ich habe abschreckende Beispiele vor mir von Leuten, wie zum Beispiel Elmar Brok, die nicht bemerkten, dass sie zu Fossilien wurden.

Wenn Sie zurückblicken, was haben Sie bewegt?

Wir haben als Parlament mit großer Mehrheit die Einführung von Mindestlöhnen und -einkommen, eine Garantie gegen Kinderarmut und bindende Verpflichtungen und Geld für den Kampf gegen Armut beschlossen. Dafür habe ich seit 2004 im Parlament gekämpft.

Aber um das umzusetzen, bräuchte das Parlament die Unterstützung der Regierungschefs im Europäischen Rat. Verzweifeln Sie an deren Blockade nicht?

Ja, aber nicht nur an den Regierungen, sondern auch an denen, die in den Mitgliedstaaten Politik machen und nicht verstehen, dass sie Druck auf die Regierungen ausüben müssen, damit diese ihr Verhalten im Rat ändern. Es muss darum gehen, auf EU-Ebene und auf nationaler Ebene diese Auseinandersetzung gleichzeitig und nicht gegeneinander zu führen. Wir dürfen uns nicht einbilden, es würde völlig reichen, wenn sich jeder in seinem Nationalstaat einmummelt und sich abschottet. Ich stehe dafür, dass die Linke begreift, dass sie diese Kämpfe zusammenbringen muss.

Begreift sie das nicht?

Der Unwille, sich mit dem komplizierten Mechanismus EU auseinanderzusetzen, führt teilweise zu völlig verschrobenen Vorstellungen. Wenn Angela Merkel seit Jahren betont, dass Sozialpolitik nationale Politik ist und sich gegen verbindliche Standards auf EU-Ebene ausspricht, dann kann ich nicht die EU für eine unverbindliche soziale Säule verantwortlich machen. Nicht die EU ist daran schuld, dass Menschen in Deutschland Flaschen sammeln müssen. Doch um Armut zu bekämpfen, könnten wir ein EU-weites Mindesteinkommen einführen. Der Vertrag bietet diese Möglichkeit.

Sie haben seit 2012 die Fraktion der Vereinigten Europäischen Linken im EU-Parlament geführt, die 52 Abgeordnete aus 14 Ländern mit sehr widerstreitenden Positionen vereint. Ist es Ihnen gelungen, diese zusammenzubringen?

In den meisten Fällen. Wir mussten begreifen, dass es nicht reicht, schöne Beschlüsse zu fassen. Wir müssen auch Verbündete in den unterschiedlichsten politischen Familien finden, wenn wir Mehrheiten erreichen wollen. Und das haben wir zunehmend geschafft. Im Herbst haben sich außerdem die Parteichefs erstmals an einen Tisch gesetzt und gesagt, wie sie sich die Zukunft der Fraktion vorstellen und wie sie die Unterschiede leben wollen.

Wie groß ist die Wahrscheinlichkeit, dass Gianis Varoufakis, falls er ins Parlament einzieht, mit seiner Demokratiebewegung dazustößt?

Quelle       :      TAZ       >>>>>      weiterlesen

Linke kürt Spitzenkandidaten für Europa

Mit No Names in Richtung Brüssel

Flag of Die Linke

Aus Bonn Martin Reeh

Auf ihrem Parteitag in Bonn schafft die Linke den Spagat zwischen EU-Anhängern und EU-Gegnern, ohne sich zu zerlegen.

Am frühen Samstagabend, als das venezolanische Militär mit Gewalt gegen Hilfslieferungen vorging, drängten auf dem Linken-Parteitag Delegierte darauf, über einen Antrag zur Unterstützung der Maduro-Regierung abzustimmen. Schließlich eilte Parteichefin Katja Kipping selbst ans Mikrofon, um auf die knappe Zeit zu verweisen. Leider könne der Antrag deshalb nicht mehr behandelt werden. Eine knappe Mehrheit entschied sich schließlich für Nichtbefassung.

Das Thema „Venezuela“ zog sich wie ein roter Faden durch den Europaparteitag der Linken in Bonn. Am Samstagmittag hatten Delegierte, darunter die Bundestagsabgeordneten Alexander Neu und Zaklin Nastic, die Bühne geentert. Sie entrollten unter Beifall ein Transparent mit der Aufschrift: „Hände weg von Venezuela – Vorwärts zum Sozialismus“. Außenpolitiker Stefan Liebich grummelte zwar auf Twitter, mit dem Sozialismus, den er sich wünsche, habe Venezuela nichts zu tun. Aber der Parteivorstand vermied eine Auseinandersetzung mit den Maduro-Fans.

Acht Monate nach dem Leipziger Parteitag ist in der Linken der große Frieden eingekehrt. Damals zerstritt sie sich über die Migrationsfrage. Im November kam es zum Burgfrieden zwischen Fraktionschefin Sahra Wagenknecht und den Parteivorsitzenden Katja Kipping und Bernd Riexinger. In Bonn räumte nun eine geschickte Regie die großen Streitpunkte aus dem Weg.

Beim Europawahlprogramm hatte der Bundesvorstand schon im Vorfeld lange beraten, um die etwa gleich großen Lager von EU-Befürwortern und EU-Gegnern zufriedenzustellen. Was nicht einfach war: Das Forum Demokratischer Sozialismus (FDS) forderte eine Republik Europa, also die Auflösung der Nationalstaaten. Die Antikapitalistische Linke (AKL) wiederum hatte „Die EU ist nicht zu reformieren“ in ihren Antrag geschrieben, was auf die Forderung nach einer Auflösung der EU hinausläuft. 24 Stunden lang feilschten die Genossen um einzelne Formulierungen.

Katja Kipping zeigte in ihrer Rede am Freitag eine leichte Schlagseite zugunsten der EU-Freunde. „Auf eine andere EU hinzuarbeiten ist die größere Liebeserklärung, als in Europa alles so zu lassen, wie es ist“, sagte sie. „Wir wollen kein Auseinanderbrechen der EU.“ Wer die EU-Debatte in der Linkspartei verstehen will, muss zwischen den Zeilen lesen: Um die Balance zwischen den Flügeln zu wahren, spricht die Linkspartei oft nüchtern vom „Neustart“ der EU und nicht pathetisch von einer „Liebeserklärung.“

Quelle          :          TAZ        >>>>>          weiterlesen

——————————————————————

Grafikquelle          :

Oben        —     Landtagswahl Thüringen am 14. September 2014

Autor      :     Olaf Kosinsky

CC BY-SA 3.0 de

Created: 14 September 2014

——————————

Unten       —         Flag of Die Linke

Abgelegt unter Europa, Medien, Nordrhein-Westfalen, P. DIE LINKE | Keine Kommentare »

Hin – Richten in Schland?

Erstellt von DL-Redaktion am 25. Februar 2019

Gesinnungsjurist Peter Königsfeld schlägt wieder zu

Datei:Bundesarchiv Bild 183-A1206-0011-001, Berlin, Pressekonferenz, Benjamin, Streit, Toeplitz.jpg

So kann  es vor Gericht aussehen.

Quelle   :    scharf  –  links

Von Holger Müller

Richter Königsfeld, der schon die trommelnde UP III („Unbekannte Person III“) wegen „rhythmischer Begleitung einer Straftat“ zu 9 Monaten Haft verurteilt hat, verhängte nun wieder eine vollkommen überzogene Strafe in gleicher Höhe gegen die junge Aktivistin „Eule“.
Trotz widersprüchlicher Aussagen der als Zeugen geladenen Polizisten ließ sich der Vorsitzende nicht von seinem gefestigten Willen abbringen, ein Exempel zu statuieren.

Gleichsam innerlich gefestigt hat er damals das komplett realitätsferne Urteil gegen die Trommlerin gefällt. Bei dem unverhältnismäßigen Urteil gegen UP III wegen der taktvollen Unterstützung „krimineller Umweltschützer“ zeigte er ebenfalls keine Gnade.
Seine Äußerungen bei der Begründung lassen die bei einem Richter nötige Distanz zur Person der Angeklagten schmerzlich vermissen.
Er griff Eule persönlich an in seiner Urteilsbegründung.
Königsfeld betonte, dass bei der Angeklagten „kein Zweifel über Entwicklungsverzögerung vorliegt“. Ebenso unterstellte er, dass „da erhebliche schädliche Neigungen vorliegen“ und dass Eule staatsfeindliche Ansichten vertritt.

In dunkelster Vorzeit deutscher Rechtsprechung wurde das in der Weimarer Republik gültige Prinzip „Erziehung statt Strafe“ 1943 vom Naziregime mit dem Reichsjugendgerichtsgesetz durch „Erziehung durch Strafe“, nämlich der Jugendstrafe „wegen schädlicher Neigungen“ abgelöst. Dieses allen neueren jugendpsychologischen Erkenntnissen widersprechende Prinzip wurde 1953 bei der Neu-fassung des Gesetzes übernommen.
Und wie man aktuell unschwer erkennen kann, findet es noch heute Anwendung in der aktuellen bundesrepublikanischen Rechtsprechung.

„Dieses Urteil ist auch ein Verdienst der hier anwesenden Sympathisanten“, so Königsfeld.
Deren lautstarke Unterstützung während der Verhandlung legte er als strafverschärfend für die angeklagte Aktivistin aus. Er fällte seinen Richterspruch also nicht nur aufgrund der Tatvorwürfe ihr gegenüber.

Auch bezog er die politische Haltung der Angeklagten mit ein.
Nahezu angewidert las er aus einem abgefangenen Brief der Angeklagten vor. Darin sprach sie von einem „Scheißstaat“.
Dass dieser Ausspruch der Angeklagten für ihn so bedeutend ist, dass er ihn explizit vorlesen musste, kann man nur als reine Gesinnungsjustiz bezeichnen.
Es darf vor Gericht keine Urteile nach politischen Ansichten geben. Das wäre Willkür und Amtsmissbrauch!
Die politische Gesinnung eines Angeklagten ist vom Gericht in keinster Weise zu würdigen. Trotzdem wurde hier ein rein politisch motiviertes Urteil gesprochen mit dem Ziel, den nötigen Widerstand gegen die Seilschaften von RWE und Landespolitik zu brechen.

Parteiisch ist die Justiz in dieser Thematik schon lange, spätestens erkennbar seit den späten fünfziger Jahren mit den Klagen der Bewohner der Gemeinden, die RWE weggebaggert hat, mit den Klagen gegen die Staublungenkrankheit und diversen Umweltverschmutzungen.
Mit der Folge, dass Staatsanwälte und die Polizei die Drecksarbeit für Konzerne wie RWE machen müssen.
Planetenweite Umweltschäden im Interesse raffgieriger Konzerne zu legitimieren scheint, gemessen am derzeitigen politischen Willen, zunehmend Hauptaufgabe der Justiz in unserem „Rechts-Staat“ zu werden.
Vielleicht sollte man aus Sicht der Umweltaktivisten mal die Idee ins Auge fassen, ein paar hundert Nazis zur Teilnahme an den Protesten im Hambi zu überreden. Diese würden dann bestimmt von Herrn Reul durch tausende Polizisten in ihrem Demonstrationsrecht geschützt!

Eines zeigt dieses verstörende Urteil ganz deutlich:
Der Versuch, Bäume schützen zu wollen, durch das Liegen in einer Hängematte, ist staatsgefährdend.
Bäume zu fällen, um durch fossile Brennstoffe Energie zu gewinnen und das Klima unwiederbringlich zu zerstören, ist hingegen lediglich gelebte Wirtschaftspolitik in NRW.
Zur Belohnung für die im wahrsten Sinne des Wortes „Dreckspolitik“ darf RWE nun Terminals für das umweltverachtende Fracking-Gas aus den USA bauen. Wird interessant sein, zu verfolgen, welche Volksvertreter sich hier wieder mitbereichern.

Laschets Kettenhund Reul wird ob dieser Nachricht der überzogen harten Bestrafung von Eule für einige Tage freudig mit dem Schwänzchen wedeln, ihm sei´s gegönnt nach all seinen bisherigen Schlappen und den beinahe alltäglichen Beweisen für seine Unfähigkeit im Amt.

Passend zur Thematik hat NRW-Bildungsministerin Gebauer, immerhin gelernte Rechtsanwaltsfachangestellte, den Schülern in NRW, die weiterhin engagiert am Klimastreik teilnehmen, mit Zwangsmaßnahmen der Polizei gedroht um sie so in die Schulen zu zwingen.

Wir können nur hoffen, dass die Geschichte das wahre Urteil über die Aktivisten im Hambacher Forst fällt. Hoffentlich hat die Gesellschaft dann aus den konzern- und kapitalgeneigten Richtersprüchen gelernt und stilisiert die Umweltaktivisten dann endlich zu dem, was sie in Wirklichkeit sind:
Zu Helden, denen man den allergrößten Dank und Respekt für ihren Kampf um unser aller Zukunft schuldet!

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————-

Grafikquelle        :           Berlin, Pressekonferenz, Benjamin, Streit, Toeplitz Info non-talk.svg

Es folgt die historische Originalbeschreibung, die das Bundesarchiv aus dokumentarischen Gründen übernommen hat. Diese kann allerdings fehlerhaft, tendenziös, überholt oder politisch extrem sein. Info non-talk.svg

Namensnennung: Bundesarchiv, Bild 183-A1206-0011-001 / Junge, Peter Heinz / CC-BY-SA 3.0

Abgelegt unter Kultur, Medien, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

Urheberrechtsreform-Piraten

Erstellt von DL-Redaktion am 24. Februar 2019

Demo gegen Artikel 13 ein voller Erfolg

Grumpy Cat builds a GNU Internet (9693327611).jpg

Der grimmige Linke Steckerzieher von der Saar ?

Quelle     :          Scharf  –  Links

Von Piratenpartei

In Köln gingen am Samstag erneut tausende Menschen auf die Straße, um gegen Artikel 13 in der geplanten Urheberrechtsreform zu protestieren [1]. Nach Meinung der Piratenpartei führt dieser zwingend zur Einsetzung sogenannter Uploadfilter, welche die freie Meinungsäußerung im Internet massiv einschränken würden.

Sebastian Alscher, Vorsitzender der Piratenpartei kommentiert:

„Die Urheberrechtsreform soll nach Jahren an die Anforderungen der Gegenwart angepasst werden. Es kann nicht sein, dass nach Jahren des Verhandelns auf Druck von Lobbyisten nun auf der Zielgeraden eine Änderung eingearbeitet wird, die bestehende Geschäftsmodelle schützt und an anderer Stelle eine Zensurinfrastruktur aufbaut, die die Kreativen einschränkt und neue Geschäftsmodelle schwächt. Nachdem sie jahrelang übergangen wurden, bringen tausende Kreative und Fans ihren Protest aus dem Netz auf die Straße. Sie fühlen sich von denjenigen hintergangen, die sich irrtümlich als ihre Vertreter ausgaben, und die die Lobbyisten pflegen – diejenigen Verleger, die diesen Politikern zu medialer Aufmerksamkeit und Öffentlichkeit verhelfen.“

Dennis Deutschkämer, stellvertretender Bundesvorsitzender und einer der Redner in

Köln ergänzt: „Artikel 13 zeigt, dass nicht nur das Internet nicht verstanden wurde, sondern eine ganze Kultur und Generation.Innerhalb kürzester Zeit konnten tausende Menschen auf die Straße geholt werden, das zeigt, in der Bewegung steckt sehr viel Energie.“

Datei:Spielbudenplatz Hamburg St. Pauli.jpg
Die Piratenpartei ruft gemeinsam mit den Partnern der #Saveyourinternet Kampagne am 23. März zu europaweiten Demonstrationen auf [2], bevor voraussichtlich Ende März final über die Urheberrechtsgesetzgebung im Europaparlament abgestimmt werden soll.

Quellen: [1] Eindrücke Demo 23.02 Köln [2] Europaweiter Demotag: www.piratenpartei.de/2019/02/14/23-maerz-demo-gegen-uploadfilter/

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————

Grafikquellen      :

Oben    —      Seen on the „Freedom not Fear“ protest rally against global internet surveillance at 7.9.2013 in Berlin,Germany: „Grumpy cat has to build a new (GNU) Internet because the NSA killed (bugged) the current one.“ The picture is a remix for the pirate party of germany of the original painting of Inti Orozco, see: https://plus.google.com/101156459815428661581/posts/BwLcunSAxsR

————————————–

Unten    —         Spielbudenplatz Hamburg St. Pauli

Quelle http://fotos.nocke.de/Piratenpartei/esso-hochhaeuser/
Urheber Frank Nocke
w:de:Creative Commons
Namensnennung
Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung 3.0 nicht portiert“ lizenziert.

Abgelegt unter Köln, P.Piraten, Politik und Netz, Überregional | Keine Kommentare »

Miethaie zur Verantwortung!

Erstellt von DL-Redaktion am 20. Februar 2019

„Miethaie zur Verantwortung ziehen!“

Datei:Dämmerung in Duisburg am Rhein.jpg

Quelle    :    Scharf  –  Links

Von DIE LINKE. Duisburg

Husemannstr.: LINKE fordert Zurückdrängung von Wohnkonzernen

„Die Räumung der Hochhäuser an der Husemannstraße kommt leider nicht aus heiterem Himmel“, erklärt Lukas Hirtz, Sprecher der LINKEn, „Schon länger beklagen sich die Mieterinnen und Mieter der Betroffenen Objekte bei uns über Missstände in ihren Häusern. Dass die Brandschutzmängel so gravierend sind hat jedoch niemand gedacht. Es ist leider typisch, dass Wohnkonzerne Miete abkassieren, sich aber nicht um die Häuser kümmern. Wohnen ist aber Menschenrecht. Die Räumung ist trauriger Höhepunkt, dass die Mieterinnen und Mieter unter dem Profitstreben leiden müssen.“

Seit ca. anderthalb Jahren ist DIE LINKE mit den Mieterinnen und Mietern der Husemannstraße 1 und 3 in Kontakt und kennt weitere Missstände in den Häusern. Am 14.2. mussten die Mieter wegen gravierender Mängel beim Brandschutz ihre Wohnungen binnen weniger Stunden verlassen.

„Für die Betroffenen ist es nun das wichtigste, dass sie schnellst möglich eine neue Wohnung bekommen, oder in ihre bisherigen zurückkommen.“ so Lukas Hirtz weiter „Die Räumung an sich war von der Stadt gut organisiert. Ich konnte mir vor Ort ein Bild der guten Arbeit von Polizei, Feuerwehr, Ordnungsamt und rotem Kreuz machen. Bei den zum Teil ehrenamtlichen Helferinnen und Helfern möchte ich mich hierfür ausdrücklich bedanken. Doch noch immer haben insbesondere diejenigen, die in die Notunterkünfte mussten, keine anständige Bleibe, da es wohl keine angemessenen Wohnungen gäbe. Die Situation belastet sie von Tag zu Tag mehr. Da Wohnkonzerne ihrer soziale und rechtlicher Pflicht wenn überhaupt nur sehr zögerlich nachkommen, sollte die Stadt schnellst möglich den Menschen helfen eine Wohnung zu finden. Hier bietet sich die Ottostr. 54-56 an, die der Stadt gehört und wo ca. 60 Wohnungen bezugsfertig auf Bewohner warten. So könnte den Betroffenen schnell und unbürokratisch geholfen werden. Angesichts dieses Dramas an der Husemannstraße sollte die Stadt nun umdenken und mehr günstigen Wohnraum erhalten, wie etwa an der Ottostraße, sowie eine Offensive für öffentlichen Wohnraum in ganz Duisburg starten. Mit der Gebag hat sie dazu alle Mittel zur Verfügung. Miethaie, die wie in der Husemannstraße Mieter gefährden müssen zurückgedrängt werden“

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————–

Grafikquelle     :           Morgendämmerung in Duisburg, DE-NW

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.
Namensnennung: CherryX per Wikimedia Commons

 

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Sozialpolitik, Überregional | Keine Kommentare »

Zum Hambacher Tagebau

Erstellt von DL-Redaktion am 19. Februar 2019

Kein Friede in den Dörfern

Aus Keyenberg Anett Selle und aus Berlin Jana Lapper

Der Konsens in der Kommission sollte den Streit um die Kohle beenden. Stattdessen bleiben die Fronten verhärtet: RWE reißt weiter Dörfer ab, Aktivist*innen besetzen Bagger. Und die Politik? Stellt die Einigung infrage.

en letzten Nagel biegt der Aktivist im Hambacher Forst mit der Hand um. Dann ist das Holzkreuz fertig, und der Mann nimmt es mit. Seit Tagen wächst die Zahl der Kreuze im umkämpften Wald neben dem Braunkohle-Tagebau Hambach: Das gelbe X hängt hier am Baum und da am gespannten Netz, es lehnt dort am Stamm und klemmt drüben zwischen Zweigen. „Wir werden uns auf dieses miese Spiel nicht einlassen“, sagt Clumsy, so nennt sich der Aktivist, der seit sieben Jahren im Wald lebt. „Von wegen ‚entweder Wald oder Dörfer’.“

In Nordrhein-Westfalen ­haben Um­weltaktivist*innen und An­woh­ner*in­nen die längste Zeit getrennt protestiert. Jetzt trifft man sich für gemeinsamen Protest. Denn sie haben das Gefühl, dass Tagebaubetreiber RWE und die Politik sie gegeneinander ausspielen wollen. Das gelbe Kreuz, das nun im Wald hängt, benutzen die Menschen in den zur Umsiedlung vorgesehenen Dörfern schon lange als Symbol des Widerstands. Eines dieser Dörfer ist Keyenberg am Tagebau Garzweiler.

Hier wohnt Norbert Winzen auf einem Hof aus denkmalgeschützten Vierkanthäusern: Drei Generationen seiner Familie leben aktuell hier, dar­unter sieben Kinder. Die Winzens besitzen Tausende Quadratmeter an landwirtschaftlichen Nutzflächen in Keyenberg. Für das neue Dorf, in das die Anwohner*innen umgesiedelt werden sollen, bekommen sie kein Angebot von RWE, berichtet Norbert Winzen. „Wir gehören zu denen, die hier zu viel Grund haben, um ihn zu ersetzen“, sagt Norbert Winzen. „Auf die Weise werden viele aus der Gemeinschaft gerissen, die nicht verkaufen wollen.“

Seit der Veröffentlichung des Abschlussberichtes der Kohlekommission läuft ein Deutungsstreit. Um möglichst alle Teilnehmenden zur Unterzeichnung zu bewegen, hat man viele Stellen schwammig formuliert. So heißt es, der Erhalt des Waldes am Tagebau Hambach sei „wünschenswert“, und mit den Dorfbewohnern am Tagebau Garzweiler solle gesprochen werden.

Eine Studie des Deutschen Instituts für Wirtschaftsforschung hat errechnet, dass sowohl der Wald als auch die Dörfer erhalten bleiben können und die bereits erschlossenen Tagebauflächen bis zum vereinbarten Ausstieg genug Kohle für die Kraftwerke liefern würden. Doch NRW-Ministerpräsident Armin Laschet (CDU) spielt den Wald und die Dörfer gegeneinander aus. „Wenn ein Gebiet herausgenommen wird, wird der Druck auf andere Gebiete höher“, meint er – und fügt hinzu, zu den Dörfern gebe es im Bericht der Kommission „nur eine allgemeine Beschreibung, aber keine Zielvorgabe“.

Der Druck auf die Dörfer hat sich tatsächlich erhöht. In Keyenberg installiert RWE gerade Grundwasserpumpen. Die braucht man nur, wenn die Dörfer abgebaggert werden sollten. „Seit der Veröffentlichung des Berichts ist es noch mal schlimmer geworden“, sagt Winzen. „Das Dorf ist Baulärm, Hämmern, Rattern jeden Tag.“ Denn im Bergrecht gelten keine Ruhezeiten. „Wir haben hier Kinder, und meine Mutter ist 75, die hält das kaum noch aus“, berichtet der Anwohner. „Ich tu mich schwer mit dem Wort ‚Schikane‘, aber dass so was in einem demokratischen Land möglich ist, hätte ich nie gedacht.“

Auch der BUND-Vorsitzende Hubert Weiger ist empört, dass RWE im Garzweiler Bereich mit weiteren Abbaggerungen Fakten schafft. „Damit wird der Beschluss der Kohlekommission infrage gestellt“, sagt er am Montag bei einer gemeinsamen Pressekonferenz mit Greenpeace-Geschäftsführer Martin Kaiser und DNR-Präsident Kay Niebert; die drei hatten die Umweltverbände in der Kommission vertreten.

„Die Zustimmung zum Kompromiss ist uns Verbänden nicht leicht gefallen“, sagt Martin Kaiser von Greenpeace. Dass die Verbände schließlich doch ihr Ja gaben, lag nur am schnellen Einstieg in den Ausstieg, den der Kompromiss vorsieht: Bis 2022 sollen – zusätzlich zu ohnehin schon geplanten Stilllegungen – Braunkohlewerke im Umfang von drei Gigawatt vom Netz genommen werden, und zwar allesamt im Westen. Darüber bestand in der Kommission Einigkeit.

Quelle       :        TAZ         >>>>>          weiterlesen

———————————————————————-

Hambi-Aktivistin verurteilt

Ein Exempel statuiert
Die fiese Fratze der Macht

von Bernd Mülleder

Tumulte im Gericht, Entsetzensschreie, rausgeschleifte Zuhörer: Die junge Hambach-Aktivistin Eule wird zu neun Monaten Jugendhaft verurteilt.

Entsetzensschreie. Höhnisches Gelächter. Dazu Zwischenrufe der rund 50 ZuhörerInnen wie „Gesinnungsjustiz“ und „Rechtsbeugung“: Als Richter Peter Königsfeld, ein älterer Herr mit markant schmalem Oberlippenbärtchen, sich am Montagabend durch die Begründung für sein harsches Urteil gegen die Hambach-Aktivistin Eule manövrierte, wurde es mit jedem seiner Sätze lauter im vollbesetzten Sitzungssaal 108 des Kerpener Amtsgerichts. Wütende Kommentare, Tumulte. Zwei Zuhörer wurden von Justizkräften rabiat aus dem Saal geschleift.

Schon das Strafmaß hatte überrascht: Neun Monate Jugendknast ohne Bewährung wegen Widerstand gegen die Staatsgewalt und versuchter gefährlicher Körperverletzung bei der Räumung im Hambacher Wald am 26. September vergangenen Jahres. Fast fünf Monate sitzt Eule schon ein. Die Urteilsbegründung wirkte dann wie ein Rückgriff in Zeiten von Rachejustiz und schwarzer Pädagogik.

„Kein Zweifel, dass eine Entwicklungsverzögerung vorliegt“, sprach Königsfeld über die junge Angeklagte. Arrest reiche nicht, „da erhebliche schädliche Neigungen vorliegen“, die Frau hege zudem „staatsfeindliche Ansichten“, wie sich aus ihren beschlagnahmten flapsigen Briefen aus dem Knast ableiten ließe. Mit demonstrativem Ekel las der Richter von den „Hampelmännchen in blau“ und dem „Scheiß-Staat“. Wer so schreibe, habe Erziehungs- und Persönlichkeitsmängel. Nein, bei Eule sei „kein rechtschaffener Lebenswandel zu erwarten“, stattdessen „neue Straffälligkeiten“.

Das Umfeld, im bürgerlichen Leben der Schoß der Familie, werde ihr nicht helfen: „Im Wald halten sich zunehmend gewaltbereite Chaoten auf“, mit zudem „erheblicher Zunahme an Gewalt“. Lachsalven. Neue Wutschreie. Zuletzt der Höhepunkt – denn die Zuhörer trifft auch noch Mitschuld am Knastgang: „Dieses Urteil ist auch ein Verdienst der hier anwesenden Sympathisanten“, so der Richter.

Ein politisches Urteil

Quelle        :     TAZ          >>>>>           weiterlesen

——————————————————————-

 Hambacher Polizeistatistik

Reuls Bedrohungsszenario

File:KAS-Reul, Herbert-Bild-6822-1.jpg

Kommentar  von Anett Selle

Mit fragwürdigen Statistiken versucht der NRW-Innenminister an den Hambacher Forst zu kommen. Das schafft Unmut in der Region.

In den Dörfern am Tagebau Garzweiler haben 43 Prozent der Menschen ihr Land noch nicht verkauft. Dieses Land möchte RWE haben. Obwohl aus dem Kohlekompromiss und aus Studien hervorgeht, dass die Kohle darunter nicht mehr gebraucht wird. Denn um Kohle allein geht es nicht mehr: Für den Strukturwandel in der Region wird viel Fläche benötigt, und die ist knapp. Wer Fläche besitzt, hat langfristig politischen Einfluss. Schon heute sprechen viele Kommunen von RWE als „starkem Partner“.

Die Dörfer tun sich mit den Aktivist*innen aus dem Hambacher Forst zusammen und warten auf die Politik. Doch die arbeitet ihre eigene Agenda ab. „Über 1.500 Polizeieinsätze“, so verkündet der nordrhein-westfälische Innenminister Herbert Reul (CDU) kürzlich in einem Bericht, habe es im Zusammenhang mit der „gewalt- und zerstörungsaffinen Straftätergruppe“ am Hambacher Forst gegeben – nur zwischen Oktober 2018 und Januar 2019.

Quelle     :         TAZ       >>>>>         weiterlesen

————————————————————–

Grafikquellen       :

Oben     —         Ortseinfahrt Keyenberg

2. von Oben       —      Die Eule als Patensymbol der Naturschutzgebiete

Abgelegt unter Medien, Nordrhein-Westfalen, Regierung, Umwelt | Keine Kommentare »

Schalke war ein Mann

Erstellt von DL-Redaktion am 8. Februar 2019

Nachruf auf Rudi Assauer

Schalke Assauer01.jpg

von Martin Krauss

Rudi Assauer inszenierte sich als Malocher und Macho. So verkörperte der ­Ex-Schalke-Manager eine besondere Form der Modernisierung des Fußballs.

Was bleibt, wenn ein Fußballmanager stirbt? Rudi Assauer ist tot, und hier sieht man: In besonderen Fällen ist es eine ganze Stadt, die bleibt.

Das beinah einzige Symbol der Stadt Gelsenkirchen, die große Indoor-Outdoor-Halle, die mittlerweile auf den Namen „Veltins-Arena“ hört, ist nicht nur quasi das Werk von Rudi Assauer, es ist auch das Bild Gelsenkirchens. Sonst ist da nichts.

Als Rudi Assauer 1993 zum zweiten Mal vom FC Schalke 04 als Manager verpflichtet wurde, gab es Fanproteste. „Wenn Assauer kommt, gehen wir“, stand auf Plakaten. Der Mann, der einst beim verhassten Nachbarn Borussia Dortmund kickte, hatte auf Schalke keine gute Bilanz hinterlassen, als er das erste Mal seinen Schreibtisch bezogen hatte: 1986 musste er gehen, als „Schuldenmacher“ galt der Manager.

Doch es gibt auch viele Stimmen, die in Assauer, der erste Profimanager, der je auf Schalke gewirkt hat, den Mann sehen, der die Grundlagen für spätere Erfolge legte – mit aller Ambivalenz, die eine Modernisierung bedeutet. Es hatte Gründe, dass Assauer 1993 zurückgeholt wurde.

Rudi Assauer, mit Gel in den Haaren und Zigarre im Mund, präsentierte sich als sozialer Aufsteiger – eine Art fußballerischer Gerhard Schröder. „Schlotbaron“ nannte ihn die FAZ, der „Pate von Schalke“ war er dem Kicker, „Graf Koks von der Gasanstalt“ schrieb der Focus, und die Bunte wählte ihn zu einem der „50 erotischsten Männer Deutschlands“.

Diese Attribute fing sich der „schöne Rudi“ (Bild) ein, als Schalke auf dem Sprung war, ein europäischer Spitzenklub zu werden: 1997 der Uefa-Pokal, 2001 die „Vier-Minuten-Meisterschaft“, als man in Schalke feierte und Bayern München noch in der Nachspielzeit einen umstrittenen Freistoß verwandelte.

Kapitalisierung als Arbeiterverein

2001 wurde auch die große Halle mit Rollrasen und aufschiebbarem Dach eingeweiht. Anfangs hieß sie noch „Arena AufSchalke“, und das verweist auf die Art, wie Assauer den fußballerischen Strukturwandel im Ruhrgebiet vollzog. Assauer war derjenige, der das „mangelhafte Deutsch der früheren Bergleute zum Kultbegriff vermarktet“, kritisierte der Schriftsteller Hans-Dieter Baroth. Da ist was dran.

Während einer ersten Schalker Amtszeit hatte Assauer noch zwei arbeitslose Jugendliche, die sich kein Ticket leisten konnten, abgekanzelt: „Hasse kein Pulver, brauch’se nich auf Schalke“ – so jedenfalls zitierte ihn der Spiegel damals. In seiner zweiten Amtszeit hatte Assauer aber dann das Fundament gelegt, dass ihm solche Sprüche nicht übelgenommen werden: Malochersprüche, vor Heimspielen wird das Steigerlied gespielt, die Mannschaft musste mal in den Pütt fahren, und Fans, die in der AufSchalke-Arena ein Bier trinken wollen, zahlen das mit der Knappenkarte.

Schalker Pokaljubel02.jpg

Es war die Kapitalisierung von Schalke 04 unter dem Etikett des Arbeitervereins. Dass dies auf Akzeptanz stieß, hat nicht – oder nicht nur – mit cleverer PR zu tun, sondern sehr wohl auch damit, dass auch Rudi Assauer nicht daran rührte, den FC Schalke als mitgliedergeführten Klub zu belassen. Bei allen anderen Erstligakonkurrenten ist die Profiabteilung ausgelagert, Konkurrent Borussia Dortmund ist sogar an der Börse.

 Aber auch wenn Assauer die Grundlagen schuf, dass Schalke modern wurde, der ganz große Erfolg – im Fußball nennt man so etwas Meisterschaft – blieb ihm und seinem Verein verwehrt. Und Assauer wusste auch damit umzugehen. „Selbst wenn wir verlieren, haben wir gewonnen, weil wir Schalker sind“, formulierte er, oder: „Wir haben den Schriftzug in unserem Vereinslogo in ‚Hosenscheißer 04‘ geändert. Wir konnten ein großes Sponsoringpaket mit einer Windelfirma schnüren.“
——————————————————————–
Grafikquellen        :

 

Oben     —         Description: Rudi Assauer, FC Schalke 04

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
———————–

Unten       —       Description: Pokalsieger 2002 FC Schalke 04

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Deutschland, Kultur, Medien, Nordrhein-Westfalen | Keine Kommentare »

Grundrente nicht zerreden,

Erstellt von DL-Redaktion am 6. Februar 2019

 sondern sachlich kritisieren

Matthias W. Birkwald 2013.jpg

Quelle      :    Scharf – Links

Von Matthias W. Birkwald, MdB

„Die unter dem falschen Namen ,Grundrente’ wiederauferstandene  ,Rente nach Mindestentgeltpunkten’ könnte ein wichtiger Baustein im Kampf gegen Altersarmut werden, wenn sie jetzt nicht von den Schwarze-Null-Fetischistinnen und Marktradikalen in der Union verwässert oder blockiert wird“, erklärt Matthias W. Birkwald, rentenpolitischer Sprecher der Fraktion DIE LINKE. Birkwald weiter:

„Menschen, die 35 Jahre oder länger im Niedriglohnsektor schuften mussten, haben sich ihr Existenzminimum im Alter ohne Bedürftigkeitsprüfung und ohne Gang zum Sozialamt redlich verdient. Eine deutlich verbesserte ‚Rente nach Mindestentgeltpunkten‘ fordert DIE LINKE schon seit Langem. Ich begrüße deshalb den Vorschlag von Sozialminister Hubertus Heil. Deshalb darf die sogenannte Grundrente jetzt nicht zerredet werden. Den Ausgaben für die neue Rentenart stehen bisher nicht bezifferte Einsparungen bei der ,Grundsicherung im Alter’ entgegen. Das Sozialministerium muss hier schleunigst Zahlen vorlegen.

Wenn die Union und der SPD-Finanzminister dann immer noch die Kosten der Grundrente drücken wollen, dann gäbe es auch dafür eine einfache Lösung: Olaf Scholz müsste seine eigene Sonntagsforderung durchsetzen, dass bis 2021 die Arbeitgeber und Arbeitgeberinnen in Deutschland einen gesetzlichen Mindestlohn von zwölf Euro zahlen.

Aber auch Arbeitsminister Heil muss mehr Sachlichkeit und Fachlichkeit in die Debatte bringen: Denn mit der sogenannten Grundrente wird für viele Rentnerinnen und Rentner die Armutsgrenze der EU für Deutschland [1.096 Euro (EU-SILC 2017)] in weiter Ferne bleiben. Hubertus Heil hat viel zu hohe Erwartungen geweckt, denn wer mit der Rente die Menschen aus der Sozialhilfefalle bringen möchte, muss sagen, was die ,Grundrente‘ netto, also nach Abzug der Krankenkassen- und Pflegeversicherungsbeiträge, brächte.

Die Sozialhilfeschwelle liegt aktuell bei 796 Euro netto. Die von Hubertus Heil beispielhaft genannte Friseurin, die 40 Jahre zum gesetzlichen Mindestlohn gearbeitet hat und damit durchschnittlich 0,4 EPs erworben habe (in Wirklichkeit ergeben 9,19 Euro gesetzlicher Mindestlohn übrigens 0,47 Entgeltpunkte) erhielte also mit der sogenannten Grundrente 960,90 Euro brutto statt 512,48 Euro. Schön und gut, aber: Netto wären das nur 855,20 Euro Rente und damit läge sie nur 59 Euro über der durchschnittlichen ‚Grundsicherung im Alter‘, dem Rentner-Hartz IV.

Bei 35 Jahren zum gesetzlichen Mindestlohn brächte die, Grundrente’ zwar 896 Euro brutto, aber eben nur 798,19 Euro netto. Das sind nur popelige zwei Euro über der Sozialhilfeschwelle bzw. dem durchschnittlichen Gesamtbedarf der ,Grundsicherung im Alter’ bei Alleinstehenden.

Dies alles zeigt: Auch wenn die sogenannte Grundrente hülfe, Menschen würdevoll aus der verdeckten Armut zu holen, wäre eine einkommens- und vermögensgeprüfte ‚Solidarische Mindestrente‘ in Höhe von 1050 Euro netto (für Alleinstehende) der bessere Weg. Sie sollte – dem Beispiel Österreichs folgend – als Zuschlag bis zur Armutsgrenze gezahlt werden, wenn die Summe aller Alterseinkünfte die Armutsgrenze nicht erreichen würde.“

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————————

Grafikquelle       :       Matthias W. Birkwald

Abgelegt unter Bundestag, Nordrhein-Westfalen, Opposition, P. DIE LINKE | 1 Kommentar »

Die Novizin – Anja Karliczek

Erstellt von DL-Redaktion am 2. Februar 2019

Anja Karliczek als Überraschung im Kabinett Merkel

Re publica 18 - Day 1 (26985174727).jpg

Gut gezeigt: Das Ei darf nie klüger als die Henne sein.

Von Anna Lehmann

Anja Karliczek war die Überraschung im Kabinett Merkel. Eine Hotelfachfrau als Bundesbildungsministerin? WissenschaftlerInnen begegnen ihr mit Dünkel und Herablassung. Karliczek muss sich im Amt beweisen. Die Zeit wird allmählich knapp.

Da hat sich die Johannes-Grundschule in Emsdetten in Westfalen nun wochenlang auf den Besuch aus Berlin vorbereitet. Im Sachunterricht haben sie immer wieder über Demokratie gesprochen, das Schülerparlament ist zusammengekommen, der Chor hat das Lied „Schule ist mehr“ einstudiert und eine Choreografie mit bunten Tüchern.

54 Mädchen und Jungen, ausgewählt per Los, dürfen in der Aula des dreistöckigen Betonbaus im Kreis sitzen, sie dürfen dem Gast aus Berlin die vorbereiteten Fragen stellen: Über was kannst du alles bestimmen? Arbeitest du mit Angela Merkel zusammen? Wann kriegen wir schnelles Internet? Und dann, nach fast einer Stunde, fragt der kleine Junge mit den kurzen dunklen Haaren, der schon seit geraumer Zeit auf seinem Stuhl hin und her gerutscht ist: „Wie heißt du?“

„Ich heiße Anja Karliczek“, sagt Anja Karliczek. Und lacht. Sie ist es gewöhnt, dass Leute fragen, wer sie eigentlich ist. Hier in ihrem eigenen Wahlkreis im Tecklenburger Land passiert ihr das zwar selten, seit sie im März 2018 neu ins Amt kam, tauchte die Frage aber häufiger auf: Wer ist die neue Bundesbildungsministerin? Gestellt wird sie mal mit herablassender, mal mit indignierter Attitüde, selten so interessiert wie von dem Grundschüler in Emsdetten.

Eine gelernte Hotelfachfrau als Wissenschaftsministerin? Ts, ts, die Eminenzen schüttelten den Kopf. Ihre Vorgängerin war ja immerhin Professorin, wenn auch an einer – ts, ts – Fachhochschule.

Bei der Personalauswahl für ihre Kabinette war Angela Merkel immer wieder für eine Überraschung gut: Ursula von der Leyen als Verteidigungsministerin, Kristina Schröder als Familienministerin. Im vierten Kabinett präsentierte Merkel Anja Karliczek als ihren Joker. Ob die Kanzlerin hier das richtige Gespür bewies? Kann Karliczek Bildung und Forschung? Die Zweifel sind da – nicht nur in den Hochschulen und bei der Opposition.

Auch in der eigenen Partei fallen die Urteile nach zehn Monaten im Amt eher harsch aus: keine Idee, keine Vision, keine Ahnung.

Schon vor der Bundestagswahl 2017 stand fest, dass Bundesbildungsministerin Johanna Wanka in Rente geht. Klar war also, dass jemand Neues kommt. Die Koalitionsverhandlungen zogen sich, Wankas Renteneintritt verschob sich von Monat zu Monat. Lange spekulierte man, wer sie beerben könnte. Hubertus Heil von der SPD hegte Ambitionen. Viele wünschten sich Helge Braun, der Arzt aus Gießen war schon mal Staatsminister und kennt das Haus. Monika Grütters und Annette Widmann-Mauz waren ebenfalls im Gespräch – die eine ist nun Staatsministerin für Kultur, die andere für Integration.

Ende Februar 2018 war klar: Zum dritten Mal in Folge geht das Bildungsministerium an die CDU, Anja Karliczek wird die neue Chefin.

Das Bundesministerium für Bildung und Forschung, das sind 58.000 Quadratmeter Stahlbeton und Glas, das sind 1.200 Mitarbeiter und Mitarbeiterinnen, von denen 70 Prozent am alten Dienstsitz in Bonn arbeiten, die anderen 30 am Hauptsitz in Berlin. Das sind 18 Milliarden Euro Budget im Jahr – der viertgrößte Etat eines Ministeriums.

Geld, das laut Koalitionsvertrag ausgegeben werden soll: für Schulen, die digital und ganztags unterrichten, für Hochschulen, die Studienplätze für Erstsemester sowie Forschungslabore für Nobelpreisträger in spe anbieten, für Forschung der Spitzenklasse. Deutschland soll führend auf dem Gebiet der künstlichen Intelligenz werden, Vorreiter bei der Gesundheitsforschung.

„Der Koalitionsvertrag ist gut“, sagt ein CDU-Bundestagsabgeordneter, der der Arbeitsgruppe Bildung und Forschung der Union angehört. „Nun müssten die Vorlagen auch in Tore verwandelt werden.“ Die Performance der zuständigen Ministerin, so formuliert er vorsichtig, könnte besser sein. Müsste, könnte – Karliczeks Wirken steht bisher im Konjunktiv.

Brochterbeck Ringhotel Teutoburger Wald 01.jpg

Um Tore zu schießen, braucht eine Bildungsministerin die Länder. Egal, ob es um Studienplätze oder digitale Schulen geht. 16 Verhandlungspartner, 16 Sach- und Machtinteressen. Bildung ist eben Ländersache. Aber: Ein großer Teil des Budgets fließt in die Forschung, hier sind die Länder finanziell auf den Bund angewiesen, hier kann eine Ministerin sich austoben.

Was muss eine Bundesbildungsministerin können, um mit den Ländern zu verhandeln?

Eine, die es wissen muss, ist Johanna Wanka. Karliczeks Vorgängerin ruft aus dem schönen Havelberg in Sachsen-Anhalt an. Wanka genießt den Ruhestand, sie kann dem Kammermusikorchester nebenan beim Proben zuhören, pflegt den Garten, kümmert sich um die Enkeltöchter. „Ich mache nur noch das, was mir Freude macht.“ Wanka will sich nicht zu ihrer Nachfolgerin äußern – nicht ihr Stil. Aber über das Amt selbst spricht sie. „Was Sie können müssen? Sie müssen Forderungen stellen können“, sagt Wanka. „Als Bundesbildungsministerin steht es oft 16 zu 1. Sechzehn MinisterInnen gegen eine. Bei allem Respekt vor den Länderinteressen – Sie müssen kämpfen.“

Vor Streit mit den Ländern schreckte Wanka während ihrer Amtszeit nicht zurück. Zusammen mit der damaligen Staatsministerin Cornelia Quennet-Thielen nahm sie die Länder im Gegenzug für zwei Milliarden vom Bund beim Qualitätspakt Lehre in die Pflicht und legte den Digitalpakt auf.

Tecklenburg, Anja Karliczeks Ortsverband im katholischen Münsterland, ist eine der wohlhabendsten Gemeinden Deutschlands, jeden Sommer kommen Zehntausende Touristen für Musicals in die Festspielstadt. Im Winter ist das Stadtzentrum verlassen, ein einsamer Spaziergänger murmelt: „Hier möchte ich nicht begraben sein“..Hier begann 2004 Karliczeks politische Karriere.

Hinter der Tür eines Einfamilienhauses ein dunkles Bellen: Egbert Friedrich, ein drahtiger Mittfünfziger mit Brille, schickt den Hund ins Nebenzimmer und bittet an den Küchentisch, auf dem eine Thermoskanne Kaffee bereit steht. Auf der Eckbank sitzt auch Willi Witt, kurze graue Haare, gemütliches Lächeln. Friedrich ist Fraktionsvorsitzender, Witt Schriftführer der hiesigen CDU. Für sie ist Anja Karliczek nur „die Anja“.

Egbert Friedrich und Anja Karliczek kamen 2004 beide neu in den Stadtrat. Er damals noch für die SPD, sie für die CDU. Ihre Kinder – beide haben drei – waren damals klein. Karliczek und Friedrich saßen sich alle ein bis zwei Monate im Sitzungssaal des Rathauses gegenüber. Zusammen warben sie um einen geeigneten Betreiber für die Ganztagsbetreuung an der Schule oder für ein neues Hotel im Stadtzentrum. Parteigrenzen zählen hier nicht viel. „In der Lokalpolitik haben Sie Sachthemen. Da wird gefragt, was gut für den Ort ist“, sagt Friedrich. Die Anja im Stadtrat erlebte er als sachorientiert und pragmatisch. „Sie eierte nicht herum und argumentierte nicht ideologisch. Sie hat eben das Herz am rechten Fleck.“

Später warb sie ihn, den SPDler, für die CDU. Im Nebenzimmer, wo nun der Hund hockt, saßen sie auf der Couch. Er vertrete doch im Grunde die gleichen Themen, sagte Karliczek zu Friedrich. Friedrich wechselte die Fraktion, 2015, als Karliczek schon im Bundestag war, wurde er ihr Nachfolger als Vorsitzender der CDU-Stadtratsfraktion „Sie hat mich geschickt eingefangen. Sich ihr anzuschließen und ihren Gedanken zu folgen ist nicht schwierig.“

Egbert Friedrich und Willi Witt gehören zum kleinen Kreis von Menschen, die nicht überrascht waren, als Karliczek zur Ministerin berufen wurde. „Aus der wird mal was, das war mir von Anfang an klar“, sagt Witt. Warum? „Weil sie gut ist.“ Er nickt, als wäre das doch klar. Witt kennt Karliczek, seit sie ein kleines Mädchen war, mit den Eltern spielte er im Tennisverein, als langjähriges CDU-Mitglied im Stadtverband begleitete er Karliczek auf ihrem Weg in die Politik. „Die Anja hört viel zu und fragt viel nach. Sie ist interessiert und hat eine schnelle Auffassungsgabe.“

2012 fragt die CDU-Stadtratsfraktion Karliczek, ob sie sich nicht für ein Bundestagsmandat bewerben wolle. Die Kandidatenkür der CDU beschreiben die Westfälischen Nachrichten als „Wahl-Krimi“. Drei Kandidaten bewerben sich auf das Direktmandat, der Saal im Hotel „Mutter Bahr“ ist überfüllt. Karliczek spricht als Zweite. Die Zeitung notiert: „Schutz der Familie, Mittelstandspolitik sind ihre Schwerpunkte. Ihre Rede ist schwächer, nicht frei von Phrasen. Aber: Karliczek strahlt Ehrgeiz aus, wirkt sympathisch, offen, kämpferisch, ‚brennt‘ für ihr Ziel.“

Karliczek gewinnt mit drei Stimmen Vorsprung. Bei der Bundestagswahl 2013 holt sie für die CDU das Mandat. Ab dann geht es für sie nur nach oben: Mitglied im einflussreichen Finanzausschuss, 2017 eine von vier Parlamentarischen Geschäftsführern der Unions-Fraktion, 2018 Bundesbildungsministerin.

„Netzwerke zu bilden, das war schon immer ihre größte Stärke“, sagt Witt. Diese Fähigkeit, so schildert er es, half ihr auch beim Kampf um das Direktmandat 2012, Karliczeks Eintrittskarte in die Bundespolitik.

Tecklenburg Markt.jpg

Tecklenburg besteht aus vier Stadtteilen: Tecklenburg, Brochterbeck, Ledde und Leeden. Um die Mehrheit der Delegierten für sich zu gewinnen, brauchte die Brochterbecker Kandidatin Karliczek, die als Außenseiterin galt, Stimmen aus den anderen Stadtteilen. „Da müssen Sie richtig hart arbeiten, um den Wahlkreis zu überzeugen“, sagt Witt. Karliczek zu unterschätzen, hält er für einen Fehler. „Nee, nee, die ist nicht nur nett.“

Ist die Frau mit dem unbeschwerten Lachen am Ende eine Angela Merkel aus dem Tecklenburger Land? Zuverlässig unterbewertet, doch bereit, im richtigen Moment die Konkurrenz beiseite zu schubsen?

Wenn Karliczek ihren Weg in die Machtzen­tren der Berliner Republik beschreibt, dann bekommt man den Eindruck, sie habe zunächst mehr die Pläne anderer abgearbeitet als ihre eigenen. Für den Bundestag kandidierte sie, weil sie gefragt wurde, Parlamentarische Geschäftsführerin wurde sie, weil man sie fragte und als Bundesbildungsministerin – „ja, auch da wurde ich gefragt.“ Sie lacht, herzlich und unprätentiös.

Quelle     :           TAZ         >>>>>            weiterlesen

—————————————————————————–

Grafikquellen      :

Oben      —       02.05.2018, Berlin: Andreas Gebhard führt Anja Karliczek, Deutsche Bundesministerin für Bildung und Forschung, über die re:publica. Die re:publica ist eine der weltweit wichtigsten Konferenzen zu den Themen der digitalen Gesellschaft und findet in diesem Jahr vom 02. bis 04. Mai in der STATION-Berlin statt. Foto: Gregor Fischer/re:publica

Abgelegt unter Bildung, Nordrhein-Westfalen, P.CDU / CSU, Regierung | Keine Kommentare »

Krass und verdienstvoll:

Erstellt von DL-Redaktion am 1. Februar 2019

TV-Ikone Hella von Sinnen wird 60

2015-03-29 384 Hella von Sinnen.JPG

von Jan Feddersen

Als sie zum Fernsehen kam, war sie kulturell längst in einem schönen, aufregenden, interessanten Prozess der Selbstfindung ganz und gar bei sich: Hella von Sinnen war, als RTL sie mit Hugo Egon Balder 1988 für die Show „Alles nichts oder?!“ auf die Bühne des Aufzeichnungsstudios stellte, keine Newcomerin, in Köln vor allem keine Unbekannte: Sie lebte längst im lesbisch-schwulen Establishment von Köln, war mit Dirk Bach busenbefreundet, lernte bei der Theater- und Camp-Legende Walter Bockmayer das boulevardeske Theaterspielen, kannte Göttin & die Welt im LGBTI*-Kulturen gegenüber nicht gerade verschlossenen Rheinland, ortsüblich mit allen per Du.

Die Hella, das war ein Geschöpf ohne viel Kunstgetue, aber mächtig künstlerischem Vermögen. Sie gilt als schräg, schrill, laut, ja, vorlaut, als ungehörig, undamenhaft. Alles an ihr und durch sie lärmt, auch die Klamotten, deren Auswahl offenbar unter der Überschrift ausgesucht wurden: beige, in der lichtschluckend fahlen Variante? Ohne mich und niemals.

Dirk bach hella von sinnen 20061130.jpg

Sie konnte Slapstick. Sie hatte nichts dagegen, in, für die feinsinnigen Gemüter, trashigsten Shows sich mit Torten bewerfen zu lassen. Sie konnte sich entblößen, weil sie sich nicht zu blamieren wusste. Und Hella Kemper, gebürtige Gummersbacherin, ist politisch seit eh und je. Sie drehte diesen genialen TV-Sport zu Aids: Sie, Hella von Sinnen, sitzt im Supermarkt an der Kasse und will einem jungen Mann die Präservative abkassieren. Er hofft auf Diskretion. Aber Hella, die Frau mit dem guten Herz, grölt mit tragender Stimme, die es selbst gegen im Sturm wogende Kornfelder aufnehmen könnte, durch den Laden: „Tiiina, wat kosten die Kondome?“ Lernziel: Über das Sexuelle nicht schweigen, Aids verdient Aufklärung, nicht Angstmache.

Quelle     :        TAZ             >>>>>              weiterlesen

Da es so schön war :

Hier der Werbespot auf YouTube

—————————————————————–

Grafikquellen      :

Oben     —           Hella von Sinnen bei der Deutschlandpremiere von „Mara und der Feuerbringer“, am 29. März 2015, im Cinedom Köln

Abgelegt unter Feuilleton, Köln, Kultur, Überregional | Keine Kommentare »

Nachfolge ungeklärt

Erstellt von DL-Redaktion am 30. Januar 2019

Im Studium wurden Abtreibungen nicht gelehrt

6439 Berlin.JPG

Gebäude des Berliner Charite Medical Campus

von Hanna Voß

Frauen, die ungewollt schwanger sind, finden in Deutschland immer seltener Ärzte, die Abtreibungen durchführen. Eine Ärztin aus Bremen will das ändern. Aber das ist gar nicht so einfach.

Noch zwei Monate wird er es machen. Dann hört er auf, nach mehr als 30 Jahren. Als einziger Arzt der Stadt, der abtreibt. Bis jetzt hat Wolfgang Burkart, 68, niemanden in Münster gefunden, der ihm nachfolgt. An einem Sonntag im April lässt er sich in seinem Büro schnaufend in den Schreibtischstuhl fallen. „Tja“, sagt Burkart und schiebt seinen Körper an den Schreibtisch heran, „will sich eben niemand die Finger schmutzig machen.“

Auch er selbst lange nicht. „Bin da reingeschlittert, nech.“ Burkart schiebt dieses Füllwort, wie so oft, nach. Eine seiner früheren Hebammen war schwanger geworden, ungewollt. Burkart gab ihr eine Adresse, wollte sie zu dem Arzt in Dortmund schicken, zu dem er Patientinnen immer schickte. „Da hat sie sich an die Stirn getippt, gesagt, Burkart, du spinnst wohl, du bist mein Arzt, du operierst, und ich weiß, dass du das kannst.“ Burkarts Augen suchen etwas, an dem sie sich festhalten können, bis sie eine Packung Taschentücher finden. „Und da hatte sie natürlich komplett recht.“

1981 sah er noch eine Frau sterben, die sich Seifenlauge in die Gebärmutter gespritzt hatte. „Ist von innen verblutet“, knurrt er. Und dann: „Es war für mich ein Prozess, zu begreifen, Schwangerschaftsabbrüche wird es immer geben.“

Doch immer weniger Ärztinnen und Ärzte in Deutschland führen sie durch. Wie das Statistische Bundesamt auf taz-Anfrage mitteilt, ist die Zahl in den vergangenen 15 Jahren um mehr als 40 Prozent gesunken. 2003 waren es noch 2.050 Einrichtungen, die dem Statistischen Bundesamt Abbrüche gemeldet haben, im dritten Quartal 2018 nur noch 1.173.

File:Bundesarchiv Bild 183-M1008-0003, Berlin, Charité, Frauenklinik, Operation.jpg

In Trier müssen ungewollt Schwangere mehr als 100 Kilometer bis ins Saarland fahren, um eine Abtreibung zu be­kommen. Im hessischen Fulda führt seit Jahren niemand Schwangerschaftsabbrüche durch, auch hier fahren die Frauen 80 bis 100 Kilometer weit. In Niedersachsen sind es je nach Region bis zu 150 Kilometer. In länd­lichen und katholischen Gegenden, in Niederbayern etwa, ist die Lage noch dramatischer.

Seit Jahren weisen die Schwangerschaftskonfliktbera­tungsstellen ihre Landesregierungen und Gesundheitsministerien auf diesen Mangel hin. Die jedoch reagieren meist nicht einmal. Dabei müssen die Länder nach dem Schwangerschaftskonfliktgesetz ein ausreichendes Angebot an Praxen und Kliniken für Schwangerschaftsabbrüche sicherstellen.

Einige Ärzt*innen übernehmen Abtreibungen nur für ihre eigenen Patientinnen. Andere machen ausschließlich medikamentöse Abbrüche, die nur bis zur 9. Woche nach dem Beginn der letzten Regel möglich sind. Wieder andere weigern sich, operative Abtreibungen bis zur 12. Woche vorzunehmen. Dadurch sinkt die Zahl der infrage kommenden Ärzt*innen weiter, und die Frauen erhalten ihren Termin, wenn überhaupt, immer später.

Warum ist das so, was sind die Geschichten hinter den Zahlen?

„Es will sich niemand die Finger schmutzig machen, nech?“, hatte Burkart gesagt. Man müsse damit in Berührung kommen, sonst fange man nicht an. So wie er selbst wegen seiner Hebamme. Danach hat er auch Abtreibungen für seine eigenen Patientinnen gemacht. Und schließlich hätten Kollegen ihre betroffenen Frauen zu ihm, zum Burkart, geschickt. „Plötzlich hatte ich nicht mehr drei und sieben Abbrüche im Quartal, sondern 140.“

Früher gab es mehrere wie ihn: Ärzte, die „reingeschlittert“ sind, die es einfach gemacht haben. Aus Pragmatismus, ohne sich politisch zu positionieren. Und es gab die anderen, die Idea­listen, die es machen wollten. Wie die Gießener Allgemeinmedizinerin Kristina Hänel, die berühmt wurde, weil sie auf ihrer Website darüber informiert, dass sie Schwangerschaftsabbrüche durchführt, und deshalb zu einer Geldstrafe von 6.000 Euro verurteilt wurde. Verurteilt nach Paragraf 219a, der Werbung für einen Schwangerschaftsabbruch verbietet, aber auch dann greift, wenn Ärzt*innen nur sachlich über ihr Angebot informieren.

Auch der Schwangerschaftsabbruch an sich ist nach Paragraf 218 des Strafgesetzbuchs noch immer illegal und kann mit einer Freiheitsstrafe von bis zu drei Jahren geahndet werden. Er bleibt jedoch straffrei, wenn ungewollt Schwangere sich haben beraten und drei Tage Bedenkzeit haben verstreichen lassen und wenn der Abbruch in den ersten zwölf Wochen nach der Empfängnis von einem Arzt vorgenommen wird.

„Man spürt regelrecht, wie die Politik sich gewunden hat. Wie sie nicht zugeben konnte, dass es den Schwangerschaftsabbruch braucht. Das Verbot sollte unbedingt im Gesetz stehen.“ Was aus Burkarts Mund in den weißen Schnauzbart hineinplätschert, ist nicht immer einfach zu verstehen. „Es wäre viel klüger gewesen, zu sagen, der gewollte und von einem Doktor vorgenommene Schwangerschaftsabbruch ist bis zur 14. Woche erlaubt, und alle anderen Fälle sind verboten. Er wäre legalisiert, eine Frau bräuchte sich nicht zu schämen, und ein Doktor müsste keine Angst vorm Gefängnis haben.“

Zwar steigt die absolute Zahl von Ärzt*innen in Deutschland immerfort, gleichzeitig nimmt in einer Gesellschaft des langen Lebens aber auch der Behandlungsbedarf zu. Insgesamt gibt es zu wenige Mediziner*innen. Wenn die Ärzt*innen aus der Babyboomergeneration nach und nach in Rente gehen, verschärft sich dieser Mangel noch. Nach Ansicht des Marburger Bunds, dem Verband der angestellten Ärzte, setzt sich ein weiterer Trend fort: Ärzt*innen lassen sich immer seltener nieder, sondern arbeiten als Angestellte in Kliniken, großen Praxen und medizinischen Versorgungszentren. Dort entscheidet dann der Chefarzt, ob abgetrieben wird oder nicht.

Früher lohnte sich der Schwangerschaftsabbruch zumindest finanziell noch einigermaßen. Als Burkart anfing, bekam er für einen Abbruch 360 D-Mark, heute sind es noch 112 Euro. Gleichzeitig steigen die Anforderungen an das ambulante Operieren und die Kosten enorm. Abgesehen davon aber hat sich noch etwas verändert, sagt Burkart. Er spricht vom „moralischen Zeigefinger der Gesellschaft“, und die Schnauzbarthaare flattern in der Atemluft, die er dabei ausstößt, wie eine Girlande im Wind. „100 Prozent der Frauen, die zu mir kommen, haben Vorurteile und Schuldgefühle. Sie glauben, danach nicht mehr schwanger werden zu können, sie schämen sich, dass ihnen ‚so etwas‘ passiert ist.“ Burkart schüttelt den Kopf. „Ich habe alle Frauen dabei, von 12 bis 54, von religiös bis atheistisch, von unverheiratet bis 5-fach-Mutter, und sie kommen alle mit den gleichen Vorbehalten.“ Im Juni wird Burkart aufhören. Und weiß nicht, wie es für ungewollt Schwangere in Münster weitergeht.

An einem heißen Tag Ende August zieht Svenja Addicks ihre Knie zu sich heran, stellt die nackten Füße auf den Sessel, sagt: „Morgen lerne ich Wolfgang Burkart kennen.“ Sie sitzt in dem Zimmer einer Mitbewohnerin, das gerade frei ist, so etwas passiert in einer 9er-WG. Svenja Addicks ist nicht der wirkliche Name der jungen Frau in dieser Geschichte. Addicks hat lange mit sich gerungen, dann aber entschieden, dass ihr richtiger Name nicht erwähnt werden soll, der taz ist er aber bekannt. Sie rechnet mit Anfeindungen, mit Hass, der ihre sonstige politische Arbeit beeinträchtigen würde.

Denn Svenja Addicks, 29, ist Ärztin – und will Abtreibungen machen. Die Not ist groß, nicht nur in Münster, sondern auch in Bremen, wo sie wohnt. Dort betreibt Pro Familia eines von vier medizinischen Zentren in Deutschland. 80 Prozent aller Abtreibungen in Bremen werden dort durchgeführt. Jahrzehntelang arbeitete das Zentrum mit Ärzten aus den Niederlanden zusammen. Doch auch die bleiben mittlerweile lieber dort, weil das gesellschaftliche Klima besser ist und die Bezahlung auch. Als sie niemanden für das Bremer Zentrum fanden, schrieb die Geschäftsführerin von Pro Familia mehr als 700 Ärzt*innen an, keiner von ihnen antwortete darauf. Sie schrieb auch an den Verteiler der „Kritischen Mediziner*innen“. Und diese Mail las Svenja Addicks.

Wenige Wochen zuvor hatte Addicks eine Veranstaltung der Gruppe in Frankfurt besucht und dort Kristina Hänel reden gehört. „Sie hat von der Unterversorgung in Deutschland gesprochen, auf uns eingewirkt, es zu lernen, Tutor*innen zu suchen, die es uns beibringen“, erzählt Addicks. Als die Mail von Pro Familia bei ihr einging, schrieb sie zurück.

„Und jetzt gibt es einen Plan“, sagt sie. Zwei Ärzte bilden Addicks aus. Sie überbrücken so den schlimmsten Versorgungsengpass in Bremen und bringen gleichzeitig einer jungen Ärztin bei, wie es geht. Einer der Ärzte ist Wolfgang Burkart aus Münster. Er ist mittlerweile Rentner, zweimal in der Woche fährt er die 170 Kilometer bis nach Bremen, um dort Nachwuchsarbeit zu machen. Bei ihm in Münster hat sich noch niemand gefunden, der Abtreibungen durchführt. Der andere Arzt, der Addicks ausbildet, ist Dirk Boumann, ein Holländer, der jahrzehntelang im Bremer Zentrum gearbeitet hat und auch aus der Rente zurückkehrte. Ohne die beiden hätte der Betrieb dort eingestellt werden müssen.

Addicks will den Abortion Doctor machen; hat sich die Ausbildung, die es in dieser Form nur in den Niederlanden gibt, selbst organisiert. Ein standardisierter OP-Katalog sieht vor, wie viele Eingriffe ein Abtreibungsarzt in welchen Schwangerschaftswochen durchgeführt haben muss, bevor er schließlich eine Prüfung ablegt. Zwei Tage die Woche ist Addicks nun im Bremer Zentrum tätig, macht bis zu 15 Abtreibungen am Tag.

Ab 2009 studierte Addicks in Lübeck Medizin. „Da war der Schwangerschaftsabbruch praktisch kein Thema.“ Mal eine Folie zur rechtlichen Situation, mehr nicht. „Das ist doch verrückt, ich studiere Medizin und nicht Jura.“ Will sie sich über die medizinischen Methoden informieren, geht das nicht auf Deutsch: „Es existieren überhaupt keine medizinischen Leitlinien zum Schwangerschaftsabbruch. Normalerweise gibt es Vorgaben für jeden Eingriff, nur dafür nicht.“ Bereits 2014 hatte Pro Familia das in einem Rundbrief kritisiert. Addicks ist überzeugt: „Das hängt damit zusammen, dass der Schwangerschaftsabbruch illegal ist. Das schränkt die Forschung ein, die Ausbildung, die Weiterbildung.“

Deutsche Mediziner*innen müssen auf englischsprachige Leitlinien gynäkologischer Fach­gesellschaften und der WHO zurückgreifen, die aber nicht alle vollständig übertragbar sind. Sogar in der gynäkologischen Weiterbildung hat der Schwangerschaftsabbruch nur wenig Platz. Der medikamentöse Schwangerschaftsabbruch etwa wird in allen 17 Weiterbildungsinhalten der Landesärztekammern nicht erwähnt. Wie die Vakuumaspiration, die Absaugmethode. „Die holländischen Ärzte bekommen deshalb regelmäßig die Krise“, sagt Svenja Addicks. Seit den 1980er Jahren geht aus englischsprachiger Literatur hervor, dass die Absaugmethode die für die Gebärmutter wesentlich schonendere Variante ist. „In Deutschland ist sie immer noch nicht der offizielle Standard.“ Stattdessen wird bei knapp 15 Prozent der Abbrüche noch immer ausgeschabt.

Quelle      TAZ      >>>>>          weiterlesen

—————————————————————————

Grafikquellen     :

Oben      —         Buildings at the Charite medical campus

—————————–

2.) von Oben     —        Berlin, Charité, Frauenklinik, Operation

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-M1008-0003 / CC-BY-SA 3.0

————————–
3.)    von Oben —     Marsch für das Leben 2012 in Berlin

————————————

Abgelegt unter Berlin, Bremen, Medien, Nordrhein-Westfalen | Keine Kommentare »

Hambi weiterhin gefährdet

Erstellt von DL-Redaktion am 28. Januar 2019

Kohlekommission fasst mutlose Beschlüsse – Hambacher Wald nach wie vor gefährdet

"Ende Gelände" 06-10-2018 27.jpg

Quelle      :        Scharf – Links

Von Hubertus Zdebel

Nachdem die Kohlekommission sich am frühen Samstagmorgen bei einer Gegenstimme auf den Abschlussbericht geeinigt hat, sieht der NRW-Bundestagsabgeordnete und Umweltpolitiker Hubertus Zdebel (DIE LINKE) noch immer große Unsicherheiten in Sachen Klimaschutz:

„Der Hambacher Wald ist noch längst nicht gerettet. Die Kohlekommission hält seinen Erhalt für lediglich ‚wünschenswert‘. Dass ich nicht lache. RWE hat prompt verlauten lassen, dass die restlose Abholzung nach wie vor das Ziel sei. Auch die angesichts des Ausstiegs absurden Umsiedlungen von weiteren Dörfern sind nicht vom Tisch. RWE-Chef Rolf Martin Schmitz spekuliert in einer ersten Reaktion bereits auf die Verlängerung beim Ausstiegsdatum. Eine konzernfreundliche Anpassung des Ausstiegsplans lässt der Abschlussbericht der Kommission ausdrücklich zu. Entschieden ist hier also noch gar nichts. Ich verstehe daher die Reaktionen der Grünen NRW nicht, die sich voreilig die Rettung des Hambacher Waldes auf die Fahnen schreiben wollen.

Der Strukturwandel wird eine große Herausforderung für das Rheinische Revier. Es ist eine richtige Entscheidung, dass er hier deutlich schneller beginnen soll als in der Lausitz, denn das Rheinische Revier birgt genügend alternative Potentiale für einen baldigen Kohleausstieg. Positiv ist, dass die Kommission sich eindeutig gegen betriebsbedingte Kündigungen ausspricht. Ob RWE und Co. dabei mitspielen, bleibt abzuwarten. DIE LINKE wird hier ganz genau hinschauen und weiter Druck für einen sozialverträglichen Ausstieg machen, für den die Konzerne die finanzielle Hauptverantwortung tragen.

Aus klimapolitischer Perspektive erscheinen die Beschlüsse der Kohlekommission mutlos. Der endgültige Ausstieg kommt mit dem Jahr 2038 viel zu spät und ist ja selbst dann noch nicht sicher. Das Klimaziel 2020 der Bundesregierung wird sicher verfehlt, da bis nächstes Jahr zu wenige Kraftwerksblöcke direkt abgeschaltet werden. Und überhaupt liest sich der Abschlussbericht stellenweise so, als wäre er in ‚copy & paste‘ von der Lobbyabteilung der Kohlekonzerne übernommen worden. Angeblich habe die Energiewirtschaft ihre Sektorziele schon ganz von alleine so gut wie erreicht. Zwischen den Zeilen des Wirtschaftskapitels klingt es fast so, als hätte es den Kohleausstieg eigentlich gar nicht gebraucht. Völlig ohne Not macht die Kommission einen tiefen Knix vor den Profitinteressen der Konzerne und verspricht üppige Ausgleichszahlungen, selbst für Anlagen, die älter als 25 Jahre sind. Die Empfehlungen der Kommission sind damit vor allem auch eine staatlicherseits gewährte Profitgarantie für die nächsten Jahrzehnte. Damit sich wirklich etwas ändert, ist weiterer Druck, insbesondere der Klimabewegung erforderlich.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————-

Grafikquelle     :   Aktion von „Ende Gelände“ zur Wiederbesetzung des Hambacher Forstes am Rande der „Wald retten – Kohle stoppen!“ Kundgebung.

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Überregional, Umwelt | Keine Kommentare »

Bericht über Glyphosat

Erstellt von DL-Redaktion am 26. Januar 2019

taz zwingt Bayer in die Knie

von Jost Maurin

Der Chemiekonzern wollte der taz eine Titelseite zum Pestizid Glyphosat verbieten. Die taz klagte dagegen – jetzt zieht Bayer zurück.

Titelseiten der taz sind bekannt für ihren Humor. Am 24. Oktober 2018 zum Beispiel druckte die Zeitung eine Persiflage auf Pharmaanzeigen. Vor einem grellen rosa Hintergrund prangte die Schlagzeile „Das Krebs-Rundumpaket“. Der Untertitel pries eine Recherche auf der Seite 3 an: „Der Bayer-Konzern vertreibt Glyphosat, ein Mittel, das wohl Krebs verursacht. Er verkauft aber auch eines, das Krebs heilen soll“.

Daneben schwebte auf einer Wolke eine Sprühflasche mit dem Glyphosat-haltigen Pestizid „Round­up“, flankiert von einem Sternsymbol mit der Aufschrift „Super: macht Krebs“. Auf dem anderen Ende der Wolke flog das Bayer-Medikament „Aliqopa“, das bei genau der Krebsart helfen soll, die Wissenschaftler auch mit Glyphosat in Verbindung bringen. Hier stand ebenfalls in einem Stern: „Super: heilt Krebs“.

Trotz des ganzen Rosa, des „Super: macht Krebs“ und der Wolke, die wolkige Werbeversprechen symbolisiert, schien einer den Witz nicht zu verstehen: Round­up-Hersteller Bayer. Der Chemiekonzern mit Sitz in Leverkusen beauftragte den Medienrechtsanwalt Gernot Lehr, die taz abzumahnen.

Das „Super: macht Krebs“ stellte er in einem Schreiben vom 31. Oktober an die Zeitung nicht als Satire dar, sondern als ernst gemeinte Tatsachenbehauptung, dass Round­up Krebs verursache. Die sei aber nicht einmal durch die von Pestizidgegnern häufig zitierte Krebsforschungsagentur der Weltgesundheitsorganisation belegt, die Glyphosat nur als „wahrscheinlich“ krebserregend eingestuft hat. Lehr zufolge reicht das „wohl“ im Untertitel nicht, um das „macht Krebs“ in dem Stern zu relativieren.

Deshalb verlangte der Bayer-Anwalt: Die Zeitung müsse sich verpflichten, unter anderem nicht mehr über Round­up zu behaupten: „Super: macht Krebs“. Das hätte bedeutet, dass die taz das Titelblatt nicht mehr verbreiten dürfte. Es hätte zum Beispiel aus dem Archiv gelöscht werden müssen. Bayer drohte der Zeitung mit einer Vertragsstrafe, falls sie diese Verpflichtung verletzt. Außerdem hätte die taz Anwaltskosten von Bayer in Höhe von einigen tausend Euro übernehmen müssen.

File:Bayer AG in Leverkusen, Luftaufnahme.JPG

Es passiert immer wieder, dass Konzerne, eine Partei wie die AfD oder Prominente versuchen, Journalisten mithilfe von Rechtsanwälten einzuschüchtern. Schon vor Veröffentlichungen drohen die Juristen etwa in sogenannten „presserechtlichen Informationsschreiben“ mit Klagen, falls die Redaktion angeblich rechtswidrige Aussagen über ihre Mandanten publiziert. Die Frankfurter Allgemeine Zeitung zum Beispiel bekam nach eigenen Angaben allein von einer Kanzlei zwischen Ende 2012 und Mitte 2016 mehrere Dutzend solcher Schreiben. Ist ein den Mandanten nicht genehmer Beitrag bereits erschienen, verschicken ihre Anwälte gern Abmahnungen, wie es nun Bayer tat. „Diese Einschüchtereien finden ständig statt“, sagt taz-Anwalt Johannes Eisenberg.

Das Tolle aus Sicht der Konzerne ist: Egal, ob sie in der Sache recht haben, die Briefe können kritische Journalisten behindern. Denn diese Anwaltsschreiben müssen nicht nur von den in der Regel zeitlich sehr eingespannten Berichterstattern analysiert werden, sondern auch von den Justiziaren und oft auch Chefredakteuren. Gerade kleine Redaktionen haben keine Juristen und sind oft geneigt, sofort nachzugeben, um aufwendigen und kostspieligen Ärger mit Big Business zu vermeiden. Deshalb berichten manche dann lieber überhaupt nicht über das Thema oder ziehen kritisierte Beiträge klaglos zurück.

Gegen das Abmahnungswesen

Quelle         :     TAZ           >>>>>        weiterlesen

——————————————————————

Grafikquellen     :

Oben       —         [1] Kniebeugen (Squat) ist eine der drei Teildisziplinen des Kraftdreikampfs

Unten       —         Das Bayer-Werk in Leverkusen.

attribution This file is licensed under the Creative Commons Attribution 3.0 Unported license.
Attribution: Rolf Heinrich, Köln

 

Abgelegt unter Gesundheitspolitik, Medien, Nordrhein-Westfalen, Umwelt | Keine Kommentare »

Irgendwer muss es ja tun

Erstellt von DL-Redaktion am 24. Januar 2019

Jugendliche protestieren für Klimaschutz

2017 COP 23 demo in Bonn. Spielvogel 7.jpg

Aber bitte nicht den Unterricht vernachlässigen, sonst sind eure Köpfe später gleich leer wie die der meisten Politiker und ihr müsst in deren Fußstapfen treten, um euren Lebensunterhalt zu verdienen.

von Sinan Recber

Am Freitag demonstrieren Tausende Schüler in Berlin für mehr Klimaschutz. Dort will die Kohlekommission ihre Empfehlungen vorstellen.

Warum heute zur Schule, wenn ich morgen keine Welt mehr habe?“ steht auf dem selbst gebastelten Schild der 11-jährigen Elise. An einem frostigen Freitagmorgen steht die Schülerin vor dem Bundestag und schwänzt den Unterricht, um für mehr Klimaschutz zu demonstrieren. Ihre beiden Klassenkameradinnen und Hunderte andere Schüler*innen sind dabei. „Ich finde, es ist eine Sauerei, dass die Erwachsenen unsere Welt zerstören“, beschwert sich Elise. Ihre Freundin Ida sagt: „Den Erwachsenen ist der Klimawandel einfach egal. Die denken: Wenn es richtig schlimm wird, bin ich eh schon tot, und solange ich lebe, kann ich noch rumsauen.“

Wie Elise und Ida gehen jeden Freitag weltweit Zehntausende Schü­ler*in­nen auf die Straße. Auch im Netz fordern sie – unter dem Hashtag #FridaysForFuture – die Politik zum Handeln auf. Seit Beginn der Proteste im Dezember nimmt die Bewegung für mehr Klimaschutz Fahrt auf: Waren es vor einem Monat noch 15 deutsche Städte, in denen junge Menschen auf die Straße gingen und die Schule oder die Uni sausen ließen, sind es jetzt schon mehr als 50 Orte. Am Freitag soll es eine große Demonstration in Berlin geben. „Dafür werden junge Leute aus ganz Deutschland anreisen“, sagt ­Luisa Neubauer.

Alles dank Greta Thunberg

Die 22-jährige Studentin organisiert die Klimastreiks in Berlin mit. Der Protest am Freitag soll der bislang größte werden. Schließlich will die Kohlekommission dann ihre Ergebnisse vorstellen. Die Kohlekommission soll einen Plan für das Ende der Kohleverstromung in Deutschland ausarbeiten. In ihr sitzen Vertreter*innen von Umweltverbänden, Wissenschaft, Industrie und Gewerkschaften.

Wie viele es am Ende werden, wissen die Veranstalter*innen nicht. Vergangenen Freitag waren es landesweit jedenfalls 25.000 Schüler*innen, twitterte der Account „Fridays For Future“. Unter anderem waren 1.000 Schüler*innen in München, 2.000 in Augsburg und 4.000 in Freiburg im Streik. Die meisten in Berlin wurden durch Freunde über den Messengerdienst WhatsApp mobilisiert oder über soziale Medien wie Instagram-Stories und Snapchat.

Ihren Anfang nahm die „Fridays For Future“-Bewegung, als die damals 15-jährige Klimaaktivistin Greta Thunberg im Sommer 2018 vor dem schwedischen Reichstag in Stockholm demonstrierte, statt die Schulbank zu drücken. „Skolstrejk för klimatet“, also „Schulstreik für das Klima“ hatte auf ihrem Schild gestanden. Derzeit ist die junge Schwedin auf dem Weg zum Weltwirtschaftsforum in Davos, wo sie eine Rede über die Folgen der globalen Erwärmung halten wird.

Junge Union hat für die Bewegung nur Spott über

Quelle       :      TAZ         >>>>>         weiterlesen

Soll für Demos der Unterricht ausfallen?

von Ralf Pauli
ja,

denn eigentlich müssten die KultusministerInnen dankbar sein. Vor wenigen Monaten beschlossen sie, die Demokratieerziehung an den Schulen zu stärken. Eine reichlich späte Einsicht. Schließlich hören Jugendliche in manchen Bundesländern erstmals in der zehnten Klasse von Wahlen, Pluralismus, Streikrecht. Noch schlimmer: An vielen Schulen des Landes sind menschenfeindliche Einstellungen heute so weit verbreitet, dass selbst CDU-regierte Länder Alarm schlagen. Logische Schlussfolgerung: Kinder sollen sich stärker und früher mit der Rolle der Zivilgesellschaft beschäftigen. Noch besser: Sie engagieren sich gleich selbst. So wünschen es sich die BildungsministerInnen. Wer beim Bund Naturschutz aktiv ist, bekommt künftig einen lobenden Vermerk im Zeugnis.

Wie passt es da zusammen, dass SchülerInnen, die seit Wochen für die Rettung unseres Planeten – und gegen die deutsche Kohlelobby – demons­trieren, mit Sanktionen von ihrer Schule rechnen müssen? Schon klar, weil sie den Unterricht schwänzen. Das aber müsste nicht sein, wenn die Schulen Klimademos nicht als Privatkram abstempeln, sondern als Chance für den Unterricht erkennen würden: Also als gesellschaftlich hochrelevantes Thema, das man endlich mal anhand eines hochaktuellen „Stoffes“ darstellen kann. Ob das Ganze dann im Ethik-, Sozialkunde- oder Erdkundeunterricht läuft, ist schnuppe. Wichtig ist doch: dass sich SchülerInnen mit dem Klimawandel, der Kohlekommission, den sozialen Folgen von deren Empfehlungen auseinandersetzen. Und – viel wichtiger: die Erfahrung, wie sie in unserer Demokratie Missstände ansprechen, mit Argumenten streiten – und bestenfalls mit ihrer Meinung Gehör finden.

———————————

von Klaus Hilllenbrand

Nein

die Schule muss nachgeholt werden. Es ist großartig, wenn Schülerinnen und Schüler für den Klimaschutz auf die Straße gehen und dafür den Unterricht schwänzen, so wie an diesem Freitag. Denn sie, die Jungen, werden einmal ausbaden müssen, was wir, die Älteren, versaut haben. Ein Grund, die Kinder deswegen vom Unterricht zu befreien, ist es allerdings nicht.

Wohlmeinende Lehrer bewerten die Schulstreiks als eine Praxisübung für das Mitwirken in einer Demokratie. Das Engagement gegen den Klimawandel sei quasi förderungswürdig – und deshalb gibt es unterrichtsfrei. Diese positive Einschätzung mag zwar inhaltlich völlig richtig sein. Sie verkennt aber, wie leicht man dabei in den Fußangeln der Demokratie ins Stolpern geraten kann. Denn zur Demokratie zählt zweifellos auch die Meinungsfreiheit. Und diese erlaubt eben auch Aktionen, die weniger Lob finden dürften.

Quelle     :      TAZ        >>>>>        weiterlesen

—————————————————————————–

Grafikquelle      :        demo in Bonn at the beginning of COP 23, November 4, 2017. Photo taken in Bonn at Genscherallee.

Abgelegt unter Medien, Nordrhein-Westfalen, Regierungs - Werte, Umwelt | Keine Kommentare »

Rundfunkzwangsgebühren

Erstellt von DL-Redaktion am 7. Januar 2019

versus Rechte, Linke und die Sammlungsbewegung

File:Aushang Plünderung.JPG

Quelle        :      Scharf – Links

Von Charlotte Ullmann

Jeder, der eine Wohnung sein eigen nennt, ob als Eigentümer oder Besitzer (Mieter), muss ab 2013 die Rundfunkabgabe abdrücken, egal, ob er ein Radio, einen Fernseher oder ein Handy besitzt. Und alle einen festen Betrag, nach dem Gießkannenprinzip gleichsam, ohne Rücksicht darauf, wieviel Einkommen er bezieht, ob 800.- Euro monatlich oder 5 Millionen.

Jeden Monat fast 20 Euro, im Jahr knappe 240 Euro, wovon der arme Schlucker statt nach Balkonien auch mal in die Vogesen reisen könnte.

Die Verfassungsrichter halten diese Zwangsabgabe für verfassungskonform, was in meinen Augen ein Faustschlag auf die demokratische Verfasstheit unseres Staates ist. Da ist ja unser Steuerrecht noch gerechter oder demokratischer, weil hier je nach Einkommen bemessen wird.

Sogar Menschen, die darauf angewiesen sind, Flaschen zu sammeln, weil sie sonst mit ihrer kargen Rente nicht zurechtkämen, müssen diese Abgabe leisten, so wie meine Nachbarin.

Nur Transferbezieher sind befreit, aber wer will schon diese entwürdigende Prozedur über sich ergehen la ssen, es sei denn, er wäre am Verhungern.

Aus reiner Neugier fragte ich nach beim Sozialamt: Wie kann man sich von den Rundfunkgebühren befreien lassen, wenn man sogar weniger Geld zur Verfügung hat als mit Grundsicherung?
Antwort: „Sie stellen einen Antrag auf Transfer!“

Wohlgemerkt, mit allen Schikanen: sich nackt ausziehen, sämtliche Kontoauszüge der letzten 3 Monate vorzeigen, ungeschwärzt!

„Und wenn Sie dann Hartz IV, Grundsicherung, Sozialhilfe oder Bafög bekommen, können Sie den Nachweis beim öffentlich-rechtlichen Rundfunk einreichen und werden von der Gebühr befreit! Wollen Sie die Transferleistung dann doch nicht haben, melden Sie sie wieder ab“.

Super! Und das alle halben Jahre?

Da hat man ja nichts anderes mehr zu tun, als sich mit diesem bürokratis chen Monstrum alle Augenblicke herumzuschlagen!

Vor allen Dingen wird man in ein staatliches Transfersystem gezwungen, erst ausgeraubt, dann der menschlichen Würde beraubt.

Das ist ein fein ausgeklügeltes System  unserer Staatsrepräsentanten, sich den Funk für „alle“, sprich Regierungsfunk, via Zwangsabgabe von allen bezahlen zu lassen, obwohl doch eigentlich alle der Staat sind und die Mehrheit gegen die Zwangsabgabe votiert.

Wenn die Sammlungsbewegung von Sahra Wagenknecht nun auch gegen die Rundfunkzwangsgebühren (Link unten) auf die Barrikaden geht, ist das nur zwangsläufig, will sie sich für soziale Gerechtigkeit einsetzen. Auch auf die Gefahr hin, mit der AfD in einen Topf geworfen zu werden.

Nur weil die AfD gegen die Zwangsabgabe ist, muss es nicht zwangsläufig heißen, dass die Linke dafür ist. Die Rechte kann auch mal in dem einen oder anderen Punkt recht haben.

Linke, die aus reinem Antirechtsreflex soziale  Ungerechtigkeiten für demokratisch erklären, sind in meinen Augen keine Linken mehr. Links bemisst sich nicht einzig darin, gegen Rechts zu sein, sondern darin, ob der Mensch in dieser Gesellschaft gemäß unserer Grundrechte und Verfassung gerecht behandelt wird, in Frieden leben kann und sein würdevolles Auskommen hat.

Öffentliche Medien, „Bürgermedien“, so wie es der Sammlungsbewegung vorschwebt, sollten am besten, wie ich meine, steuerfinanziert sein.

Das wäre die wirkliche Alternative zum jetzigen Verf ahren, das wie Wegelagerer auch diejenigen belastet, die sich möglichst selbstbestimmt und erhobenen Hauptes gerade noch über Wasser halten können und wollen.

Charlotte Ullmann, Frankfurt am 6.1.18

Link zum Artikel in der FAZ: https://tinyurl.com/ybu8a26u

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/

———————————————————————-

Grafikquelle       :       Aushang „Plünderer werden mit dem Tode bestraft – Bei der Schadenbekämpfung oder bei Aufräumungs- und Instandsetzungsarbeiten geborgene oder sonst aufgefundene Gegenstände sind binnen 24 Stunden an ihren Eigentümer oder an die nächste Polizei- oder Parteidienststelle oder in der Gemeindekanzlei abzuliefern“ (Bayern, Nachkriegszeit, Exponat bei der Sonderausstellung 60 Jahre Bayerische Polizei, Ingolstadt)

Author User:Mattes   /  Source  – Own work

I, the copyright holder of this work, release this work into the public domain. This applies worldwide.
In some countries this may not be legally possible; if so:
I grant anyone the right to use this work for any purpose, without any conditions, unless such conditions are required by law.

Abgelegt unter Kultur, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Kolumne Habibitus

Erstellt von DL-Redaktion am 4. Januar 2019

Herbert, was für persönliche Betroffenheit?

2018-11-30 Herbert Reul Innenministerkonferenz in Magdeburg-2308.jpg

Ich bin der schöne Herbert, ganz unten vom Parkett. Selbst aus der letzten Reihe pups ich rassistisch mit.

Von Hengameh Yaghoobifarah

Rassismus ist kein Racheakt. Wer den Anschlag von Bottrop mit persönlichen Problemen des Täters begründet, legitimiert Rassismus.

Ein 50-jähriger weißer Deutscher will an Silvester mal was anderes als nur Böller knallen lassen, pumpt noch mal ein paar rassistische Fantasien und steigt in seinen Benz. In Bottrop und Essen checkt er Menschen nach ihrem Aussehen aus und fährt gezielt jene an, die er als „Ausländer“ markiert. Acht Menschen verletzt er, einen davon schwer.

Was für manche nach dem perfekten Blockbuster für ihren reaktionären Onkel Detlef klingt, ist ein rassistischer Terroranschlag, der sich vor einigen Tagen tatsächlich so abgespielt hat. Obwohl sich der Täter Andreas N. selbst dazu bekennt, aus rassistischen Motiven heraus gehandelt zu haben, sprechen Journalist_innen in ihrer Berichterstattung von „Fremdenfeindlichkeit“ – als ob es genauso gut einen weißen US-Amerikaner oder eine weiße Dänin hätte treffen können.

2019 klingelt Sturm und man muss Journalist_innen immer noch erklären, dass nicht alle, die nicht wie sie aussehen, „fremd“ sind. Silvester in NRW, als wäre Karneval nicht schon belastend genug. Schafft Deutschland es diesmal, nicht in rassistische Debatten zu schlittern? Für Wünsche nach einem guten Rutsch ist es zu spät.

KAS-Reul, Herbert-Bild-6822-1.jpg

Nicht nur Nazis sind gewaltbereit

Während selbst die Behörden die Amokfahrt als Terroranschlag einstufen (und trotzdem nach pathologischen Ursachen suchen), hat für den NRW-Innenminister Herbert Reul nichts mit nichts zu tun. Da bisher nicht bekannt ist, ob der Täter in der Neonazi-Community ein- und ausging – als ob nur Nazis gewaltbereite Rassist_innen sein könnten ­–, betrachtet er die Tat nicht als politisch motiviert, sondern eher als „allgemein-kriminell“. Der Mann habe eher „aus einer persönlichen Betroffenheit und Unmut heraus dann Hass auf Fremde entwickelt“.

Quelle    :          TAZ         >>>>>          weiterlesen

———————————————————————-

Grafikquelle       :

Oben        —              Herbert Reul vor der Sitzung der 209. Innenministerkonferenz vom 28.-30. November in Magdeburg