DEMOKRATISCH – LINKS

                      KRITISCHE INTERNET-ZEITUNG

RENTENANGST

Archiv für die 'Mitteldeutschland' Kategorie

Kurswechsel in der SPD?

Erstellt von DL-Redaktion am 8. Dezember 2019

Die Mitte tickt ökosozial

Kolumne von Ulrich Schulte

Mehr Klimaschutz und mehr staatliche Investitionen, das ist nicht links, sondern einfach nur vernünftig. Die neue SPD-Spitze hat das verstanden.

Für manche sind die neuen SPD-Vorsitzenden Saskia Esken und Norbert Walter-Borjans so etwas wie der personifizierte Weltuntergang. Die SPD gebe sich auf, urteilt etwa die Frankfurter Allgemeine Sonntagszeitung, kurz FAS. „Für Deutschland ist das ein politisches Erdbeben.“

Ein Großteil der veröffentlichten Meinungen sieht es ähnlich. Gerade liberalkonservative JournalistInnen überbieten sich mit apokalyptischen Deutungen des angeblichen Linksschwenks der Sozialdemokratie. Das sind durchschaubare Versuche, die Neuen unmöglich zu machen.

Schauen wir auf die Inhalte, die das frisch gewählte Duo vertritt. Esken und Walter-Borjans fordern engagierteren Klimaschutz mit einem höheren CO2-Preis und mehr Kompensationen für Niedrigverdiener. Sie wollen den Mindestlohn auf 12 Euro anheben und ein milliardenschweres Investi­tionsprogramm des Staats auflegen, für Brücken, Bahnstrecken oder Bildung.

Ähnliches findet sich auch bei Grünen und Linken. Und die Parteien sind nicht allein. Viele Klimaforscher, Ökonomen und Verbände raten dasselbe. Ein solches Programm ist nicht naiv oder radikalutopistisch. Es ist einfach nur vernünftig – und auf Augenhöhe mit den Herausforderungen der Zeit.

Abschied von der Scholz-Heil-Linie

Der Bundesverband der Deutschen Industrie forderte kürzlich staatliche Investitionen von 450 Milliarden Euro in den nächsten zehn Jahren, Seit’ an Seit’ mit dem Deutschen Gewerkschaftsbund. Es würde die Infrastruktur, von der alle profitieren, aufwerten – und die rezessionsbedrohte Wirtschaft ankurbeln. Beide Organisationen, BDI und DGB, sind kommunistischer Umtriebe bisher unverdächtig.

File:Gerhard Schröder, der Basta-Kanzler.png

Hier habt ihr euren Bastard – Basta

Jene, die eine linkere SPD verhindern wollen und gleichzeitig für sich in Anspruch nehmen, für die bürgerliche Mitte zu sprechen, haben das Gefühl für die wahre Mitte der Gesellschaft verloren. Sie wenden Denkschablonen der 1990er Jahre auf das 21. Jahrhundert an, was kognitiv vielleicht nachvollziehbar ist, aber scheitern muss.

Gerhard Schröder und Tony Blair unterwarfen die Sozialdemokratie der Marktgläubigkeit, als sie 1999 ihr Konzept der „Neuen Mitte“ propagierten. Die darauf folgende Agendapolitik, dieser Verrat an ihrer Wählerschaft, verfolgt die SPD bis heute, trotz vieler, oft kleinteiliger Reparaturen in den Großen Koalitionen unter Merkel.

Quelle        :         TAZ       >>>>>         weiterlesen

—————————————————————–

Grafikquellen       :

Oben      —        Michel trying to make a revolution in 1848

Abgelegt unter Berlin, P.CDU / CSU, P.SPD, Regierung | Keine Kommentare »

Wo nicht die Banane,

Erstellt von DL-Redaktion am 6. Dezember 2019

 sondern die Republik matschig ist

2017-01-09-Rainer Wendt-hart aber fair-9613.jpg

Eine Kolumne von

In Sachsen-Anhalt wollte die CDU Rainer Wendt zum Staatssekretär machen und fragte wohl nicht nach seiner Kompetenz. In Frankfurt will sie dafür alles über die Frau des Oberbürgermeisters wissen.

Compliance!

Was ist eine Bananenrepublik? Die DDR war bekanntlich keine. Metaphorisch ist eine Bananenrepublik zu Hause, wo nicht die Banane, sondern die Republik matschig ist. Das klassische Modell sieht vor, dass ein ganz normales Unternehmen der Südfrüchte-Industrie in einem warmen Land eine ausreichende Zahl von Generälen und Staatssekretären mit Luxusvillen, Luxusautos und Luxusweibern ausstattet, damit die zum Fortbestand der Welt erforderlichen Geschäfte des Obst-, Kupfer- oder Gold-Exports ohne nennenswerte Störungen durch eingeborene Veganer abgewickelt werden können. Infolge der allgemeinen Modernisierung wirken die entsprechenden Filme aus den Fünfzigern und Sechzigern allerdings inzwischen etwas verstaubt.

Im deutschen Bundesland Sachsen-Anhalt wachsen bislang aus Klimagründen keine Bananen. Da sich das schnell ändern kann, muss die Polizei vorbereitet sein, bevor es losgeht mit dem bananenrepublikmäßigen Niedergang. Genau hier setzte der mutige Plan an, Deutschlands härtesten Polizeihauptkommissar a.D., Rainer Wendt, zum für die Polizei des ganzen Bundeslandes zuständigen Innenstaatssekretär zu machen. Das wäre für den etwas überstürzt pensionierten Beamten der durch Nicht-Dienst errungenen Besoldungsgruppe A 12 (entsprechend: Amtsrat in der Verwaltung), der auf eine Verwaltungserfahrung als Dienstgruppenleiter im Schichtdienst bei der Schutzpolizei zurückblicken kann, eine schöne Herausforderung in der zwölf Stufen höheren Besoldungsgruppe B 9 gewesen.

Es stellt sich hier nicht die Frage, ob man das Herrn Wendt persönlich gönnen mochte: Auch im Lotto muss ja schließlich irgendwer gewinnen, und wenn man eigentlich jeden nehmen kann, kann’s ja auch ein pensionierter Schutzmann aus der Versicherungsbranche sein. Mit etwas Verantwortungsbewusstsein könnte einem zwar die Frage kommen, ob einem ganzen Bundesland ein oberster Verwaltungsbeamter zu gönnen ist, dessen Verwaltungskompetenz sich auf eine Dienstgruppenleitung bei der Duisburger Schutzpolizei beschränkt. Diese Frage wurde aber ausdrücklich selbst dann nicht diskutiert, als die „große Freude“ in der Staatskanzlei verebbt war. Man wandte sich vielmehr der Frage zu, ob PHK Wendt als Innenstaatssekretär eher eine Lachnummer oder ein Appetithäppchen für die AfD hätte sein sollen. Und ob sich ein großmächtiger Innenminister in seine durchdachte Personalpolitik hereinreden lassen mögen darf.

Dienst-Bananen!

Szenenwechsel: Auf der Suche nach dem Bananenunwesen in der Metropole Frankfurt am Main hat der Kolumnist einer dortigen Zeitung am 30.11. den ortsansässigen „Marxismus-Feminismus“ in den Fokus genommen, womit er selbstverständlich nicht die hessische CDU meinte, sondern die Brutstätte des Nepotismus im proletarisch-türkischen Sumpf, wie er seit jeher im Schatten des blitzsauberen Bankenviertels gedeiht. Während sich die Rest-SPD hinter ihren neuen Speerspitzen versammelt, behauptet nämlich ein ihr angehörender 61-jähriger Wahlbeamter der Besoldungsstufe B 11, er wisse nicht, wieviel seine 32-jährige Ehefrau als Kita-Leiterin bei der Arbeiter(!)-Wohlfahrt verdient: Es handelt sich, wie „FAZ“, „Welt“ und „Bild“ erfahren haben, um die unerhörte Summe von monatlich etwa 4200 Euro brutto (in Lohnsteuerklasse V kommen ca. 2200 Euro netto heraus). Solche Ahnungslosigkeit kann nur glauben, wer es auch nicht verdächtig findet, dass der Altersunterschied bei Bürgermeisters größer als bei Macrons ist, der Vorname der Frau türkisch und die von ihr geleitete Kita „deutsch-türkisch“, wie wir lesen durften. Und so blöd ist man weder bei diesen Zeitungen noch in der Frankfurter CDU.

Die Sozialdezernentin (CDU) der Stadt Frankfurt hat angesichts des Abgrunds gleich mal die „Zuschüsse eingefroren“ (die an die AWO), und im Halbtagesrhythmus lesen wir, dass sich „die Affäre ausweitet“ („FAZ“). Es fehlt nicht mehr viel, und „Bild“, „Welt“, „FAZ“ und HR rufen gemeinsam die Schlecker-Frauen oder die Bewohner des Ostends gegen den Feldmannschen Dienstwagen (Ford Focus!) in den Straßenkampf: Hongkong ist überall! Der Baudezernent (CDU) macht sich Sorgen um das Klima, weil der Dienst-Ford, wie er herausgefunden hat, CO2 ausstößt. Und die „FAZ“ fragt zum ersten Advent basisdemokratisch ihre Leser: „Wie soll es weiter gehen mit Peter Feldmann?“.

Wie die „Bunte“ zu der Sache steht, ist noch offen, da Frau Feldmann vor noch nicht langer Zeit dort als „wunderschöne Braut“ lief, was vermutlich die alten Säcke bei der „FAZ“ und der CDU echt neidisch gemacht hat. Wir würden natürlich gern wissen, wie sich das Gehalts- und Dienstwagengefüge bei ihren eigenen Bräuten darstellt, aber das ist super geheim und nur den Eliteforschern von der AfD bekannt.

Ja, es geht bergab in der Bananenrepublik! Der Herr Professor Meuthen und die Frau Doktor Weidel haben es schon immer gesagt, und die verstehen etwas davon. An dem ganzen Desaster ist aber die CDU Sachsen-Anhalt völlig unschuldig. Schuld sind ist erstens und im Allgemeinen das Kanzleramt, zweitens und im Besonderen der Duzfreund des Innenministers, Terminator Wendt, der bei seinem Anstellungsgespräch glatt vergessen hat zu erwähnen, dass eine Disziplinarmaßnahme gegen ihn verhängt wurde, weswegen er leider gar nicht eingestellt werden dürfte. So etwas Geheimes konnte natürlich ein Innenminister weder wissen noch ahnen!

Wäre Herr Wendt ein Volkspolizei-Kommissar in der DDR gewesen und hätte er sich im Jahr 1990 ähnlich schusselig um eine Anstellung als Staatssekretär (die Hoffnung stirbt zuletzt) oder Schichtleiter bei der Schutzpolizei Wernigerode beworben, hätte man ihn vermutlich wegen versuchten Anstellungsbetrugs verfolgt oder wegen Geschäftsunfähigkeit unter Betreuung gestellt. Aber das ist lange her. Die Mauer ist verschwunden und mit ihr die Arbeiterklasse, die jetzt „die Menschen“ heißt. Die Linke hat zwar gegen den Versicherungs-Fachmann Strafanzeige erstattet, aber wir ahnen, dass der Kommissar a.D. sich im berufstypisch unvermeidlichen Verbotsirrtum befunden haben könnte.

Wiederaufnahme!

Apropos DDR: Geschichte wiederholt sich nicht. Deshalb ist es auch ziemlich egal, ob man Herrn Höcke „Faschist“ nennen darf, was jetzt manche Antifaschisten gerne tun, vor allem im Fernsehen, in der kindlichen Hoffnung, dann würden „die Menschen“ sagen: Ja wenn das so ist!, und wieder SPD wählen oder wenigstens AKK. Dabei übersehen sie, dass Herr Höcke nicht gewählt wird, obwohl er Faschist ist, sondern weil er es ist. Und dass Herr Höcke sich nicht wie Rumpelstilzchen in der Luft zerreißt, wenn man seinen geheimen Namen herausgefunden hat. Die heutige Jugend jeden Alters glaubt leider an Zauberwörter und denkt, „Faschismus“ sei, wenn man Juden hasst, albern spricht und Antifaschisten zusammenschlägt. Das täuscht.

Quelle     :          Spiegel-online            >>>>>             weiterlesen

———————————————————–

Grafikquellen         :

Oben         —          Rainer Wendt in der WDR-Sendung „hart aber fair“ am 9. Januar 2017

Autor    —     „© Superbass / CC-BY-SA-4.0 (via Wikimedia Commons)“

File:2017-01-09-Rainer Wendt-hart aber fair-9613.jpg

———————————–

Unten           —        Systemkritische Protestfahne „BananenRepublik Deutschland“

Abgelegt unter Hessen, Justiz-Kommentare, Sachsen-Anhalt, Überregional | Keine Kommentare »

Linke lässt Mandat prüfen

Erstellt von DL-Redaktion am 6. Dezember 2019

Linke-laesst-Doppelmandat-von-Ex-CDU-Landeschefin-pruefen

Gruppenbild der Kandidat*innen Landesliste für die Landtagswahl 2019

Von dpa

Die Brandenburger Linke hat das von Ex-CDU-Landeschefin Saskia Ludwig beabsichtigte Doppelmandat in Bundestag und Landtag prüfen lassen. Der Parlamentarische Beratungsdienst (PBD) sei in seinem Gutachten zu dem Ergebnis gekommen, dass die Funktionsfähigkeit des Landtages durch die beiden Mandate beeinträchtigt sein könne, da nach Bundesrecht die Ausübung des Mandates im Mittelpunkt der Tätigkeit des Bundestagsmitgliedes stehe, zitierten die Linken am Dienstag aus dem Gutachten. Halte sich das Mitglied daran, könne das Landtagsmandat nur noch „am Rande“ ausgeübt werden, hieß es weiter.

Ludwig will für Brandenburgs Innenminister Michael Stübgen (CDU) als Abgeordnete in den Bundestag nachrücken. Stübgen hatte sein Mandat wegen seines Ministerpostens niedergelegt. Ludwig kündigte an, vorerst parallel auch Landtagsabgeordnete bleiben zu wollen.

Portrait saskia ludwig.jpg

„Wir halten dieses Doppelmandat und auch das, was Frau Ludwig hier verkündet hat, für einen handfesten Skandal“, sagte Linken-Fraktionschef Sebastian Walter. Die Linken wollen kommende Woche einen Änderungsantrag einbringen, der Doppelmandate in Zukunft ausschließt.

Quelle         :      Berliner – Morgenpost          >>>>>       weiterlesen

————————————————————————-

Grafikquellen        :

Oben       —         Die Linke LV Brandenburg

—————————-

Unten       —           Offizielles Portraitfoto der Politikerin Saskia Ludwig.

Abgelegt unter Brandenburg, P. DIE LINKE, P.CDU / CSU, Überregional | Keine Kommentare »

Richternd

Erstellt von DL-Redaktion am 3. Dezember 2019

Schöffe am Amtsgericht in Euskirchen

File:1031616 Amtsgericht Euskirchen.jpg

Quelle       :         untergrund-blättle     CH.

Von   Richard Albrecht

Im letzten Jahrzehnt war ich vor einigen Jahren einige Jahre lang ehrenamtlicher Richter. Genauer: (Hilfs-) Schöffe an einem Amtsgericht in der Rheineifel.

Euskirchen, historisch Oiskirchn, ist das Tor der Eifel. Aber nicht alle Euskirchner sind Eifler Toren. Es hat auch dort einige Autoren.

Das dortige Amtsgericht ist baulich neu und liegt zentral für alle, die mit dem Zug oder dem Auto anreisen. In den Kleinen Saal wurde in Handschellen reingebracht ein Angeklagter, den ich gut ein Jahrzehnt vor der Verhandlung einmal beobachtete wie er am Bach Frösche fing und mit dem ich über die Jahre auch zwei, drei Sätze irgendwas sprach.

Was er getan haben sollte Jahre bevor er als Angeklagter befragt wurde fiel unters Jugendstrafrecht.

Merkwürdig war, dass Monate vergingen bevor er nach erster polizeilicher Auffälligkeit vor seinen ersten Richter kam. Ich fragte nach. Der Berufsrichter am Amtsgericht war lange Jahre lang Direktor des nahegelegenen Hauses, in dem ich später 15 Tage als Busse für die angebliche „Beleidigung“ eines Rechtsadvokaten abbüssen sollte. Er liess als Vorsitzender pausieren und erklärte im Beratungsraum wortreich, warum´s so war damit das wirken konnte, was Pädagogik genannt wird.

Ob der – nun – junge Mann, den ich – wieder´n paar Jahre später – noch einmal zwischen Regalen in einem Supermarkt sah und den ich an seinen so hellen wie wachen Augen wiedererkannte, nun schlussendlich wegen seines ersten Altdelikts verurteilt wurde oder auch nicht, kann ich nicht wissen.

Die Verhandlung, an der ich laienrichterlich teilnahm, musste aus formalen Gründen vertagt werden.

Die letzte Gerichtsverhandlung, an der ich, ehrenamtlich überhöht sitzend, teilnahm, war geheim: „aus Gründen“ des Jugendschutzes wurde was „die Öffentlichkeit“ heisst ausgeschlossen.

Der alte Mann war das erste Mal in seinem Leben öffentlich angeklagt. Er fühlte sich unschuldig und schämte sich nicht. Sondern hatte Angst vor seiner Frau. Denn er sollte, so staatsanwaltschaftliche Ermittlungen, von hinten eine Minderjährige begrapscht haben.

Diese erschien gross und prall. Die Gutachterin wissend und eifernd.

Der Mann war nicht nur ein alter, sondern auch ein kleiner Mann. Würde er wie allseits beredt behauptet die Titten nicht nur von hinten, sondern auch von oben begrabscht haben, hätte er auf einer kleinen Leiter oder auf einigen Telefonbüchern der Kreise Bergheim-Düren-Euskirchen stehen müssen.

Als ich dies, ehrenamtlich-richternd und gutachterlich-kritisch, anmerkte – herrschte sekundenlang so kundiges wie beredtes Schweigen.

Was den Vorsitzenden trotz Advokatenprotest nicht hinderte, wie Basta durchzuziehen. Und den kleinen alten Mann, der seine Unschuld beteuerte und den die Angst vor seiner Frau schwitzen machte, zu einer milden Geldstrafe zu verurteilen.

Die Verhandlung wurde weder zur Beratung unterbrochen noch später ausgesetzt.

Diesen Berufsrichter sah ich erst Monate später in anderem Zusammenhang im selben Amtsgericht während meines eigenen, von ihm beförderten, Prozesses wegen angeblicher „Beleidigung“ eines Bonner Rechtsadvokaten ebendort wieder – in der Gerichtskantine, nachdem der gegen mich als Angeklagten veranlasste Prozess wegen Besorgnis berufsrichterlicher Befangenheit vertagt wurde.

Seitdem ward er von mir nimmer gesehen.

Und das war und das ist auch nur gut so.

Diese Kurzerzählung erschien zuerst im Sammelband des Autors HELDENTOD. Kurze Texte aus Langen Jahren (Aachen: Shaker Media, 2011).

—————————————————————-

Grafikquelle          :         Amtsgericht Euskirchen, Sept. 2007

Author Wikoli       —        Source  :  Own work

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Justiz-Kommentare, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 3. Dezember 2019

Die Welt als Wunder

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ariane Lemme

Dialektik der Aufklärung 2.0. Die Woche hat mal wieder gezeit, wie eng Diskurse geführt werden. Eine gute Party funktioniert anders.

Ein bisschen befremdlich finde ich es ja immer, wenn Erwachsene andere Erwachsene (meist auf Buchrücken oder in schlecht geschriebenen Rezensionen) dafür loben, „noch staunen zu können wie ein Kind“. Der Welt nicht gleichgültig, sondern mit Liebe und Aufmerksamkeit begegnen kann man auch, ohne dass man fallenden Blättern hinterhertaumelt und bei jeder Äußerung, die nicht dem eigenen Weltbild entspricht, die Kinnlade fallen lässt. Diese Woche aber war die Welt mal wieder derart Freakshow, dass ich, trotz déformation professionelle, sprich: zum Zynismus erzogen, aus dem Staunen nicht herausgekommen bin.

Dabei fing alles ganz harmlos an. Ich war nach Hannover gefahren, um mal etwas Schönes zu machen. Ein Baby angucken. Über Babys, das gebe ich zu, konnte ich schon immer staunen, so viel Persönlichkeit auf so wenig Kubikzentimetern zusammengefaltet.

Dann aber ging’s los: Massen an Polizisten, die meisten zu Pferd, als wollten sie Game of Thrones reenacten. Tatsächlich aber wollten sie 120 NPD­lern (Sie erinnern sich – diese Partei, die zu irrelevant war, um sie zu verbieten) ihr Recht auf Demonstrationsfreiheit sichern. Na gut, dachte ich, der Rechtsstaat funktioniert, wer nicht verboten ist, darf eben demonstrieren. Auch wenn er, anerkanntermaßen, verfassungsfeindlich ist. Bitte sehr.

Über genau diesen funktionierenden Rechtsstaat hab ich mich dann aber, kaum zurück in Berlin, doch sehr gewundert. Nämlich als er dem Verein VVN-BdA, kurz für Vereinigung der Verfolgten des Naziregimes – Bund der Antifaschistinnen und Antifaschisten, die Gemeinnützigkeit aberkannte.

Grund: Der Landesverband in Bayern sei im bayerischen Verfassungsschutzbericht wiederholt als „linksextremistisch beeinflusst“ bewertet worden. Eigentlich ist zu dem Thema alles gesagt, namentlich hier in dieser Zeitung von ­Jagoda Marinić.

Sprachlos bin ich trotzdem noch angesichts der kognitiven Dissonanz, die bei denen grassieren muss, die nach dem antisemitischen Anschlag in Halle gerade erst allerlei Dinge im Kampf gegen den Antisemitismus gefordert haben. Mehr Gesetze, mehr Zivilgesellschaft, mehr Blabla. Ganz nach dem Motto: Wie soll ich wissen, was ich denke, bevor ich höre, was ich sage?

Quelle         :          TAZ         >>>>>       weiterlesen

———————————————————————

Grafikquellen       :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Berlin, Kultur, Positionen, Überregional | Keine Kommentare »

Vom Erfolg überrumpelt

Erstellt von DL-Redaktion am 2. Dezember 2019

Zerknitterte Verlierer, überraschte Sieger:

2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg

Aus Berlin von Stefan Reinecke

Mit der neuen SPD-Spitze bahnt sich ein Machtkampf um den Verbleib in der Großen Koalition an.

m Samstagabend um 18.08 Uhr ist klar, dass Olaf Scholz und Klara Geywitz nicht neue SPD-Chefs werden. Lars Klingbeil, für unverwüstlichen Frohsinn bekannt, schaut ziemlich betreten drein. Er hatte den langwierigen Wahlprozess gemanagt – jetzt wackelt der Job des Seeheimers als Generalsekretär. Die SPD hat zum ersten Mal seit sehr langer Zeit eine linke Parteiführung. Bei der versammelten Hauptstadtpresse im Willy-Brandt-Haus herrscht ratloses Erstaunen. Auf allzu viele Sympathien werden Saskia Esken und Norbert Walter-Borjans bei den Leitmedien eher nicht rechnen können.

Fast die gesamte Parteispitze, Ministerpräsidenten wie Stephan Weil, die BundesministerInnen, die überwältigende Mehrheit der Bundestagsfraktion hatten Scholz und Geywitz unterstützt. Das Basisvotum sollte Scholz mit besonderer Legitimität ausstatten. Das war der Plan der SPD-Spitze.

Geywitz versichert tapfer, dass sie die Sieger unterstützen wird, und verlässt danach schnell das Willy-Brandt-Haus. Olaf Scholz trägt einen schwarzen Anzug und sagt, er wünsche der neuen Führung alles Gute. Es ist für den Vizekanzler, der Kanzlerkandidat der SPD werden wollte, eine herbe Niederlage. 53 Prozent zu 45 – es ist nicht einmal der befürchtete ganz knappe Ausgang geworden.

Es gibt bei dieser Wahl viel Einmaliges. Die Basis stimmt gegen die SPD-Führung. Die neuen Chefs kommen nicht aus der Parteielite. Sie waren nicht zuvor im Vorstand – und sind auch sonst untypisch für SPD-Spitzenfunktionäre. Norbert Walter-Borjans war nie Parlamentarier und hatte nie ein Parteiamt inne. Saskia Esken, erst seit ein paar Jahrenim Bundestag, spielte dort keine herausragende Rolle. Die SPD-Führung rekrutiert sich aus Juristen und Politikwissenschaftlern. Die Parteilinke Esken hat ein Studium abgebrochen, als Kellnerin, Schreibkraft und Fahrerin gejobbt, drei Kinder großgezogen, ehe sie sich als Informatikerin weiterbildete und spät in die Politik ging. Recht ungewöhnlich für eine SPD-Chefin.

Zerknitterte Verlierer, überraschte Sieger. Es ist ein Abend inniger Wünsche und beklommener Hoffnungen. Als Walter-Borjans und Esken auf dem Podium die unerwartete Siegerpose geübt und Daumen in die Höhe gereckt haben, geben sie eineinhalb Stunden lang Interviews. „Wir reichen allen, die nicht für uns gestimmt haben, beide Hände“, sagt SaskiaEsken. Die neue Führung sendet Friedensbotschaften. Nein, man werde nicht automatisch die Große Koalition beenden. Ja, Olaf Scholz werde Finanzminister bleiben. Und ja, man wisse, dass 45 Prozent nicht für sie gestimmt haben.

Aber was genau jetzt passieren wird, liegt im Nebel. Am Freitag beginnt der Parteitag in Berlin. Endet die Große Koalition? Oder geht es nur darum: Wann? Die neue SPD-Führung will mit der Union nachverhandeln. Sie hat vorab einen Katalog vorgelegt, der nach Wunschtraum klingt: 12 Euro Mindestlohn sofort, ein großes Investitionsprogramm und das Ende der schwarzen Null, ein neues Klimapaket. Alles richtig, aber mit der Union nicht ­machbar.

Manchmal klingt Esken und noch mehr Walter-Borjans auch elastischer. Man wisse ja, dass man mit der Union nicht das SPD-Programm durchsetzen werde, so Esken. Das seien erst mal die Forderungen, sagt Walter-Borjans. Dies war ein immer wieder wiederholtes Argument der beiden im internen SPD-Wahlkampf: Die SPD nehme den Kompromiss immer schon vorweg, statt allen klarzumachen, was sie fundamental von der Union unterscheidet. Angesichts der nahenden Rezession müsse sich doch auch die Union bewegen, hofft Walter-Borjans.

Muss sie? CDU-Chefin Annegret Kramp-Karrenbauer und andere Unionspolitiker haben Verhandlungen bereits ausgeschlossen. Das war vielleicht etwas vorschnell. Gesprächsblockaden wirken wenig souverän.

2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2562.jpg

Vom SPD-Parteitag erwartet Walter-Borjans eine „heftige Debatte um die schwarze Null“. In den paar Tagen bis Nikolaus wird es mit der Union keine Verhandlungen geben. Der Parteitag wird einen Forderungskatalog für Verhandlungen beschließen. Wie hart oder weich der ausfällt, wird der entscheidende Streitpunkt. Der Leitantrag wird auch die Blaupause sein, die anzeigt, wie das neue Machtgefüge aussieht (siehe Interview mit Karl Lauterbach).

Die SPD-Bundestagsfraktion hat angesichts von Umfragewerten bei 13 Prozent wenig Lust auf Neuwahlen. Bricht also jetzt ein Krieg zwischen Parteispitze und Fraktion aus? Walter-Borjans äußert sich da sibyllinisch: „Zwischen Partei und Fraktion ist ein Spannungsfeld nötig und richtig. Die Fraktion muss wissen, wo ihre Loyalitäten liegen“. Wenn die Partei aber den Ausstieg aus der Groko beschließe, müsse die Fraktion folgen.

Quelle          :       TAZ        >>>>>           weiterlesen

Große Koalition und Neuwahlen

Zwischen Partei und Regierung

Maischberger - 2019-03-06-6426.jpg

Kommentar von Ulrike Herrmann

Gerade die SPD ist jetzt besser aufgestellt, um noch zwei weitere Jahre in der Groko zu überleben. Mit einer Arbeitsteilung, von der alle profitieren.

Totgesagte leben länger: Dieses banale Sprichwort passt bestens, um die Zukunft der Großen Koalition zu beschreiben. Auf den ersten Blick scheint die Diagnose klar, die ein Arzt für parteipolitische Krankheiten stellen muss: Die Groko hat keine Chance mehr. Die künftigen SPD-Spitzen Walter-Borjans und Esken wollen neu über die Koalition verhandeln, während die Union genau dies ablehnt.

Trotzdem wäre es verfrüht, mit Neuwahlen zu rechnen. So angeschlagen der Patient Groko wirkt: Für Union und SPD wäre es unerfreulich, wenn es zu einem Urnengang käme. Denn beiden Parteien fehlt eine geeignete KanzlerkandidatIn.

Die Karriere von Olaf Scholz hat sich an diesem Samstag erledigt. Nach seiner SPD-internen Niederlage kann er zwar Finanzminister bleiben, aber mehr ist nicht mehr drin. CDU-Chefin Kramp-Karrenbauer wiederum ist bei den WählerInnen so unbeliebt, dass parteiintern längst nach Alternativen gesucht wird.

Noch schlimmer: Beide Regierungsparteien sind in Flügel zerfallen. Bei der SPD verläuft die Front horizontal zwischen Fraktion und Basis, wenn es um die Frage geht, wie „links“ die Partei sein soll. Bei der Union hingegen geht die Spaltung vertikal durch die Partei. Auf jeder Ebene wird um den richtigen Kurs gekämpft, und dieser Dauerstreit beginnt schon ganz oben – mit Schäuble gegen Merkel. Was „konservativ“ sein soll, ist strategisch schwer zu definieren. Rückt man zu sehr nach rechts, könnten viele Unionswähler zu den Grünen überlaufen. Ist man zu mittig, könnte die Union an die AfD verlieren.

Gerade die SPD ist jetzt besser aufgestellt

SPD und Union benötigen Zeit, um ihre Flügelstreitigkeiten auszutragen, an ihren Programmen zu feilen und KanzlerkandidatInnen zu finden. Da wäre es höchst unüberlegt, die Groko enden zu lassen. So paradox es wirken mag: Gerade die SPD ist jetzt besser aufgestellt, um noch zwei weitere Jahre in der Groko zu überleben. Denn es könnte zu einer Arbeitsteilung kommen, von der alle profitieren. Das neue Spitzenduo sorgt fürs linke Programm – während die SPD-Minister pragmatisch regieren.

Quelle        :           TAZ        >>>>>        weiterlesen

——————————————————————–

Grafikquellen         :

Oben       —         Team Saskia Esken und Norbert Walter-Borjans bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg
  • Erstellt: 2019-09-10 18:00:40

——————————-

2.) von Oben     —         Team Klara Geywitz und Olaf Scholz bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2565.jpg
  • Erstellt: 2019-09-10 18:54:20

————————————

Unten         —        MAISCHBERGER am 6. März 2019 in Köln. Produziert vom WDR. Thema der Sendung: „Attacke auf die Reichen: Beschimpfen, besteuern, enteignen?“ Foto: Ulrike Herrmann, Journalistin

Abgelegt unter Berlin, P.SPD, Regierung, Sozialpolitik | Keine Kommentare »

NRW / Sagel verläßt Linke

Erstellt von DL-Redaktion am 2. Dezember 2019

NRW – Leitlinien und ein Austritt in Bielefeld

Rüdiger Sagel.jpg

Von Sebastian Weiermann, Bielefeld

Der Landesparteitag der LINKEN in Nordrhein-Westfalen hat die Kommunalwahl 2020 vorbereitet.

Für die Linkspartei in Nordrhein-Westfalen ist es nicht leicht, auf sich aufmerksam zu machen. Zwar kommen zu ihrem Parteitag am Wochenende in Bielefeld prominente Bundestagsabgeordnete aus dem Bundesland und mit Özlem Alev Demirel sitzt nun eine fest in der nordrhein-westfälischen LINKEN verankerte Politikerin im Bundestag, aber der Partei fehlt die Präsenz im Landtag.

Ein bisschen Glanz brachte der Parteivorsitzende Bernd Riexinger in den Parteitag. In seiner Rede sprach er sich gegen die AfD und für Solidarität mit der antifaschistischen Organisation VVN-BdA aus. Das neue Vorsitzendenduo der SPD aus Esken und Walter-Borjans kommentierte Riexinger wohlwollend. Es sei zwar fraglich, ob es wirklich eine Erneuerung der SPD gäbe, aber die abstimmenden Mitglieder hätten sich für eine »sozialdemokratischere« Partei ausgesprochen. Das sei kein Grund, von Zusammenschlüssen zu träumen. Die LINKE habe ihren Platz links von der SPD. Sie kämpfe für »demokratischen Sozialismus«. Über Saskia Esken wusste Riexinger noch zu berichten, dass er sie im Jugendzentrum »zum Teil mit politisiert« habe. Das habe offensichtlich nur für die SPD gereicht – aber »immerhin linker Flügel«, wie er anmerkte.

Zentrales Thema des Parteitags war allerdings nicht die SPD, sondern die Vorbereitung auf die Kommunalwahlen, die im September 2020 stattfinden. Dass die Themen dafür in den Städten gesetzt werden, war den Delegierten klar. Aber man wollte mit den »Kommunalpolitischen Leitlinien« einen »Steinbruch« entwickeln, aus dem die Kreisverbände sich bedienen können, wie Landessprecher Christian Leye erklärte. Es sei wichtig, sich auf Landesebene über gewisse Positionen verständige. Man sende damit ein »Signal«, wo man stehe. Die Leitlinien, die er Parteitag beschlossen hat, umfassen mehr als 100 Seiten und bilden das ganze Spektrum der Politik ab. Darin geht es sowohl um größere Fragen, wie der Positionierung der LINKEN gegen Hartz-IV-Sanktionen, als auch um Details, etwa ob man für oder gegen Kunstrasenplätze sei. Diskutiert wurde, ob in den Leitlinien von »Arbeitslosigkeit« oder »Erwerbslosigkeit« die Rede sein solle. Für den ersten Begriff spreche dessen Allgemeingültigkeit, für den zweiten, dass Lohnarbeit damit nicht überhöht würde, worauf die Delegierten sich dann einigten.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Laut und leidenschaftlich wurde es nur selten. Etwa bei der Frage danach, ob der Energiekonzern RWE »verstaatlicht« oder »zerschlagen« werden sollte oder beim Thema Prostitution, bei dem es eine Bandbreite an Positionen gibt, die von einer Liberalisierung bis zum Sexkaufverbot reicht. Man einigte sich auf Grundsätzliches wie Beratungsangebote und die Stärkung von Hilfsmöglichkeiten für die Menschen in der Branche.

Quelle          :          ND         >>>>>           weiterlesen

—————————————————————–

Grafikquellen       :

Oben       —         Rüdiger Sagel

—————————-

Unten        —       Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Thüringen als Menetekel:

Erstellt von DL-Redaktion am 2. Dezember 2019

Wie man aus Rechtsradikalen Bürgerliche macht

2019-10-27 Wahlabend Thüringen by Sandro Halank–81.jpg

von Albrecht von Lucke

Am Anfang war Thüringen: Vor bald 90 Jahren, am 23. Januar 1930, konnten die Nationalsozialisten dort ihre erste Beteiligung an einer deutschen Landesregierung feiern. Und zwar mit einem Staatsminister für Inneres und Volksbildung namens Wilhelm Frick, der nur drei Jahre später zum Reichsminister des Innern im Kabinett des frisch gekürten Reichkanzlers Adolf Hitler ernannt wurde. Dahinter steckte bekanntlich das Kalkül des (neben Hindenburg zweiten) Kanzlermachers, Franz von Papen, dem die wohl fatalste Fehleinschätzung der deutschen Geschichte zugeschrieben wird: „In zwei Monaten haben wir Hitler in die Ecke gedrückt, dass er quietscht!“[1]

Ausgerechnet in Thüringen kann man dieser Tage erleben, wie es wieder einmal „quietscht“ – und eine in erheblichen Teilen rechtsradikale Partei durch eine bürgerliche Partei hoffähig gemacht wird. Ausgangspunkt dafür war das Patt bei den jüngsten Landtagswahlen, das weder die Fortsetzung des rot-rot-grünen Bündnisses unter Bodo Ramelow ermöglichte, noch einen Machtwechsel zugunsten seines Herausforderers, des CDU-Spitzenkandidaten Mike Mohring. Im Gegenteil: Da die CDU von 33,5 Prozent auf nur noch 21,7 Prozent der Stimmen regelrecht abstürzte, erwog Mohring – auch um sich durch eine Regierungsbeteiligung vor den innerparteilichen Attacken zu retten – Gespräche mit dem Wahlsieger Ramelow. Was folgte, war ein Aufschrei in fast der gesamten Union: Mit der „Partei der Mauerschützen“ könne man nicht reden oder gar Koalitionen bilden.

Noch bezeichnender war allerdings etwas anderes: Kaum hatte Mohring diese Überlegung angestellt, befand der stellvertretende Thüringer CDU-Fraktionschef Michael Heym, es gebe ja in diesem neu gewählten Landtag „eine bürgerliche Mehrheit rechts“, nämlich CDU, FDP und AfD. Und in der AfD sehe er ohnehin eine konservative Partei. Das einzige Problem sei deren Landeschef Björn Höcke, der Umgang mit allen anderen Abgeordneten hingegen gut. Auch wenn eine Zusammenarbeit ja nicht gleich in einen Koalitionsvertrag münden müsse, hätte er, Heym, kein Problem damit, wenn die AfD ein Bündnis mit einem CDU-Ministerpräsidenten toleriere.[2]

Was für ein Tabubruch! Ein bürgerliches Bündnis unter Einbeziehung der AfD: Noch vor Kurzem hätte man sich dergleichen nicht vorstellen können. Doch Thüringen macht das Undenkbare vorstellbar. Denn mit einer Tolerierung durch die AfD ist diese indirekt an der Regierung beteiligt. Und zugleich ist dies, wie die Geschichte lehrt, der Einstieg in zukünftige Koalitionen. Damit wird die Abgrenzung der Union nach rechts aufgehoben. Doch Konsequenzen? Fehlanzeige. Im Gegenteil: Am Anfang war es „nur“ der stellvertretende Fraktionschef Heym, aber kurz darauf plädierten bereits 17 Thüringer CDU-Funktionäre für „ergebnisoffene“ Gespräche mit der AfD. CDU-Generalsekretär Paul Ziemiak bezeichnete diese Überlegungen zwar als „irre“, schließlich gebe es einen klaren Unvereinbarkeitsbeschluss, der Koalitionen mit der AfD wie mit der Linkspartei auf Bundes-, aber auch auf Landesebene ausschließt. Doch anstatt ihn abzustrafen, wurde Heym umgehend als stellvertretender Fraktionschef wiedergewählt, auf Vorschlag von Mike Mohring.

Hier zeigen sich der enorme Autoritätsverlust der CDU-Bundesspitze wie auch die Eigenwilligkeit der ostdeutschen Landesverbände, die offensichtlich große Nähe zur AfD empfinden und einen immensen Willen zur Macht haben. Das aber wirft die Frage auf, wie lange noch die Bundes-CDU diesem wird etwas entgegensetzen können – oder ob wir es tatsächlich schon in Kürze mit Koalitionen zwischen CDU und AfD zu tun bekommen.

Relativierung des Rechtsradikalismus

Denn hier liegt das grundlegende strategische Dilemma der CDU: Bereits mit der Eurokrise 2013, aber mehr noch seit der Fluchtkrise von 2015 ist die AfD als rechte Konkurrenz in das bürgerliche Lager eingebrochen und hat es durch die eigene Selbstradikalisierung tief und nachhaltig gespalten. „Bürgerliche Mehrheiten“ sind damit auch in vormals klassischen CDU-Ländern – wie Sachsen, Thüringen, aber auch Baden-Württemberg – auf unabsehbare Zeit ausgeschlossen. Und zugleich steigt die Versuchung der Union, die Stimmen für die AfD in das demokratische Spektrum zurückzuholen, indem man die AfD als bürgerliche Partei etikettiert, um so wieder zu Mehrheiten zu kommen. Die fatale Konsequenz liegt auf der Hand: Wer der AfD ein bürgerliches Mäntelchen umhängt, macht sie hoffähig.

Insofern hat die Thüringer CDU die Büchse der Pandora geöffnet. Denn wer den Eindruck erweckt, man habe es bei der AfD mit einer bürgerlichen Partei zu tun, relativiert zugleich deren Rechtsradikalismus. Michael Heym erklärt denn auch prompt die AfD in Thüringen für in Gänze ungefährlich, mit einer Ausnahme: Björn Höcke. „Und“, so Heym weiter, „den immer gleichlautenden Reflex, dass das [die Wählerinnen und Wähler] alles Nazis wären, den teile ich so nicht“.

So richtig es ist, dass auch massive Versäumnisse der anderen Parteien zur Wahl der AfD führen: Die Argumentation Heyms bagatellisiert die Tatsache, dass von den Wählerinnen und Wählern der Thüringer AfD auch deren Spitzenkandidat Höcke gewählt wurde – ein dezidierter Rechtsradikaler, der bewusst den Schulterschluss mit dem antisemitischen Anführer von Pegida sucht.[3] Wer sich mit einer solchen Partei einlässt, gibt klar zu verstehen, dass er nicht bürgerlich, sondern rechts wählt. Zugleich stellt sich die Frage, ab wann das, was manche Wählerinnen und Wähler nur als Protestwahl deklarieren, auch ein klares rechtsradikales Bekenntnis ist.

2019-10-27 Wahlabend Thüringen by Sandro Halank–60.jpg

Zugespitzt gefragt: Würden wir die Wählerinnen und Wähler, die Hitler „aus Protest“ gegen die „System“-Parteien – damals NS-, heute AfD-Jargon – gewählt haben, heute nicht auch Nazis nennen? Ab wann also wird ein Wähler einer rechtsradikalen Partei selbst zum Rechtsradikalen? Diese Frage muss gestellt werden. Denn die Behauptung, dass es sich nur um eine Protestwahl gehandelt habe, ist eine Exkulpation der AfD-Wählerinnen und Wähler, von denen 72 Prozent erklären, dass das AfD-Wahlprogramm wichtig für ihre Wahlentscheidung war.[4] Heyms Argumentation – alle bürgerlich, außer Höcke – verkennt zudem völlig, dass unter Höcke eine rechtsradikale Parteibasis existiert, die ihn immer wieder fast per Akklamation zum unangefochtenen Führer der Thüringer AfD gewählt hat. Durch die Behauptung, eigentlich gehe es nur um die Personalie Höcke, ansonsten wäre die AfD problemlos, werden seine massenhaften Anhänger in der Partei wie in der Wählerschaft zum Verschwinden gebracht – und so die AfD akzeptabel gemacht. Das Ziel ist klar: Indem die AfD ins bürgerliche Lager eingemeindet wird, soll sie koalitionstauglich und die CDU damit wieder mehrheitsfähig gemacht werden. Faktisch aber ist es eine Strategie der bewussten Verharmlosung einer rechtsradikalen Partei, die sich in Thüringen dezidiert für den Führer Höcke und dessen Programm entschieden hat.[5]

Die Lebenslüge der CDU

Quelle        :        Blätter         >>>>>         weiterlesen

——————————————————————-

Graqfikquellen          :

Oben        —      Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke), Christian Müller (MDR)

Abgelegt unter L. Thüringen, Medien, Positionen, Regierung | Keine Kommentare »

Eine Schifffahrt, die ist …

Erstellt von DL-Redaktion am 1. Dezember 2019

Die Binnenschifffahrt könnte dabei helfen die Klimaziele zu retten

SophienhafenHalle WSA.JPG

Von Annette Jensen

Die Binnenschifffahrt könnte dabei helfen, die deutschen Klimaziele zu erreichen. Doch die marode Infrastruktur und der Trend zu immer schnelleren Lieferungen erschweren das.

Warten. Am Kai nebenan quietscht seit Stunden ein Kran, der Getreide in ein Schiff schaufelt. Auf der „MS Catharina“ aber ist es still. Ab und zu fegt eine Sturmböe über das flache Schiff und das eingezäunte Gelände im Magdeburger Hafen, auf dem plastikverpackte Rotoren und andere Bauteile für Windräder lagern. Bei diesem Wetter ist es zu gefährlich, 68 Meter lange Flügel zu verladen.

Für Kapitän Klaus Hohenbild, seinen Bruder Karl Georg und seinen Sohn Christoph war das Wochenende am Sonntag schon vorbei. Da sind sie knapp fünf Stunden mit dem Auto von ihrer Heimatstadt Emmerich am Rhein nach Magdeburg an der Elbe gefahren. Sie wollten unbedingt rechtzeitig auf ihrem Schiff sein, wenn der Lkw mit ihrer Ladung eintrifft. Doch jetzt müssen sie erst mal warten.

Zweimal hat Klaus Hohenbild oben am Kai schon nachgefragt. Dann kam der Anruf: Heute nicht. Morgen, vielleicht. Der 65-Jährige brummt und schaut aus dem Fenster. Das Schiff bewegt sich kaum. Vom Sturm merkt man im Bauch der 100 Meter langen „MS Catharina“ so gut wie nichts.

Wenn es nach der Bundesregierung geht, sollen Familie Hohenbild und ihr Schiff dabei helfen, die deutschen Klimaziele zu erreichen. Sie will den Gütertransport von der Straße auf Schienen und Flüsse verlagern. Das Bundesverkehrsministerium unter Andreas Scheuer will die „Attraktivität für Industrie und Logistik steigern“, heißt es im Klimaschutzprogramm.

Denn der Transport auf dem Wasser ist deutlich klimafreundlicher als mit dem Lkw, die in Deutschland gegenwärtig über 70 Prozent des Transports abwickeln. Die Binnenschifffahrt dümpelt bei gerade mal 8 Prozent vor sich hin. Laut Umweltbundesamt werden bei Gütertransporten mit dem Lkw Treib­haus­gase der Menge 103 Gramm pro Tonnenkilometer ausgestoßen, mit der Binnenschifffahrt sind es nur 32 Gramm. Noch in den 1960er Jahren teilten sich Bahn, Laster und Schiff die Transporte zu etwa gleichen Teilen – danach ging es mit der Schifffahrt ab- und mit dem Straßentransport aufwärts. Wie kam die Schifffahrt in die Krise? Und kann man das Ruder wieder rumreißen?

Karl Georg will jetzt etwas tun, um die Wartezeit zu überbrücken. Bekleidet mit Blaumann und ausgebleichtem Stoffhütchen steigt er die steile Treppe in den Maschinenraum hinunter, um dort ein bisschen aufzuräumen und Werkzeuge und Farbtöpfe zu sortieren. Alles ist gut ausgeleuchtet hier, Boden und Bleche sind rot und gelb lackiert, die Rohre grün. Es riecht nach Diesel, obwohl nirgendwo ein Tröpfchen Öl zu sehen ist. Nach einem Kohletransport schrubben sie den Frachtraum sechs bis sieben Stunden lang, bis dort bedenkenlos die nächste Ladung Korn, Dünger, Streusalz oder Windradflügel gelagert werden können. „Schrott transportieren wir nicht. Das gibt zu viele Beulen“, erzählt Karl Georg.

Die drei Hohenbilds hoffen, dass die Fahrt nach Bremen am nächsten Tag beginnen kann. Am Freitag sollen sie dort abladen, anschließend werden die Windradflügel in die Türkei verschifft. Jetzt ist es ist Montag. Sie haben also fünf Tage Zeit, um von Magdeburg nach Bremen zu kommen. Fünf Tage für 385 Kilometer. Das sollte schaffbar sein – oder?

Die Probleme der Schifffahrt

Wartezeiten gehören für Binnenschiffer zum Geschäft. Lade- und Löschzeiten sind Teil der Verträge. Und so werden die Hohenbilds auch für die Verzögerung in Magdeburg ein Ausfallgeld vom Auftraggeber bekommen. Das decke die laufenden Kosten aber kaum, sagt Klaus Hohenbild. Seine Familie ist auch Mitglied in einem Netzwerk, in dem er und seine Kollegen anonym ihre Frachtpreise einstellen, um einem Unterbietungswettbewerb entgegenzuwirken.

„Als ich anfing, war es eine Sensation, wenn eine Schleuse mal zwei Wochen lang nicht funktionierte“, erinnert sich Klaus Hohenbild, während er es sich auf dem Steuer­mannsitz im Führerhaus bequem macht und die Füße hochlegt. Fast 50 Jahre liegt seine Lehrzeit zurück; genau wie sein Sohn Christoph sein Azubi war, so hat auch er auf dem Schiff seines Vaters gelernt.

Klaus Hohenbild holt sein Handy raus, er möchte zeigen, was in der Binnenschifffahrt schief läuft. Auf einem Foto sieht man einen Mann in einem neongelben Anzug, der sich an einem Betonklotz festgekettet hat und an einem Seil zieht. „Das ist im Weser-Datteln-Kanal. Da setzen sie jetzt sogenannte Festmacher ein“, empört er sich. Sein Bruder Karl Georg kichert. Die Innenwände dieser Schleusen sind so marode, dass die Schiffe ihre Taue nicht mehr um die Poller legen dürfen. Obwohl es sich um eine der am meisten befahrenen Wasserstraßen handelt, erließ das Amt vergangenes Jahr auch die Anweisung, dass immer nur ein Schiff auf einmal einfahren darf.

Hohenbild wischt über den Bildschirm und zeigt eine unscharfe Aufnahme: ein winziges Sportboot, das in die über hundert Meter lange Schleusenkammer tuckert. Es ist klein genug, um gemeinsam mit anderen Schiffen durchgeschleust zu werden. Das geht aber nicht – wegen der Anweisung. So entstehen lange Warteschlangen. „Vier, fünf, sechs, sieben Stunden Wartezeit“, sagt Kapitän Hohenbild. Weil die verladende Industrie protestierte, setzt die Schifffahrtsverwaltung jetzt Männer im Dreischichtbetrieb ein, die den Schiffen beim Festmachen helfen. Wie lange dieses Provisorium weitergehen soll? „Weiß keiner. Wir wissen es jedenfalls nicht.“

Auf dem Weg bis nach Bremen müssen sie elfmal in eine Schleuse einfahren, um Staustufen zu überwinden. Auch hier heißt es häufig warten. Da ist die Schleuse Drakenburg, die seit Monaten klemmt. In Minden gibt es seit zwei Jahren eine neue Anlage, die aber nur von großen Schiffen genutzt werden darf. „Sie soll wohl geschont werden“, mutmaßt Kapitän Klaus Hohenbild. Die „MS Catharina“ muss hier oft stundenlang an der Anlage für kleinere Schiffe ausharren. Beide Schleusen werden aus der Ferne gesteuert – und eine parallele Bedienung ist offenbar nicht möglich oder vorgesehen. „Behörde“, stöhnt der sonst so gelassen wirkende Mann.

Zuständig für den Zustand der Schleusen und der Binnenschifffahrt ist die Wasser- und Schifffahrtsverwaltung (WSV). „Da ist kein Zug drin, das System ist krank, keiner will da die Verantwortung übernehmen“, sagt der Kapitän. Jeder Anruf bei der WSV sei schwierig. Oft erreiche er dort niemanden oder er müsse betteln, um zu einer zuständigen Person durchgestellt zu werden.

Erst ein paar Tage alt ist die Meldung, dass der Nord-Ostsee-Kanal für große Schiffe vorübergehend nicht passierbar ist, weil eine Schleuse in Brunsbüttel gewartet wird und sich die andere nicht vollständig öffnen lässt. In der Nische des Schleusentors hat sich Schlick angesammelt. Angesichts solcher Zustände findet es Klaus Hohenbild „zum Lachen“, dass dauernd von Digitalisierung und selbstfahrenden Binnenschiffen als Zukunftsvision die Rede ist.

Ruhrmündung Duisburg Luftaufnahme 2014.jpg

Doch lustig finden die Hohenbilds die Lage der Binnenschifffahrt nicht. Es hapert überall. Und seit Frühjahr nehmen die Frachtanfragen auch wieder ab, die Preise geraten unter Druck. „Die Kohle ist seit Langem auf dem absteigenden Ast, auch Sand und Kies sind rückläufig“, benennt Hohenbild ganz nüchtern die Probleme seiner Branche. Aufgeben aber ist für die Familie Hohenbild keine Option – und auch der 29-jährige Christoph geht fest davon aus, dass er sein gesamtes Berufsleben auf Flüssen und Kanälen verbringen wird. Seit mindestens 1850 gehört die Schifffahrt zur Familientradition der Hohenbilds.

Hört man den Männern zu, könnte man den Eindruck bekommen, dass die Krise der Binnenschifffahrt vor allem ein Ergebnis mangelnder Finanzierung von Schleusen und Technik ist. Die Bundesregierung will das mit einer Verdopplung ihrer Investitionen ändern. Aber die Probleme liegen gerade für das Familienunternehmen Hohenbild tiefer, oder besser: flacher. Fuhr der Vater von Klaus und Karl Georg noch mit einem 300-Tonnen-Frachter, so kann die „MS Catharina“ sechsmal so viel laden. „Das entspricht 74 Lkw“, rechnet Klaus Hohenbild vor. Damit gehört das Schiff heute eher zu den Kleinen: Fast alle neuen Schiffe sind inzwischen 135 Meter lang und für 3.500 Tonnen Last oder Containertransport vorgesehen – sie schippern fast ausschließlich auf dem tiefen Rhein, wo acht von zehn Transporten auf Flüssen stattfinden.

Quelle          :          TAZ          >>>>>          weiterlesen

——————————————————————-

Grafikquellen        :

Oben        —         Einfahrt zum Sophienhafen, Gebäude des Wasserstraßen- und Schifffahrtsamtes Magdeburg, Halle (Saale)

——————————-

Unten           —       Aerial shot of mouth of the Ruhr (River) River at Duisburg-Ruhrort into the Rhine

Abgelegt unter Nordrhein-Westfalen, Sachsen-Anhalt, Überregional, Wirtschaftpolitik | Keine Kommentare »

Bis heute ungeklärt :

Erstellt von DL-Redaktion am 1. Dezember 2019

Der Mord an Alfred Herrhausen

Gewerbegebiet Süd Eschborn 09.JPG

Quelle      :     Scharf  —   Links

Von Ernst Wolff

Vor dreißig Jahren, am 30. November 1989, wurde Alfred Herrhausen, Chef der Deutschen Bank, durch einen Bombenanschlag getötet. Auf Grund eines nicht verifizierten Bekennerschreibens und vager Indizien wurde der Anschlag der terroristischen Untergrundorganisation Rote Armee Fraktion (RAF) zugeschrieben. Die Mörder wurden jedoch nie ermittelt und mittlerweile gibt es zahlreiche Hinweise, die an der Täterschaft der RAF zweifeln lassen.

Trotzdem haben die Mainstream-Medien und die Behörden bis heute nicht die Frage gestellt, wer ein Interesse an Herrhausens Tod gehabt haben könnte. Zudem beschreiben sie ihn nach wie vor fälschlicherweise als Kapitalismuskritiker und als Träumer, der für eine Utopie sein Leben riskierte.

Tatsächlich war Herrhausen ein von der Marktwirtschaft überzeugter Banker, dessen erklärtes Ziel darin bestand, die Deutsche Bank an die Weltspitze zu führen und der als einer der ersten Europäer die Chancen erkannte, die der Umbruch im Finanzwesen den Großbanken in den Siebziger und Achtziger Jahren eröffnete. Vor allem aber war er ein Mann, der seine Ziele kompromisslos und mit großer Konsequenz und Härte verfolgte und der kein Problem damit hatte, sich viele Feinde zu machen.

Herrhausen erkannte früh die Chancen der Deregulierung

Nach dem Ende des Nachkriegsbooms, der die Deutsche Bank zum größten deutschen Finanzinstitut hatte aufsteigen lassen, suchten die Banken wegen des nachlassenden Kreditgeschäftes nach neuen Einnahmequellen und drängten die Politik, das Finanzwesen zu deregulieren und ihnen zu ermöglichen, das eigene Geschäft zu globalisieren.

Bereits im Anfangsstadium dieser Entwicklung nutzte Herrhausen die Möglichkeiten, die sich dadurch vor allem im Bereich des Investmentbankings ergaben und trieb die Neuausrichtung der Deutschen Bank ab Mitte der Achtziger Jahre energisch voran. Dabei zog er sich wegen seiner rigorosen Personalpolitik den Zorn großer Teile der traditionell konservativen Führung des Geldhauses zu.

Das aber hinderte ihn nicht daran, das Tempo des Umbaus sogar noch zu forcieren. Unter seiner Führung übernahm die Deutsche Bank zwischen 1986 und 1989 diverse Banken und  Wertpapier-Broker in Italien, den Niederlanden, Portugal, Spanien, Österreich, Kanada und Australien.

Eintreten für den Schuldenschnitt – kühle Kalkulation zum eigenen Vorteil

Im Herbst 1987 unterbrach Herrhausen die Jahrestagung des IWF in Washington für einen Kurzbesuch beim Präsidenten des hoch verschuldeten Mexikos. Am Tag darauf forderte er auf einer Pressekonferenz zum ersten Mal einen umfassenden Schuldenerlass für die Entwicklungsländer – ein Vorstoß, der weltweit Aufsehen erregte.

Es handelte sich dabei aber keineswegs um die Utopien eines Visionärs, sondern um ein in doppelter Weise kalkuliertes Manöver: Einerseits schwamm Herrhausen auf der populären Welle des damals weltweiten Protestes gegen die Politik von IWF und Weltbank, andererseits brachte er die Deutsche Bank so im internationalen Wettbewerb in eine besonders günstige Lage: Während ein solcher Schuldenschnitt mehrere amerikanische Banken in große Schwierigkeiten gebracht hätte, hätte die Deutsche Bank ihn weitgehend problemlos überstanden – weil Herrhausen sie zuvor ganz bewusst gegen einen solchen Schock abgesichert hatte.

Kein Wunder also, dass eine mächtige Front aus Wall Street, IWF und Weltbank Herrhausens Pläne samt und sonders empört zurückwies. Als er dann auch noch so weit ging, seine Ideen den Mitgliedern amerikanischer Banken zu präsentieren, wurde er anschließend so massiv bedroht, dass er sich gezwungen sah, auf der Weltbankkonferenz 1989 eine schusssichere Weste zu tragen.

Herrhausens hervorragende Beziehungen zur Politik

Der Schuldenschnitt aber war nicht die einzige Front, an der Herrhausen seine Gegner herausforderte. Neben seiner Tätigkeit als Bankchef beriet er auch noch Bundeskanzler Helmut Kohl und war maßgeblich an dem 10-Punkte-Programm zur deutschen Wiedervereinigung beteiligt, das Kohl am 28. November 1989 verkündete, und zwar ohne vorherige Absprache mit den Alliierten.

Außerdem ging die Deutsche Bank dank Herrhausens Beziehungen als einer der ganz großen Gewinner aus der deutschen Wiedervereinigung hervor. Ihr wurden bei der Abwicklung der DDR-Staatsbank und der Neugründung der Deutschen Kreditbank 49 % ihrer Anteile und 122 Bankfilialen in bester Lage übertragen – ein Macht- und Vermögenszuwachs, der hervorragend in Herrhausens Pläne passte, die Deutsche Bank zu einem „Global Player“ und so zum Konkurrenten der Wall-Street-Banken zu machen.

Der ganz große Coup

Mit einem derartigen Machtzuwachs ausgestattet, blies Herrhausen 1989 zum ganz großen Angriff auf die Wall Street und die City of London: Die in den Jahren zuvor sorgfältig vorbereitete Übernahme der britischen Investmentbank Morgan Grenfell für 2,7 Milliarden DM sollte der Deutschen Bank mit einem Paukenschlag den Einstieg ins internationale Derivategeschäft bescheren.

Damit aber warf Herrhausen nicht nur den weltweit größten Bankhäusern den Fehdehandschuh hin, sondern auch den eigenen Kollegen: Als er sie am 28. November 1989 bei einer Vorstandssitzung in München aufforderte, den Chef von Morgan Grenfell in den Vorstand der Deutschen Bank aufzunehmen, kam es zu einem Aufstand, den sein Nachfolger Hilmar Kopper als „Palastrevolution“ beschrieb.

Den letzten Höhepunkt in der Auseinandersetzung mit seinen Gegnern setzte Herrhausen schließlich in einem Interview mit dem ‚Wallstreet Journal’, in dem er erklärte, dass er Polen mit Hilfe einer eigenen Bank und unter Umgehung der „strukturellen Anpassungen“ von IWF und Weltbank wirtschaftlich voranbringen wolle – ein weiterer Affront gegen beide Organisationen, den sich bis dahin kein führender Banker geleistet hatte.

Die Fragen, die bleiben

Ein nüchterner Blick auf Herrhausens Karriere zeigt, dass er nicht nur einer der ersten war, der die Chancen für das Finanzgewerbe im Investmentbanking erkannte und zum Vorteil der Deutschen Bank nutzte, sondern dass er zur Erreichung seiner Ziele auch mit eiserner Härte und letzter Konsequenz vorging und nie davor zurückscheute, sich Feinde zu machen.

Heute, dreißig Jahre später, muss man sich daher fragen, warum die Ermittlungen sich so lange fast ausschließlich um eine Terrororganisation drehten, die sich damals im Zustand der fortgeschrittenen Auflösung befand und an deren Täterschaft immer größere Zweifel aufkamen. Warum haben die zuständigen Behörden im Zusammenhang mit dem Attentat niemals die alles entscheidende Frage „Wer hätte ein Motiv gehabt?“ gestellt?

Bad Homburg Herrhausen-Stelen.jpg

Aufschlussreich ist in diesem Zusammenhang die Tatsache, dass Herrhausens Nachfolger Hilmar Kopper die Idee eines Schuldenschnittes für die Dritte Welt sofort fallen ließ und dass kein Deutsche-Bank-Chef nach Herrhausen je wieder öffentliche Kritik am IWF oder an der Weltbank geäußert hat.

Es ist gut möglich, dass wir nie erfahren werden, wer hinter dem Anschlag vom 30. November 1989 gesteckt hat. Je mehr Fakten man jedoch über seine Vorgeschichte aneinanderreiht und miteinander verknüpft, umso weniger wahrscheinlich erscheint die Version vom RAF-Attentat, die heute noch von den deutschen Behörden und der Mehrheit der Mainstream-Medien verbreitet wird.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————

Grafikquellen      :

Oben   —        Stahlskulptur (2002) im Kreisverkehr an der Kreuzung der Frankfurter Straße mit der Mergenthalerallee und der Alfred-Herrhausen-Allee

———————————

Unten   —       Memorial for the assassination of Deutsche Bank CEO Alfred Herrhausen in 1989, Bad Homburg, Germany. The memorial indicates the position of the car bomb which killed Herrhausen. A 3rd stele on the other side of the road is not shown.

Abgelegt unter Deutschland, Finanzpolitik, Hessen, Regierung | Keine Kommentare »

Die Anti-Groko-Spitze

Erstellt von DL-Redaktion am 1. Dezember 2019

SPD wählt Esken und Walter-Borjans

2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg

Von  dpa/taz

Beim SPD-Mitgliederentscheid gewinnt überraschend das linke Duo Saskia Esken und Norbert Walter-Borjans. Sie liegen deutlich vor Scholz und Geywitz.

Die GroKo-Kritiker Norbert Walter-Borjans und Saskia Esken sollen nach dem Willen der Parteimitglieder Vorsitzende der SPD werden. Der frühere nordrhein-westfälische Finanzminister und die Bundestagsabgeordnete aus Baden-Württemberg gewannen die Stichwahl des Mitgliederentscheids mit 53,06 Prozent der Stimmen, wie die SPD am Samstag mitteilte. Ihre Konkurrenten, Vizekanzler Olaf Scholz und die Brandenburger Politikerin Klara Geywitz, kamen lediglich auf 45,33 Prozent.

Scholz und Geywitz haben den neuen Parteichefs ihre Unterstützung zugesagt. Die SPD habe mit Norbert Walter-Borjans und Saskia Esken nun eine neue Parteiführung und hinter dieser müssten sich alle versammeln, sagte beide nach der Verkündung des Ergebnisses im Willy-Brandt-Haus. Ziel bleibe, die SPD wieder stark zu machen, das sei gemeinsame Sache.

Olaf Scholz will trotz der Niederlage beim Mitgliederentscheid um den SPD-Vorsitz Bundesfinanzminister bleiben. Er werde nicht zurücktreten, erfuhr die Deutschen Presse-Agentur aus Parteikreisen.

Die Wahlbeteiligung lag bei rund 54 Prozent. Offiziell gewählt ist die neue Doppelspitze damit aber noch nicht. Der Parteitag in der kommenden Woche muss sie noch bestätigen, was allerdings als sicher gilt.

Quelle        :        TAZ         >>>>>          weiterlesen

Die neue SPD-Spitze ist links

Versöhnen statt spalten

2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2562.jpg

Kommentar von Stefan Reinecke

Die Wahl von Esken und Walter-Borjans ist ein historischer Einschnitt. Der SPD drohen Turbulenzen, wenn sie irreale Forderungen durchprügeln.

Das Votum für Saskia Esken und Norbert Walter-Borjans ist ein historischer Einschnitt. Denn es gehört zur DNA der Sozialdemokratie, dass die Basis am Ende immer murrend der Führung folgt. Doch die SPD-Basis glaubt den Glaubenssätzen des Weiter-so und den rituellen Beschwörungen der Verantwortungsethik nicht mehr.

Diese Wahl ist aber weniger eine für Esken und Nowabo und deren besonders glanzvolle Performance. Sie ist ein deftiges Misstrauensvotum gegen das Parteiestablishment, das komplett Scholz & Geywitz stützte. Dass die Wahlbeteiligung bescheiden war, zeigt, wie erschöpft die Partei ist.

Aber das verblasst angesichts der zentralen Frage: Es ist klar, was die SPD-Basis nicht mehr will, aber schwer zu erkennen, was sie will. Was kommt jetzt

Quelle         :         TAZ            >>>>>          weiterlesen

—————————————————————–

Grafikquellen       :

Oben       —         Team Saskia Esken und Norbert Walter-Borjans bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg
  • Erstellt: 2019-09-10 18:00:40

 

——————————-

Unten      —         Team Klara Geywitz und Olaf Scholz bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2565.jpg
  • Erstellt: 2019-09-10 18:54:20

Abgelegt unter Berlin, P.SPD, Positionen, Regierung | Keine Kommentare »

Der Linke PV v. 23./24.11.19

Erstellt von DL-Redaktion am 30. November 2019

Bericht von der Sitzung

Mitglieder des Parteivorstands der LINKEN halten ein Transparent mit dem Text: Für Frieden und Demokratie in der Türkei. Solidarität mit der HDP. DIE LINKE.

Quelle         :       AKL

Von Lucy Redler und Thies Gleiss
Mitglieder des Bundessprecher*innenrates der Antikapitalistischen Linken in der LINKEN im Parteivorstand.

DER NEUGEWÄHLTE FRAKTIONSVORSTAND WAR DA

Am 23. und 24. November kam der Parteivorstand der LINKEN zu seiner letzten Sitzung in 2019 zusammen. Die Sitzung war mit bis zu 36 (von noch 43 gewählten PV-Mitgliedern) Teilnehmenden einer der bestbesuchten. Als Gäste wurden am Samstag die neu gewählten Vorsitzenden der Fraktion der LINKEN im Bundestag, Amira Mohamed Ali und Dietmar Bartsch, begrüßt. Am Samstag waren zudem Martina Michels von der Fraktion GUE-NGL im Europaparlament und Heinz Bierbaum vom Vorstand der Europäischen Linken zu Besuch. Am Sonntag waren eine Delegation der Jugendorganisation Linksjugend-Solid und des Studierendenverbandes SDS sowie die Sprecherin für Gleichstellung in der Fraktion der LINKEN, Doris Achelwilm, als Gäste anwesend.

1. Aussprache mit den neu gewählten Fraktionsvorsitzenden

Es sollte ja eine Selbstverständlichkeit sein, dass die Vorsitzenden der Fraktion der LINKEN im Bundestag an den Sitzungen des Vorstandes der Partei beratend teilnehmen, deren Arbeit und deren Wahlkämpfen sie ihre privilegierte Stellung als Berufspolitiker*innen verdanken und deren Beschlüsse und Ideen sie in der Bundestagsarbeit umsetzen sollen. Leider ist das in der LINKEN nicht selbstverständlich und wir von der AKL fordern dies immer wieder – auch zu dieser Sitzung – ein.

Die Aussprache mit den Fraktionsvorsitzenden wurde durch die Parteivorsitzende Katja Kipping eingeleitet. Ihr Redebeitrag ist mittlerweile veröffentlicht (https://www.katja-kipping.de/de/article/1639.das-richtige-nicht-nur-sagen-sondern-auch-umsetzen.html).
Im Zentrum ihrer Ausführungen stand die Aufforderung, dass die LINKE sich zu einer „linken Mehrheit“ und dem Auftrag zum Regieren bekennen müsse. Das wäre kein einfaches „Rot-Rot-Grün“, sondern ein umfängliches Programm der Umsetzung linker Forderungen. Die LINKE müsse den GRÜNEN und der SPD deutlich machen, dass ein „Großteil der politischen Vorhaben“, die sie aktuell diskutieren und auf Parteitagen beschließen, nicht in einer Regierungsallianz mit der CDU/CSU, sondern nur mit der LINKEN umsetzbar wären.

Amira Mohamed Ali skizzierte als Input kurz ihre Zielsetzung als neue Fraktionsvorsitzende. Die Fraktion hat die Aufgabe, dass die LINKE in den gesellschaftlichen Auseinandersetzungen mehr vorkomme. Das wäre heute leider nicht der Fall, sondern die öffentliche Debatte finde fast ohne die LINKE statt. Um das zu ändern müsse sich die Fraktion besser aufstellen und ihre Inhalte, vor allem die erfolgreichen, überzeugender darstellen.
Der in seinem Amt als Fraktionsvorsitzender bestätigte Dietmar Bartsch unterstützte dies. Die Erfolge der LINKEN und ihrer Fraktion müssten besser vermarktet und verbreitet werden. Es fehle ein positives Selbstverständnis der Fraktion, stattdessen dominiere eine Kultur der gegenseitigen Auf- und Abrechnung.
Er griff die Aufforderungen von Katja Kipping, neue linke Mehrheiten zu organisieren, ausdrücklich auf und forderte eine neue „Mitte-Links-Regierung“ auch auf Bundesebene.

In der Aussprache wurde überwiegend deutlich, dass die These, mit SPD und GRÜNEN (oder auch nur mit aus ihnen rausgebrochenen nennenswerten Teilen) wären jetzt verbesserte Möglichkeiten einer Regierungsbildung aufgekommen, auch weil die „GroKo“ an ihrem Ende angelangt sei, arg steil und wirklichkeitsfremd ist. Gerade der Parteitag der GRÜNEN hat noch einmal das Hauptanliegen der GRÜNEN aufgeführt, neue Hoffnungen in den Kapitalismus und seine ökologische Modernisierung zu schüren, jenseits aller realen Erfahrungen. Auch die inhaltslose und trotz immensen Aufwandes nicht einmal die Hälfte der eigenen Mitglieder mobilisierende Inszenierung der SPD, um neue Parteivorsitzende zu finden, zeigt, dass es gerade keinen neuen linken Aufbruch in der SPD gibt.
Richtig ist es aber, dass die Fraktion der LINKEN kein gutes Bild abgegeben hat und abgibt. Sie ist ein Ensemble von Einzelteams der jeweiligen Abgeordneten, die sich einen von Egoismus und Konkurrenz geprägten Stellungskampf leisten.
Lucy Redler und Thies Gleiss verwiesen vor allem auf die deprimierende Kluft zwischen den realen Möglichkeiten einer oppositionellen, auch antikapitalistischen Bewegung und dem, was die Fraktion als Ganzes daraus macht. Die Bewegung für Klimagerechtigkeit, aber auch die Mieterkämpfe und andere Proteste, zeigen, wie unendlich viel wirksamer die außerparlamentarische Opposition ist. Eine Fraktion der LINKEN müsste ihre Kräfte auf die Verbreitung der Forderungen dieser Bewegungen – aktuell vor allem zum Mietendeckel und Mietsenkung – konzentrieren, anstatt diese sozialen Aufbrüche zu Gunsten irgendwelcher sowieso nicht kommender Regierungsallianzen zu kanalisieren und auf eigenes linkes Profil zu verzichten.

2. Aktuelle politische Situation

Die Vorbereitungen für die „Strategiekonferenz der LINKEN“ am 29.2./01.3. 2020 in Kassel laufen. Eine Reihe von Diskussionsbeiträgen ist bereits auf der Website veröffentlicht worden (https://strategiedebatte.die-linke.de/start/). Es sind bisher mehrere regionale Vorbereitungskonferenzen geplant: 19.1. in Ulm; 18.1. in Bremen; 18.1. in Mecklenburg-Vorpommern; 08.2. in Frankfurt.
Die Beiträge von Thies Gleiss und Lucy Redler zur Strategiedebatte sind hier https://www.antikapitalistische-linke.de/?p=3267 und https://www.antikapitalistische-linke.de/?p=3265 hier zu finden.

Der PV beschloss eine Solidaritätserklärung mit der Vereinigung der Verfolgten des Nazi-Regimes – Bund der Antifaschist*innen (VVN-BdA), denen die Finanzbehörden die Gemeinnützigkeit aberkannt haben. Politische Unterstützungs-Eintritte unserer Mitglieder in die VVN-BdA sind sinnvoll.
Einer der nächsten PV-Sitzungen wird sich umfassender mit der Gemeinnützigkeit und den als Steuermaßnahme verschleierten politischen Angriffen auf kritische Organisationen befassen.
Solidaritätserklärungen gab es auch für die Aktivist*innen, die in Italien seit Jahren gegen eine umweltzerstörende und überflüssige Bahnhochgeschwindigkeitstrasse (No-TAV) kämpfen und gerade zu drakonischen Geld- und Haftstrafen verurteilt wurden. Der geschäftsführende PV wird den genauen Wortlaut der Erklärung gemäß den Vorgaben aus dem PV formulieren und veröffentlichen.
Eine Solidaritäts- und Grußadresse wurden für die Sozialist*innen in Seattle/USA um Kshama Sawant) verabschiedet, die sich bei den Stadtratswahlen erfolgreich gegen eine gigantische und weltweit beachtete Kampagne von Amazon gegen die Sozialist*innen und ihre Forderung nach einer Amazon-Steuer zur Finanzierung lokaler Sozialpolitik durchgesetzt haben.
Am Sonntag wurde zudem eine Protesterklärung gegen den Putsch in Bolivien beschlossen.
Alle Beschlüsse sind demnächst auf den Online-Seiten der LINKEN nachzulesen.

3. Hamburg und Sachsen
Der PV hatte auf der letzten Sitzung beschlossen, im Rahmen der Debatte zur aktuellen Lage, jeweils ein oder zwei ausführlichere Berichte aus den Landesverbänden zu diskutieren.
Aus Sachsen wurde in diesem Rahmen über die Aufarbeitung der bitteren Wahlergebnisse berichtet. Auf dem Landesparteitag wurde ein neuer Landesvorstand – diesmal mit einer Doppelspitze – gewählt (https://www.dielinke-sachsen.de/2019/11/die-linke-sachsen-beendet-landesparteitag-und-will-digitalpolitische-leitlinien/)
Im Kontrast dazu wird sich in Hamburg auf die kommenden Bürgerschaftswahlen im Februar 2020 vorbereitet, zu der die aktuellen Umfragen für die LINKE ein erfreuliches, zweistelliges Ergebnis vorhersagen. (https://www.die-linke-hamburg.de/fileadmin/lv/lpt/06_04/Beschluesse/Beschluss_BuewaProgramm_191019.pdf)

4. Zukunft des Sozialstaats

Die Etablierung der „Hartz-Gesetze“ zur Reform der Arbeitsmarktpolitik, die von der letzten SPD-GRÜNEN-Bundesregierung beschlossen wurde, und von denen vor allem das vierte Gesetz (Hartz IV) Eingang in alle Wörterbücher gefunden hat, als Beispiel roher und verrohender Sozialpolitik, erlebt ihren fünfzehnten Jahrestag. Die LINKE wird das zum Anlass nehmen, zum Jahresanfang 2020 eine politische Initiative zur „Zukunft des Sozialstaats“ zu ergreifen. Dazu gab es im PV eine erste Debatte.
Katja Kipping eröffnete die Debatte mit einer Präsentation zu „Hartz IV – Armut per Gesetz“. Alle Kritikpunkte aus linker Sicht haben sich in diesen 15 Jahren bitter bestätigt: Die Armut nahm zu; das Lohngefüge wurde für alle nach unten gedrückt; die Dauererwerbslosigkeit wurde verfestigt; die Hartz-Gesetze und die Sanktionen haben ein furchtbares Regime der Entwürdigung und Abwertung der Menschen verursacht.

Thies Gleiss verwies in der Debatte darauf, dass „Hartz IV“ auch als eine Niederlage der Gewerkschaften bilanziert werden muss, zu der sie leider auch noch zugestimmt und die Einfallstore geöffnet haben. Politisch ist der Widerstand gegen Hartz IV aber auch einer der wesentlichen Gründungsimpulse für die LINKE gewesen, der immer wieder neu belebt werden muss. Der Begriff „Sozialstaat“ drückt deswegen nur unzureichend aus, um was es heute geht und ist historisch erfunden worden, um der Idee des Sozialismus etwas entgegen zu setzen. Er ist ein Ausdruck für ein spezifisches Kräfteverhältnis zwischen Kapital und Arbeiter*innenklasse, das beide Seiten permanent zu verändern suchen.
Andere betonten in der Diskussion, dass die LINKE klar machen muss, worin sie sich „von der Diakonie unterscheidet“.
Lucy Redler betonte, dass sich eine solche Initiative ins Verhältnis zu den heutigen gesellschaftlichen Bewegungen und Tarifrunden 2020 setzen müsste, damit sie nicht im luftleeren Raum verbleibt.

Wie genau die „Zukunft des Sozialstaats“ aus linker Perspektive aussehen muss, blieb noch unklar. Bis Weihnachten 2019 wird den Mitgliedern des PV von der Arbeitsgruppe „Zukunft des Sozialstaats“ und dem gfPV ein Konzept für die entsprechende Initiative in 2020 vorgelegt, an dem dann noch Änderungen möglich sind.

5. Fraktion im Europäischen Parlament und Situation der EL
Die Gäste Martina Michels und Heinz Bierbaum, dazu die PV-Mitglieder Martin Schirdewan, Claudia Haydt und Judith Benda berichteten zur Lage der linken Fraktion GUE-NGL im Europaparlament und zur Lage der EL.
Die Fraktion ist mit 41 Mitglieder geschrumpft gegenüber der Vorperiode und die kleinste Fraktion im Europaparlament. Die Aufgaben sind aber nicht geringer geworden. Die formale Konstituierung der Fraktion ist so gut wie abgeschlossen. In 2020 beginnt die Ratspräsidentschaft der BRD und damit wahrscheinlich auch eine erhöhte Aufmerksamkeit für das Wirken der Abgeordneten in dem sonst doch sehr vergessenen goldenen Käfig in Brüssel und Straßburg. Die Tatsache, dass drei gewählte Abgeordnete aus Katalonien nicht erkannt werden, bleibt ein Skandal und beweist, dass dieses Parlament offenkundig kein wirkliches Parlament mit den gängigen Rechten ist.

Die Situation in der Europäischen Linken ist kritisch zu bewerten. Die großen linken Organisationen Podemos in Spanien, Parti de Gauche in Frankreich, Partei der Arbeit in Belgien und Sozialistische Partei in den Niederlanden sind nicht oder nicht mehr dabei. Die 24 Mitgliedsparteien sind sehr unterschiedlich in Größe und politischer Ausrichtung und stehen sich teilweise sehr misstrauisch gegenüber. Die innere Struktur ist nicht handlungsfähig, zwischen dem Vorstand und dem „Rat der Vorsitzenden“ läuft kaum etwas zusammen. Die LINKE finanziert die EL jährlich mit 280.000 Euro (dazu kommen noch projektgebundene Einmalausgaben). Das ist sehr viel Geld für wenig Ergebnis. Es gibt keine gemeinsame politische Linie – insbesondere zur EU-Thematik, wobei nicht vergessen werden darf, dass die EL auch Mitgliedsgruppen außerhalb der EU hat.
Zusammengefasst: Es gibt auf diesem Feld noch sehr viel, fast alles zu tun.

6. Bericht von Ältestenrat und Bundesausschuss

Diese regelmäßigen Tagesordnungspunkte bringen auch regelmäßig die gleichen Diskussionen auf, weil insbesondere der Bundesausschuss immer noch keinen allseits respektierten Platz im Aufbau der LINKEN hat. Diesmal war der Streit etwas länger und lauter als sonst, weil der BA sich beschwerte – nach unserer Meinung: zurecht – nicht genügend in die Strategiekonferenz einbezogen und seine Vorschläge nicht genügend in der Gesamtmitgliedschaft kommuniziert werden.
Es gibt in der LINKEN – wir haben das von der AKL schon mehrfach detailliert kritisiert – die Tendenz, dass nicht nur die Fraktionen in den Parlamenten zu viel Einfluss bekommen, sondern auch der Parteiapparat und der geschäftsführende Vorstand zu viel Verselbstständigung gegenüber der Mitgliedschaft erhalten. Der Bundesausschuss ist das wichtigste Gremium, das neben den Delegierten zum Parteitag direkt in den Landesverbänden gewählt wird und viel näher an der Mitgliedschaft ist. Es wäre wichtig, dass dieses Gremium ernst genommen wird. Seine Beschlüsse sollten genau wie die von Parteitagen seriös veröffentlicht werden, auch auf Pressekonferenzen und im Rahmen unserer Kampagnen.

7. Bericht Linksjugend-Solid und SDS

Die beiden Jugendorganisationen berichten von erfreulichem Zuwachsen und vielen Projekten im Zusammenhang mit den neuen sozialen Bewegungen zum Thema Klima, Wohnen usw. Die Berichte dazu wurden schon auf der letzten Sitzung vorgestellt, diesmal wurden sie diskutiert.

8. Finanzplan

Der Schatzmeister Harald Wolf stellte die Grundzüge seiner Schätze vor. Die LINKE hat viel Geld – 14 Millionen Euro jährliche Einnahmen nur bei der Bundeskasse, davon 11 Millionen Staatsknete – aber dennoch wird es knapper, weil die schlechteren Wahlergebnisse weniger Zuflüsse zur Folge haben. Es war die „erste Lesung“ des Haushaltsplans 2020. Wir werden von der AKL auf die Finanzfrage ausführlicher eingehen, wenn die nächste Lesung ansteht.
Es wurde ein Richtungsbeschluss gefasst, die Zeitschrift „Disput“, die offiziell ein Mitgliedsorgan sein soll, aber nur 2800 Exemplare Auflage hat, in dieser Form nicht fortzuführen, sondern ein elektronisches und teilweise gedrucktes Zeitschriftenprojekt zu konzipieren, das breitere Verteilung erfährt und trotzdem finanziell günstiger ist.

9. Parité-Gesetz

Der Gesetzentwurf aus der Bundestagsfraktion der LINKEN zur Pflicht auf paritätische Zusammensetzung der Wahllisten und der Wahlkreisbewerberinnen aus Männern und Frauen wurde bereits auf der letzten PV-Sitzung vorgestellt. Es folgte jetzt eine weitere Diskussion. Dazu war Doris Achelwilm aus der Fraktion zu Gast und stellte das Projekt vor.
Das Problem ist die Aufstellung von Wahlkreis-Bewerber*innen als Doppelspitze (was entweder zu einer Verringerung der Anzahl Wahlkreise oder zu einer Verdoppelung der Direktmandate führt) oder die Abschaffung der Direktmandate zugunsten eines reinen Verhältniswahlrechts.
Die Diskussion war kontrovers, auch über die Frage, warum eine Zehnprozent-Fraktion sich überhaupt die viele Arbeit machen muss, dazu einen ausgefeilten Gesetzesentwurf vorzulegen. Aber über die Zielsetzung gab es keinen Dissens.
Es wurde beschlossen, dass sowohl eine Wahlkreis-Vergrößerung mit Doppelsitz als auch ein reines Verhältniswahlrecht von der LINKEN akzeptiert werden kann. Der Gesetzentwurf, der vorliegt, wurde nicht ausdrücklich abgestimmt.

10. Sonstige Beschlüsse und Berichte

– Die Debatte über die Berichte zur Feministischen Offensive und das Projekt „Feministisches Labor“ wurden verschoben.
– Die LINKE wird auch in 2020 wieder Kampagnenmaterial zum Frauentag herstellen und verbreiten sowie die Initiative zum Frauenstreik 2020 unterstützen.
– Die LINKE beteiligt sich wie jedes Jahr am Gedenken an Luxemburg und Liebknecht, diesmal am 12. Januar 2020
– Der Antrag, die Veranstaltungsreihe „Gedrucktes“ finanziell zu unterstützen, wurde abgelehnt. Es ist eine reine Berliner Angelegenheit, die auch von den Berliner Abgeordneten und dem Landesverband finanziert werden kann und sollte.
– Der Antrag zur „Privatisierung von Bürgerportalen“ wurde ein weiteres Mal verschoben, weil nicht so dringend.
– Es gab einen Zwischenstandsbericht zu den geplanten Aktivitäten anlässlich des 75. Jahrestages der Befreiung vom Faschismus (8. Mai 2020).
– Es gab einen Bericht zu den Vorbereitungen zum gemeinsamen Jahresauftakt von Partei und Fraktion am 10. Januar (der Beschluss dazu wurde bereits im Oktober gefasst).
– Zum „Fest der Linken“ am 20. Juni 2020 beschloss der PV ein Budget von 30.000 Euro. Der PV wird über das genaue Programm rechtzeitig informiert und befinden, damit nicht wieder so ein Unglück passieren kann, wie der Auftritt von Jens Spahn im letzten Jahr.
– Die LINKE unterstützt die Proteste gegen den AfD-Bundesparteitag in Braunschweig am 30. November 2020.
– Anträge zur Unterstützung von Protestaktivitäten gegen Nato-Manöver in der Lausitz und zur Prozessbeobachtung in der Türkei wurden vertagt.

akl - Antikapitalistische Linke

————————————————————–

Grafikquelle      :         Twitter – DIE: LINKE

Abgelegt unter Arbeitspolitik, Berlin, Deutschland, P. DIE LINKE | Keine Kommentare »

Dorf Mühlrose geht unter

Erstellt von DL-Redaktion am 28. November 2019

Mühlrose soll der Braunkohle weichen

File:Wochožanska jama 2.jpg

Aus Mühlrose und Schleife Sabine Seifert

Mühlrose, ganz im Osten der Republik gelegen, soll weg, der Braunkohle wegen. Else und Günter Zech wollen nicht fort. Bei den Noacks war der Umzugs­wagen schon da. Wie sich eine Dorfgemeinschaft schon vor dem Verschwinden auflöst.

as Dorf hat eine Straße, die hinein- und wieder hinausführt: in die selbe Richtung, aus der man gekommen ist. Wer in die andere Richtung fährt, landet nach wenigen Metern im Tagebaugebiet Nochten, wo die Lausitz Energie Bergbau AG (LEAG) möglichst lange Braunkohle zu fördern hofft. Auch die 150 Millionen Tonnen, die unter Mühlrose liegen sollen, will sie noch erschließen. Es könnte das letzte Dorf der Lausitz sein, das den Kohlebaggern weichen muss.

Seit sechs Jahrzehnten knabbert die Kohle an Mühlrose. Das Dorf ist ein Sonderfall. Denn noch steht nicht fest, ob die Kohle überhaupt gebraucht wird und ob abgebaggert werden darf. Dennoch wurde im Frühjahr diesen Jahres ein Umsiedlungsvertrag für die Einwohner unterzeichnet. Ein Großteil möchte umsiedeln. Aber längst nicht alle. Die Dorfgemeinschaft ist gespalten, der Dorffrieden dahin. Die einen kämpfen für ihren Wegzug, die anderen für ihren Verbleib. Die einen sind lauter, die anderen hartnäckig. „Die Seele des Ortes geht verloren“, sagt die Pfarrerin.

200 Einwohner zählt Mühlrose heute, im ostsächsischen Landkreis Görlitz gelegen. Ein hübsches Dorf, umgebaute Drei- oder Viertseithöfe, die typisch sind für das einst sorbische Siedlungsgebiet. Landwirtschaft wird hier schon lange nicht mehr betrieben. „Wo ich geboren bin, das ist schon weggebaggert“, sagt Else Zech. Die 80-Jährige lebt heute nur ein paar Dorfstraßen weiter. Es ist das Elternhaus ihres Mannes Günter, in dem das Paar mit seinem erwachsenen Enkel unter einem Dach lebt.

Günter Zech, der am Silvestertag 81 Jahre alt werden wird, ist in diesem Haus geboren. Er hat ein gelbes X darauf angebracht, ein öffentliches Bekenntnis, dass seine Bewohner bleiben wollen, wie zu hören ist. Nur zwei Häuser im Ort zeigen dieses X, obwohl es acht Höfe sein sollen, die nicht umsiedeln wollen. Zech schätzt die Zahl der Bleibewilligen, der Verunsicherten und Zögernden auf insgesamt 20. „Die Leute sind verängstigt“, sagt er. „Viele trauen sich nicht, die Goschen aufzumachen.“ Im Fall einer späteren Enteignung könnten sie ja schlechter wegkommen. Davor hat er keine Angst – „die wollen doch was von mir“. Kaum einer im Dorf, der nicht jemanden in der Familie hat, der bei der LEAG arbeitet oder gearbeitet hat.

Günter Zech war nie im Tagebau, er fuhr Lastwagen, schon zu DDR-Zeiten. Else Zech hat als Verkäuferin gearbeitet. „Wir haben alles ertragen“, sagt sie. „Dreißig Jahre Kohledreck. Damals konnte man keine Wäsche aufhängen.“ Denn damals führte die Kohleverladebahn noch direkt am Dorf vorbei. Schmutz und Lärm stellen heute kein Problem mehr da, sagen die beiden. Günter und Else Zech, er in blauer Arbeitshose, sie im türkisfarbenen Haushaltskittel, haben im Vorraum des Hauses Platz genommen. Ein Wintergarten ohne Grün, hinter ihnen der orange Heizkessel, auf dem Tisch lehnt eine gerahmte Luftaufnahme von Mühlrose.

Er: „Niemand hat uns gefragt: Und wer will bleiben? Man hat uns mundtot gemacht.“ Sie: „Wir sind nicht einmal zum Reden gekommen.“ Er: „Ich habe nichts dagegen, wenn die, die wegziehen wollen, wegziehen. Dann kommt endlich wieder Ruhe ins Dorf. Aber warum soll man das hier aufgeben?“ Sie: „Wir waren nicht einmal im Urlaub, wir haben alles ins Haus gesteckt. Jetzt sind wir über 80 und haben nie die Welt gesehen.“

Es gibt Fotos vom Mühlroser Gasthof „Zur Erholung“, der nur noch zu besonderen Gelegenheiten öffnet. Der 28. März 2019 war so ein Tag, der Vorstandsvorsitzende der LEAG war da, die Bürgermeister von Trebendorf und Schleife kamen, sogar Sachsens Ministerpräsident Michael Kretschmer von der CDU. Der Umsiedlungsvertrag für Mühlrose wurde unterzeichnet, der Energiekonzern kommt für die Neuansiedlung der Haushalte im Nachbarort Schleife auf, wo am Ortsrand ein Areal für etwa 40 Grundstücke der Neu-Mühlroser erschlossen wird. Auch Einzelumsiedlungen oder ein Umzug in Mietwohnungen werden finanziert, ebenso wie die Umsetzung von Kriegerdenkmal, Glockenturm und Friedhof.

„Wer wohin kommt, das ist alles schon geregelt“, erklärt Enrico Kliemann. Der 44-Jährige ist kommissarischer Ortsvorsteher von Mühlrose, das seit 1999 zur Gemeinde Trebendorf gehört, und er ist Mitglied im Beirat für die Umsiedlung. Kliemann hat einen Raum im Vereinshaus aufgeschlossen, an den Wänden Skizzen von Neu-Mühlrose. Die Bestandsaufnahmen seien fast abgeschlossen. „Wie man’s hat, kriegt man’s wieder.“ Aus Alt wird Neu. Aus einem historischen Dorf eine Neubausiedlung auf dem flachen Acker.

Wie erklärt sich Kliemann, dass von ihm geschätzte 90 Prozent aus Mühlrose wegwollen, wo noch nichts endgültig klar ist? Jahrelang sei nichts investiert worden, sagt Kliemann, nicht bei der Stromversorgung, nicht beim Abwasser, und auch das Internet stagniert bei 2G. Manche Häuser im Dorf hätten Risse wegen der Grundwasserabsenkung durch den Tagebau. „Und selbst wenn das Sonderfeld nicht mehr genehmigt wird, ist Mühlrose von drei Seiten umschlossen.“

Unsicherheit und Verzögerung hätten vielen zugesetzt, da Mühlrose vor ein paar Jahren schon einmal umgesiedelt werden sollte. Damals kam der bereits ausgehandelte Vertrag nicht zustande, weil der schwedische Energiekonzern Vattenfall aus dem Energiegeschäft in der Lausitz ausstieg. Die Mühlroser hatten lange Zeit, sich an den Gedanken eines Umzugs zu gewöhnen. Und mancher mag auch geglaubt haben, dass er materiell etwas hinzugewinnt. Oder sich um Altlasten nicht mehr kümmern muss. „Neue Chancen“, formuliert Kliemann neutral, „die sich woanders auftun.“

Dataja:Mühlrose Tagebau Nochten Kraftwerk Boxberg 2008-05-11.jpg

Waldemar Locke ist der Mann, der am 28. März seine Unterschrift unter den Umsiedlungsvertrag gesetzt hat. Schweren Herzens, das ist selbst am Telefon noch zu hören. Ein Treffen klappt nicht, der Bürgermeister von Trebendorf und Mühlrose, 57 Jahre alt, CDU-Mitglied und seit zwei Jahren im Amt, ist unter der Woche berufstätig. Bei der LEAG. „Es handelt sich um einen rein privatrechtlichen Vertrag“, erklärt er. „Wer umsiedeln will, kann umsiedeln. Wer bleiben will, kann bleiben.“ Fünf Parteien sollen den Vertrag bisher unterschrieben haben. Was passiert mit deren Häusern? Die, so hatte es Kliemann erklärt, sollen bald abgerissen werden. Das Dorf würde also in sich zusammenfallen. Ein Tod auf Raten.

Der Bürgermeister hat Verständnis dafür, dass die Älteren im Dorf nicht entwurzelt werden wollen. „Günter Zech spricht für sich“, sagt er anerkennend, „nicht für das ganze Dorf. Ich akzeptiere nicht, wenn man sagt: Alle wollen umsiedeln. Jeder soll für sich sprechen.“ Locke sagt, seine Unterschrift unter den Vertrag habe er gesetzt, damit die Umzugswilligen „ihre Ruhe haben“.

Qielle        :         TAZ         >>>>>         weiterlesen

————————————————————————

Grafikquellen           :

Unten         —          Blick auf den Tagebau Nochten vom Aussichtsturm bei Weißwasser.

Author Julian Nyča      /       Source       :  Own work
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
No Facebook.svg This file has been released under a license which is incompatible with Facebook’s licensing terms. It is not permitted to upload this file to Facebook.

——————————–

Unten     —        Mühlrose in Sachsen: Blick vom Schutzdamm über einen ausgekohlten Bereich des Tagebaus Nochten zum Kraftwerk Boxberg mit dem Neubaublock R (links), dem Werk 4 (900 MW), dem Werk 3 in der Mitte (2×500 MW) und dem still gelegten alten Kraftwerksteilen (rechts).

žórło Swójske dźěło
awtor René Mettke
Tuta dataja je pod licencu Creative Commons Attribution 3.0 Unported licencowana

Abgelegt unter Regierung, Sachsen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Rebellisch und sozialistisch

Erstellt von DL-Redaktion am 28. November 2019

Meine Vision der LINKEN 2020

Redler.jpg

Quelle      :    AKL

von Lucy Redler, Berlin

Lucy Redler ist aktiv im Kampf für mehr Personal im Krankenhaus und für die Enteignung von Deutsche Wohnen & Co, Mitglied des Parteivorstands, Bundessprecherin der AKL, aktiv im Bezirksverband DIE LINKE Neukölln und in der SAV.

Wer Visionen hat, sollte zum Arzt gehen, meinte Helmut Schmidt. Churchill wird das Zitat zugeschrieben, demzufolge jemand, der mit vierzig noch Sozialist*in sei, keinen Verstand habe. 2019 bin ich vierzig geworden, erfreue mich geistiger Gesundheit als Sozialistin und sehe darin einen guten Anlass, meine Vorstellungen im Rahmen der bundesweiten Strategiedebatte zu formulieren. Was kann DIE LINKE 2020 tun? Ein paar – unvollständige – Gedanken und Anregungen zur gemeinsamen Revolutionierung der Partei.

Januar

DIE LINKE startet mit einem gemeinsamen Neujahrsauftakt von Partei und Fraktion, bei dem Aktivist*innen von Aufständen aus Chile, Iran, Irak, Hongkong und Bolivien zu Wort kommen und mit ihnen eine internationale Strategie gegen Kapital und Repression diskutiert wird. Das eingesparte Geld für den Extra-Jahresauftakt der Fraktion wird den Bewegungen in diesen Ländern gespendet.
DIE LINKE beteiligt sich am Treffen der Initiative zur Vernetzung einer kämpferischen Gewerkschaftslinken am 25./26. Januar in Frankfurt/Main.

Februar

Die Landesverbände organisieren Ratschläge zum Mietendeckel und zur Enteignung von Vonovia und Co. DIE LINKE Hamburg und Bayern integrieren dies in bewegungsorientierte Wahlkämpfe. DIE LINKE Berlin startet eine große Aufklärungskampagne zum Mietendeckel und den Lügen der Immobilienkonzerne.
Beim politischen Aschermittwoch der LINKEN in Bayern steht die Maut-Korruption von Verkehrsminister Scheuer (CSU) im Zentrum. Die Redner*innen fordern Scheuers sofortigen Rücktritt und seine persönliche Haftung. Sie präsentieren die Eckpunkte einer grün-sozialistischen Verkehrspolitik und verbinden dies mit einer Kundgebung vor der CSU-Zentrale.
DIE LINKE bringt zur Strategiekonferenz 29.2./1.3. 400 Mitglieder der Basis zusammen und diskutiert über die politische, ökonomische und ökologische Krise, innerimperialistische Spannungen, neue Kriege, den Zulauf für die AfD, mögliche Angriffe im Rahmen einer nächsten Krise und die daraus abgeleiteten Aufgaben der LINKEN. Sie lädt Aktive aus Kliniken, Mieteninis, Klimabewegung,  antirassistischen Bündnissen, Frauen*kampftag und Gewerkschaften ein. Aus diesen Diskussionen leitet sie ab, welche Aufgaben der LINKEN, ihren Abgeordneten und dem Apparat zukommen. Sie bespricht, wie sie diese Kampagnen nutzt, um sozialistisches Bewusstsein in der Gesellschaft zu verankern. Konkretes Ergebnis der Konferenz ist, dass jeder Kreisverband die Kampagnen zu Wohnen und Pflege vor Ort umsetzt.
Ein weiteres zentrales Thema ist die Stärkung der innerparteiliche Demokratie und die Herstellung des Primats der Partei gegenüber der Fraktion.

März

DIE LINKE beteiligt sich an der Mobilisierung zum Frauen*streiktag. Sie erklärt, warum der Kampf für Frauen*rechte auch im Interesse von Männern aus der Arbeiter*innenklasse und warum der Antisexismus der LINKEN antikapitalistisch ist. DIE LINKE ist mit eigenen Lautsprecherwagen vor Ort und lässt Frauen aus Rojava, Betrieben, Gewerkschaften und sozialen Bewegungen zu Wort kommen.
Die Zeichen in der Autoindustrie und bei den Zulieferern stehen auf Stellenabbau und Werksschließung. DIE LINKE nimmt die Tarifrunde der Kolleg*innen in der Metall- und Elektroindustrie zum Anlass, um die Forderungen und Aktionen der Kolleg*innen zu unterstützen und offensiv die Konversion und Vergesellschaftung der Autoindustrie bei Erhalt aller Arbeitsplätze und geltenden Tarife zu fordern.

April

Bei der bundesweiten Kreisvorsitzenden- und Aktionskonferenz werden die Erfahrungen der Ratschläge zur Mietenpolitik in eine bundesweite Strategie gegossen. Unter Beteiligung von Beschäftigten in Krankenhaus und Altenheimen wird diskutiert, an welchem Punkt die ver.di-Entlastungskampagne steht, welche Erfahrungen mit den Deep Organizing- und Whole-Worker-Ansätzen gemacht wurden, welche politischen Vorschläge DIE LINKE unterbreitet und wie eine starke gewerkschaftliche Linke aufgebaut werden kann. Ein bundesweiter Pflegeratschlag wird für Oktober vorbereitet.
Die neuen Fraktionsvorsitzenden besuchen die politischen Gefangenen in Katalonien und der Türkei und beteiligen sich an mehrtägigen Kundgebungen vor den Gefängnissen und dem Flüchtlingslager Moria auf der griechischen Insel Lesbos.

Mai

DIE LINKE nutzt den Maifeiertag, um in einer Pressemitteilung anzukündigen, dass der Parteivorstand dem Parteitag vorschlägt, alle Abgeordnetengehälter auf ein Gehalt der mittleren Entgeltstufe im öffentlichen Dienst bzw. von Automobil-Facharbeiter*innen zu begrenzen. Dieser Vorschlag dominiert die politischen Debatten unter Kolleg*innen bei den DGB-Demos.
DIE LINKE beteiligt sich im Rahmen der Pflegekampagne mit Aktionen am Tag der Inklusion am 5. Mai und/oder dem Tag der Pflege am 12. Mai.
Die Bundestagsfraktion führt am 23. Mai, dem Tag des Grundgesetzes, eine Veranstaltung zu Artikel 15 durch und stellt die Vorschläge der LINKEN zur Enteignung von Vonovia und Co vor.

Juni

DIE LINKE mobilisiert an der Seite der Bündnisse für mehr Personal im Krankenhaus zu den Protesten gegen die Gesundheitsministerkonferenz und Spahns Politik in Berlin.
Der Bundesparteitag beschließt Eckpunkte für die Arbeit der Bundestagsfraktion: Alle Mandatsträger*innen erhalten neben der Erstattung ihrer sich aus dem Mandat ergebenden Extra-Ausgaben als Gehalt „nur noch“ einen durchschnittlichen Facharbeiter*innenlohn. Die darüber hinausgehenden Beträge werden an soziale Bewegungen, internationale Bündnispartner*innen und den Parteiaufbau gespendet.
Dazu folgt eine Plakatkampagne unter dem Motto: „DIE LINKE: Die einzige nicht käufliche Partei. Unsere Abgeordneten verdienen nicht mehr als ein durchschnittliches Arbeitnehmer*innen-Gehalt.” In Umfragen gewinnt DIE LINKE drei Prozentpunkte dazu.
Die neu gewählten Parteivorsitzenden kündigen an, 2021 nicht für den Bundestag zu kandidieren und schließen sich der Forderung von Trennung von Amt und Mandat für den neuen Parteivorstand an.
Der Parteitag diskutiert unter Ausschluss der Medien eine Bilanz der Arbeit der rot-rot-grünen Landesregierungen und beschließt Eckpunkte, zu denen die Arbeit zugespitzt fortgesetzt oder perspektivisch beendet werden soll. Dies wird durch Landesparteitage in den betreffenden Ländern konkretisiert. Die Eckpunkte sind u.a.: Die Weigerung, die Schuldenbremse umzusetzen, Ablehnung jeglicher Privatisierungen und Kürzungen, Rekommunalisierung privatisierter Betriebe der öffentlichen Daseinsvorsorge, Stopp aller Abschiebungen, Gesetze zur bedarfsgerechten landesweiten Personalbemessung im Krankenhaus, Gesetze zu Mietendeckel, Mietsenkung und Enteignung der Immobilienkonzerne, Einführung der 35-Stunden-Woche im Öffentlichen Dienst bei vollem Lohn und Personalausgleich, Einführung des Nulltarifs im ÖPNV, Auflösung der Landesämter für Verfassungsschutz.
Der Parteitag diskutiert über Programm und Strategie der Partei zum sozial-ökologischen Umbau der Wirtschaft, der Vergesellschaftung und Konversion der Autoindustrie und beschließt ein Tempolimit von 30/80/120, ein Konzept für den Nulltarif im Nahverkehr, eine Kampagne zur Enteignung der Klimakiller und entwirft eine Vision einer sozialistischen, ökologischen Demokratie. Der Parteitag erteilt dem Konzept einer CO2-Steuer eine Absage und richtet eine Arbeitsgruppe aus Kolleg*innen aus der Autoindustrie, linken Gewerkschafter*innen der IGM, Naturwissenschaftler*innen und Umweltverbänden ein, um über Alternativen zu Verbrennungsmotor und E-Auto zu diskutieren.
Die Beschlüsse bestimmen tagelang die öffentliche Debatte und Talkshows. Claus Wagner und Max Uthoff rufen öffentlich dazu auf, in DIE LINKE einzutreten

Juli

Im Juli startet die Tarifrunde TV-N (Nahverkehr). DIE LINKE unterstützt die Forderungen der Kolleg*innen und bringt die Forderung nach Nulltarif im ÖPNV prominent in die Debatte ein. Die Fraktionen bringen Anträge in ihren Landesparlamenten ein mit dem Ziel, Kommunen die Erhebung einer Nahverkehrsabgabe von Unternehmen zu ermöglichen. Die Partei beteiligt sich an lokalen Bündnissen für den Nulltarif und ruft die Mitglieder auf, sich an gemeinsamen Schwarzfahr-Aktionen zu beteiligen (massenhaft in Wellen, vernetzt über Social Media). Für den Fernverkehr schlägt DIE LINKE vor: Die BahnCard 100 soll es nicht nur für Bundestagsabgeordnete, sondern kostengünstig für alle geben. Statt den Kauf eines E-Autos durch Bund und Hersteller mit 4000 Euro zu subventionieren, wird dieses Geld für eine kostengünstige BahnCard 100 bereitgestellt.

August

Eine Senatorin der LINKEN geht für einen Monat ins Gefängnis, weil sie einen Abschiebeflug blockiert hat.

September

Zum Start der Tarifrunde Bund und Kommunen ist jeder Kreisverband aktiv beim Warnstreik dabei. Die BAG Betrieb und Gewerkschaft gibt eine Zeitung für Kolleg*innen von Kolleg*innen im Streik heraus. DIE LINKE NRW verbindet ihren Kommunalwahlkampf mit der Auseinandersetzung.

Zum 20. Jahrestag des ersten Mordes des NSU an Enver Simsek unterstützt DIE LINKE antirassistische Initiativen, Organisationen von Migrant*innen und Gewerkschaften dabei, einen öffentlichen und demokratischen Untersuchungsausschuss einzurichten, um die bis dato nicht erfolgte Aufklärung zu erzwingen. Als erste Zeugen werden der ehemalige hessische Innenminister Bouffier, alle Spitzenbeamten des hessischen Verfassungsschutzes und Andreas Temme vorgeladen. Die Verhandlungen werden live gestreamt.

Oktober

Fraktion und Partei führen einen bundesweiten Ratschlag mit dreihundert Kolleg*innen aus Krankenhäusern, Altenheimen und häuslicher Assistenzpflege zur Pflegekampagne durch. Die Ergebnisse des Ratschlags werden in allen Landes- und Kreisverbänden in Bezug auf ihre konkrete Umsetzung diskutiert.

November

Der Bundesausschuss beschließt Kriterien zur Aufstellung der Landeslisten zur Bundestagswahl. Neben der Frauenquote wird als Vorschlag an die Vertreter*innenversammlung 2021 eine Lohnabhängigen-Quote beschlossen, um in der  Fraktion die eigene Klasse stärker abzubilden.

Dezember

DIE LINKE verteilt Wiederaneignungs-Adventskalender: Hinter jedem Türchen wird ein konkretes Projekt der Wiederaneignung von Zeit, Würde, Rechten und Eigentum der Arbeiter*innen und ihrer Familien präsentiert.
Zusammen mit unabhängigen linken Medienschaffenden startet DIE LINKE einen Youtube-Nachrichten-Kanal, der zunächst wöchentlich und später täglich über soziale Kämpfe im In- und Ausland berichtet.

Feedback erwünscht: Ihr seid der Meinung, dass sei alles zu viel auf einmal? Es geht in meinem Vorschlag weniger darum, all dies genau so umzusetzen, sondern um eine Vision, was die Partei mit einer anderen Strategie erreichen könnte. Wie sähe die Arbeit einer Partei aus, für die der Kampf für eine sozialistische Gesellschaft ein in täglichen Kämpfen verankertes Ziel ist und nicht nur ein papiernes Bekenntnis?
Anregungen, Ideen und Kritik an: lucy.redler@die-linke.de

akl - Antikapitalistische Linke

———————————————————————–

Grafikquelle          :        Lucy Redler, * 17. awgusta 1979, Hann. Münden

CC BY-SA 2.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms

  • File:Redler.jpg
  • Created: ‎24‎ ‎March‎ ‎2007

Abgelegt unter Berlin, P. DIE LINKE, Sozialpolitik, Überregional | Keine Kommentare »

Stadtgespräch aus München

Erstellt von DL-Redaktion am 28. November 2019

Mir san Sommer –
Änderung des Ferienbeginns in Bayern

Fitxer:Starnberger See mit Steg und Alpenblick.jpg

Von Ambros Waibel

Früher in die Ferien? Markus Söder will die Ferienzeiten bewahren. Das ist identitätspolitisch clever, preußisches Rumgenöle wirkt da eher kontraproduktiv.

„Das bayerische Abitur bleibt bayerisch“, hat Bayerns Ministerpräsident Söder den Ausstieg Bayerns und Baden-Württembergs aus dem geplanten nationalen Bildungsrat kommentiert – „übrigens genauso, wie die Ferienzeiten bleiben, wir wollen auch die nicht angleichen.“

Das sind gleich zwei inhaltliche Nullaussagen. Denn dass ein bayerisches Abitur einen im Leben irgendwie weiter brächte als ein beliebiges anderes, ist genauso Unsinn – ich kann hier mitreden – wie das trotzige Bestehen auf dem späten Sommerferientermin in Zeiten des Klimawandels; der ja insbesondere den Juli auch in Nürnberg oder in München zu einem Monat macht, in dem sinnvoller Unterricht in den zumeist nicht klimatisierten Lehranstalten kaum mehr möglich ist.

Politisch, also identitätspolitisch hingegen sind beide Aussagen wirkmächtig. Ich brauchte mindestens zehn Jahre, um mich daran zu gewöhnen, dass die Sommerferien in nördlichen Gefilden nicht mehr oder weniger am 1. August beginnen und am 15. September enden. Es erschien mir grausam, ein Kind, wie in diesem Jahr in Berlin, am 5. August nicht in die Sonne, sondern in die Schule zu schicken.

Logisch lässt sich das nicht begründen. Dem Kind ist es auch wurscht. Pfingstferien, die als Argument für den späten süddeutschen Sommerferienbeginn inzwischen vorgeschoben werden, sind etwas sehr Schönes – insbesondere weil da oft noch Vorsaisonpreise gelten und keine Preußen am Gardasee rumhängen. Aber auch sie taugen letztlich nicht zur Rechtfertigung der bajuwarischen Reservat­rechte. Und wer im Sommer und damit eben auch im September schlicht kein Geld übrig hat, um in den Süden zu fahren, der kann in Bayern die letzten beiden Ferienwochen oft genug damit verbringen, in einen zähen Landregen zu schauen.

Das ganze folkloristische Repertoire

Nehmen wir mal eine andere Perspektive ein. In seinem leider nicht auf Deutsch vorliegenden Reisebuch „La leggenda dei monti naviganti“ (etwa „Die Legende der reisenden Berge“, 2007) erkundet der italienische Journalist Paolo Rumiz die Alpen und macht dabei auch einen Abstecher nach München.

Veitshöchheim Haus der Fastnacht 06.jpg

Seine Gesprächspartner klären ihn darüber auf, dass die CSU in Bayern für immer regieren werde, weil letztlich niemand ein anderes Bayern wolle, auch die CSU-Gegner nicht. Die Gleichsetzung von Staat, Partei und Heimat überlebt jeden CSU-Skandal und konnte bislang nur von der CSU selbst beziehungsweise von noch rechteren Gruppierungen – mit noch mehr „Mir san mir“ – herausgefordert werden: wie aktuell von den „Freien Wählern“.

Quelle             :         TAZ       >>>>>         weiterlesen

——————————————————————-

Grafikquellen        :

Oben          —            Starnberger See: Steg mit Ausflüglern und Alpenblick von Starnberg aus

Font Treball propi
Autor MAx59

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

———————————-

Unten         —         Veitshöchheim, Haus der Fränkischen Fastnacht, Fassadenmalerei (2015) mit Motiven aus der Fernsehsendung „Fastnacht in Franken“: Links im Gefängnis Markus Söder, der sich 2014 für die Fernsehsitzung als Shrek verkleidet hatte.

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 Deutschland“ lizenziert.

Abgelegt unter Bayern, Kommunalpolitik, P.CDU / CSU, Überregional | Keine Kommentare »

Debatte der LINKEN 2020

Erstellt von DL-Redaktion am 27. November 2019

ÖKO-SOZIALIMUS ALS PROGRAMM

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Wo bleibt das Personal hierfür ?

Quelle      :       AKL

Von Thies Gleiss.

POLITIK IN DER ERSTEN PERSON ALS STRATEGIE – MITGLIEDER-AKTIVEN-PARTEI ALS FORM.

Gegensätze können aufbauen und vorantreiben, aber auch verwirren. Es liegt ein wenig an uns selber, was letztlich herauskommt:

Dreizehn Jahre die Partei DIE LINKE, 63.000 Mitglieder und beharrlich knapp 10 Prozent bundesweite Unterstützung bei Wahlen ist doch eher etwas zu feiern. Die kapitalistische Gesellschaft in Deutschland ist uns trotz aller Bemühungen nicht losgeworden und auch trotz vieler Leute in den eigenen Reihen, die in dieser kapitalistischen Gesellschaft lieber an- als von ihr wegkommen wollen – und dennoch kommt das Gefühl auf, es geht nicht weiter, sondern eher zurück. Was läuft da schief im Selbstverständnis der LINKEN?

Die größten Demonstrationen der gesellschaftlichen Opposition seit dem zweiten Weltkrieg: Millionen folgen einem Aufruf von Kindern und Jugendlichen, an einem normalen Arbeitstag in der Woche, kurzerhand zu streiken, um die Herrschenden ein wenig in Panik geraten zu lassen, ob deren Unfähigkeit, die Klimakatastrophe zu verhindern. Und selbst wenn es manchmal nur ein paar Minuten, ein Gespräch in der Kantine waren, so bleiben es doch eine Mut machende Verweigerung, die selbst den notorisch konservativen Bürokraten in deutschen Gewerkschaften Feuer unterm Hintern bereitet.
Hunderttausende gehen für unteilbare Solidarität, Menschenrechte und humanen Umgang mit Geflüchteten auf die Straße und widersetzen sich dem gnadenlosen Funktionieren des deutschen und des EU-Staates.
Ja, auch wenn es Leute in den eigenen Reihen, und bei den Rechten sowieso, anders behaupten: Der Staat hat in der Geflüchtetenfrage nicht versagt, sondern fast immer eher zu gut funktioniert. Die EU-Maschinerie mordet am Mittelmeer und in der Sahara.
Zehntausende stellen sich Woche für Woche dem rechten Spuk von AfD und anderen faschistischen und halbfaschistischen Kräften entgegen.
Hunderttausende protestieren gegen Freihandelsverträge und den neoliberalen Anspruch, sich die ganze Welt untertan zu machen. Sie stellen die Legitimation der kapitalistischen Herrschaft in Frage – auch wenn es noch keine linken, sozialistischen Alternativen sind, die dem entgegengehalten werden. In zahlreichen Ländern auf allen Kontinenten erhebt sich gleichzeitig die Bevölkerung, weil die brutale Umsetzung des kapitalistischen Anspruchs, die Welt zu beherrschen, zu schlimmen Verschlechterungen des täglichen Lebens führt: In Frankreich die Proteste der Gelbwesten; im Iran, im Irak, in Chile, in Ecuador, in Kolumbien, im Sudan, im Libanon und vielen Ländern mehr.
Tausende gehen in allen großen Städten Deutschlands gegen die hohen Mieten und die Macht der Immobilienkonzerne auf die Straße. Sie stellen in einer Weise die Eigentumsfrage, einschließlich der Forderung nach Wiederaneignung der Häuser und Enteignung der Konzerne, wie es tausende von klugen Bücherschreiber*innen und hunderte von parlamentarischen Expert*innen mit ihren Eingaben nicht geschafft haben oder sich gar nicht erst trauen.
Hunderttausende sind heute bereit, für betriebliche und gewerkschaftliche Forderungen zu streiken. Die leider so gesichts- und geschichtslose Zahl der durch Streiks verlorenen Arbeitstage steigt auch in Deutschland wieder – dem Land, wo Streiks eigentlich nur noch in den Erzählungen der Groß- und Urgroßeltern vorkamen. Es tauchen dabei qualitative Forderungen auf – neue Formen der Arbeitszeitverkürzung, Mindestpersonalbesetzung, generelle Aufwertung von Berufen – die seit 1985 nicht mehr in so radikaler Weise die gewerkschaftlichen Kämpfe prägten. Die Idee eines Frauenstreiks, der in Spanien und der Schweiz wieder zu den herausragenden Ereignissen des Jahres zählte, findet auch in Deutschland neuen Zulauf.
Zehntausende gehen für mehr Bürgerrechte, gegen neue Polizeigesetze, gegen Überwachung und Datenmissbrauch auf die Straße. Sie demonstrieren für gesunde Nahrungsmittel und gegen Tierversuche.
Und selbst ein enger Blick auf die politisch radikalen und erklärtermaßen sozialistischen oder antikapitalistischen Mobilisierungen der Linken zeigt: Es kommen so viele wie lange nicht mehr.
Allein die klassische „Friedensbewegung“ hat sich nach den Jahren des Untergangs der bipolaren Weltordnung und dem daraus folgenden Verlust an strategischer Perspektive noch nicht wieder erholt. Leider. Denn die Bedrohungen durch Kriege – schmutzige und konventionelle, staatliche und bandenmäßige – durch diktatorische Regimes, die allesamt durch ökonomische und militärische Alimentierung der imperialistischen Großmächte am Leben gehalten werden, und durch neue Aufrüstungsorgien mit Massenvernichtungswaffen, von denen jede einzelne die Welt auslöschen kann, nehmen nach wenigen Jahren ganz leichter Entspannung wieder massiv zu.

Und trotz alledem versinkt die LINKE eher in Selbstmitleid. Sie scheint vor dem Vormarsch
der Rechten zu kapitulieren und sieht nur noch den „Rechtsruck“. Die nicht wenigen Kräfte in der LINKEN, die von einer friedlichen Gemeinschaft der Klassenzusammenarbeit träumen, die in sozialdemokratischer Weise „Versöhnen“ wollen, wo Unversöhnlichkeit auf der Tagesordnung steht, sind ratlos und verfallen fast in Esoterik, wenn sie immer wieder rufen „Rot-Rot-Grün!“, um ein schnödes Bündnis mit den in den Kapitalismus vernarrten GRÜNEN und der SPD zu fordern.
Tausende von parlamentarisch tätigen LINKEN oder solchen Mitgliedern zuarbeitende Genoss*innen rufen verzweifelt „LINKS wirkt“, ohne zu sehen, dass 13 Monate außerparlamentarische Bewegung „Fridays for Future“ und deren Begleitkommandos zigfach mehr wirken als 13 Jahre LINKE in den Parlamenten. Das Verhältnis zwischen außerparlamentarischer und parlamentarischer Arbeit der LINKEN ist in schwerer Schieflage, und deshalb sind es auch die Perspektiven und Erwartungen der LINKEN, wie es weiter gehen könnte.

Die Stellvertreter*innenpolitik beenden.

Um der gesellschaftlichen Situation ein wenig gerechter zu werden, ist die wichtigste Aufgabe einer linken Partei, diese oben umrissenen realen gesellschaftlichen Konflikte und Bewegungen politisch zusammenzuführen. Dazu ist es selbstverständlich erforderlich, dass die LINKE praktisch Teil dieser Kämpfe wird, dass sich jedes einzelne Mitglied daran beteiligt. Das ist längst nicht der Fall. Im Gegenteil sieht die Wirklichkeit heute so aus: Der Großteil der Mitglieder bleibt diesen realen Bewegungen und Kämpfen fern und sieht sie entsprechend nur im Fernsehen oder auf dem Handy. Viele der in der Parlamentsarbeit verstrickten Genoss*innen haben schon aus Zeitgründen, aber teilweise auch als Selbstverständnis, nur die Absicht, kurz aufzukreuzen, ein Bild mit sich und den Aktiven für die Homepage zu knipsen und dann zur nächsten Sitzung abzurauschen. Ein solches Verhalten wird zurecht „Elend der Stellvertreter*innenpolitik“ genannt. Das muss ein Ende haben. Wenn sich die LINKE nicht vorrangig als aktive Bewegungspartei versteht und weiterhin so viel Energie, Personal, Ressourcen und Zeit in parlamentarische Spielerei (oder sogar in die Erledigung der Regierungsgeschäfte des Kapitals) steckt, dann wird das alles nichts mehr.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Aber die organische und dauerhafte Mitarbeit in realen außerparlamentarischen Bewegungen durch die Mitglieder ist nur die erste Hälfte.
Die andere besteht in der politischen Zusammenführung all dieser Bewegungen und Widerstände. Der Kapitalismus lebt davon, als engmaschig vernetztes System all seinen Gegner*innen Angst und Zurückhaltung dadurch einzujagen, dass er ihnen einbläut, alles hängt mit allem zusammen; wenn du nicht das ganze System änderst, dann bleibst du ohnmächtig. So richtig die Systemfrage ist, so falsch ist die Schlussfolgerung, dann machen wir eben nur die Politik der kleinen Schritte und Teilerfolge, alles andere blenden wir aus (oder, wenn wir Spitzenfunktionär*in sind: Reden nur noch in den Sonntagsreden davon). Die richtige Schlussfolgerung ist, in den täglichen Auseinandersetzungen die Systemfrage zu entdecken und zu stellen; dem System des Kapitalismus das eigene, alternative System entgegenzustellen. Für die LINKE ist diese Alternative tausendfach aufgeschrieben worden: Sie heißt Sozialismus, das heißt eine Gesellschaft ohne Privateigentum an Produktionsmitteln; ohne Lohn- und andere Zwangsarbeit und Ausbeutung des Menschen durch den Menschen; mit umfänglichen Freiheitsrechten, umfänglicher als jede kapitalistische Gesellschaft zuvor, ohne Diskriminierung und mit gleichen Rechten für alle; eine Gesellschaft ohne Krieg und industrielle Gewalt und Gewaltmittel.
Die großen Jahrhundertthemen „Soziale Gerechtigkeit“ und „Frieden und Gewaltlosigkeit“ hat der Sozialismus ziemlich überzeugend und wissenschaftlich mit seiner Strategie der Überwindung des Kapitalismus als weltweite Produktionsweise beantwortet. Schon lange.
Dennoch scheut sich die LINKE fast pathologisch, eine fröhlich-empathische, freche und selbstbewusste Partei für den Sozialismus zu werden. In dreizehn Jahren gab es gerademal ein Plakat mit dem Ruf nach Sozialismus – und das dieses Jahr ausgerechnet in Sachsen, wo die LINKE ein gutes Jahrzehnt lang alles gemacht hat, sich vor den großen Fragen und den sozialistischen Lösungsvorschlägen zu drücken, um bürgerliche Regierung in Wartestellung zu spielen. Da konnte so ein Plakat nur als missglückte Selbstironie verstanden werden.
Viele meinen, diese Zurückhaltung läge daran, dass der Sozialismus nach Stalin, DDR und alldem ein schlechtes, ein Loser-Image hat. Das ist richtig, das liegt aber nicht am Sozialismus, sondern eben an Stalin, DDR und alldem. Aber das lässt sich doch konkret erläutern und diskutieren – wenn mensch will. Und wichtiger noch: Das schlechte Image des Sozialismus bestimmt schon lange nicht mehr so sehr das Bewusstsein der Vielen, wie es das taktische Verhalten, das Zaudern und Verzweifeln der linken Funktionäre von heute noch prägt. Alles hausgemachtes Elend also: Die Stellvertreter*innenpolitik und die Angst vor dem Sozialismus.

Trotzdem reicht der Sozialismus heute nicht aus, um all die widerständigen Bewegungen gegen den Kapitalismus politisch zusammenzufassen. Es ist ein neues Jahrhundertthema dazugekommen, dessen zerstörerisches Potenzial ähnlich groß ist wie das von Krieg oder das von ökonomischer Ausbeutung und Ungleichheit: Die Zerstörung der Biosphäre – Klima, Boden, Luft, Wasser, Artenvielfalt – durch die normale kapitalistische Produktion. Der Zwang zum Wachstum der Profite, die Konkurrenz und die unaufhaltsame Tendenz des Kapitalismus, vorgefundene natürliche, historische, kulturelle Zusammenhänge zu parzellieren und sie unter dem Diktat des Privateigentums neu zu zentralisieren und zu konzentrieren, wobei alle nicht für den Profit verwertbaren Dinge externalisiert werden – all das ist der kapitalistischen Produktionsweise innewohnend und kann nicht wegverhandelt werden. Auch nicht mit einem grünen New Deal. Was früher nur vereinzelt thematisiert wurde, haben die letzten fünfzig Jahre weltweit offenbart: Der Kapitalismus tötet, vertreibt, erzeugt Ungleichheiten und schafft neue Kriegsgründe auch durch die Zerstörung der Biosphäre. Sieben und mehr Milliarden Menschen auf der Welt sind in jeder Produktionsweise die größte Bedrohung für einen Erhalt der Biosphäre. Unter kapitalistischen Bedingungen ist diese Bedrohung aber halt- und grenzenlos. Und immer gilt: Die von sozialer Ungleichheit und Ausbeutung Betroffenen sind auch die ersten und zahlreichsten Opfer vom Krieg und von der Zerstörung der Biosphäre.

Wenn Marx, Engels und ihre Zeitgenoss*innen mit bis heute gültiger wissenschaftlicher Genauigkeit analysiert haben, wie die soziale Ungleichheit und Ausbeutung im Kapitalismus funktionieren und als organisatorisch-politische Antwort die Bildung einer sozialistischen oder kommunistischen Internationale in Angriff genommen haben; wenn Lenin, Luxemburg und ihre Zeitgenoss*innen den furchtbaren Ersten Weltkrieg und Kriege allgemein als systemisches und bis heute gültiges Ergebnis des Kapitalismus analysierten und eine Neubegründung der kommunistischen Internationale als Friedensinternationale forderten und organisierten; so können wir heute die Klimakatastrophe und die Zerstörung der Biosphäre als systemisches Ergebnis des Kapitalismus analysieren und die Basis für eine weitere neue Begründung der sozialistischen oder kommunistischen Internationale liefern. Nach Sozialismus und Kommunismus bietet sich auch dafür ein neuer Begriff an, um die neue Qualität des zerstörerischen Potenzials des Kapitalismus und die Notwendigkeit einer weltweiten koordinierten Antwort der Arbeiter*innenklasse zu demonstrieren. Der Begriff Ökosozialismus ist dafür ein guter Vorschlag. Mit diesem Begriff müssen die politischen Debatten und strategischen Ausrichtungen in den sozialen Bewegungen vorangetrieben werden.

Bewegungspartei – bewegte Partei, aber richtig

Wenn die LINKE oder ihre Landes- und Kreisverbände eine Kampagne zur Mitgliederentwicklung machen, dann heißt die zentrale Parole stets: „Komm zu uns, wir brauchen dich“. Das ist die Ansprache einer auf Wahlkämpfe und Parlamentsarbeit fixierten Partei, die ihre Mitgliedschaft nur als Kulisse für Parlaments- und -Sonntagsreden benötigt, und als Verteiler*innen für bunte Hochglanzbroschüren, die in einer imaginierten Konkurrenzschlacht zu anderen papierproduzierenden Parlamentsparteien erzeugt werden. Diese Ansprache ist im besten Fall moralisch und immer nicht links.
Der umgekehrte Anspruch kommt einer linken Politik schon viel näher: „Komm zu uns, du brauchst die linke Partei“. Es ist die große Aufgabe linker Politik diese Realität jeden Tag zu begründen und zu belegen – in der Praxis. Jedem einzelnen der 63.000 Mitglieder muss die Partei als nützliches Instrument in seinem oder ihrem eigenen Umfeld und den daraus abgeleiteten Interessen und Erwartungen vermittelt werden.
Das ist „Politik in der ersten Person“. Die LINKE hat – wie es schon im Kommunistischen Manifest heißt – keine besonderen Interessen gegenüber den Vielen. Sie organisiert deren Interessen und bereitet Widerständigkeit und Kämpfe darum vor. Deshalb muss sich die LINKE nicht in „Mittwochskreisen“ (oder wie immer sie heißen) zur Unterstützung der parlamentarischen Arbeit und Fraktionen organisieren, sondern dort, wo die Menschen leben und arbeiten: Im Stadtteil, in Betrieben, Schulen und Universitäten. Die gesamte Politik einschließlich der parlamentarischen Initiativen und der bunten Flyer müssen eng an diesen lokalen Notwendigkeiten ausgerichtet werden. Deshalb liegt der Schwerpunkt der politischen Arbeit der LINKEN in der Kommune – nicht wegen der Bedeutung irgendwelcher Räte und Gremien der parlamentarischen Scheindemokratie auf kommunaler Ebene.

Der bürgerliche Parlamentarismus ist nicht das letzte Wort einer demokratischen Beteiligung der Vielen. Er ist sogar in vielfacher Hinsicht eine Scheindemokratie und bewusste Desorientierung der Menschen bei der Vertretung ihrer Belange. Die das tägliche Leben der Menschen bestimmenden Dinge und die kollektive Wahrnehmung ihrer Interessen kommen im Parlament nicht oder nur sehr verzerrt zum Ausdruck. Direkte Demokratie und demokratische Selbstverwaltung, dort wo die Menschen leben und arbeiten, ist eine bessere Variante. Die in der Geschichte als sozialistische Rätedemokratie bekannte Form der Selbstverwaltung sollte auch für die LINKE Richtschnur sein.

Dennoch ist es notwendig und sinnvoll, sich an den Parlamentswahlen zu beteiligen. Linke Strömungen, die das verneinten, haben große Chancen verpasst und waren zurecht nicht dauerhaft erfolgreich. Aber Vorrang müssen die Mitgliederstrukturen und deren Weiterentwicklung haben. Dort – vor allem auf kommunaler Ebene – wo die LINKE keine oder zu wenig Mitglieder hat, sollte auch nicht zu Parlamenten oder Stadträten kandidiert werden. Denn es gilt fast ausnahmslos: Mit Wahlkämpfen und parlamentarischen Erfolgen wird keine linke, antikapitalistische Kraft aufgebaut. Es können im besten Fall, die zuvor erreichten Erfolge durch Wahlkämpfe und Parlamentsarbeit gefestigt werden.

Deshalb muss die LINKE ihre wachsende und unkontrollierte Verstrickung in die Parlamentsarbeit begrenzen. Wer zehn oder mehr Jahre hauptberuflich im Parlament arbeitet, der oder die wird ein anderer Mensch als zuvor. Die politische Wahrnehmung ist eine komplett andere, die Eigeninteressen zum Erhalt dieser privilegierten Stellung nehmen immer mehr zu. Alle materiellen Privilegien von Abgeordneten müssen transparent sein und strikt auf das Niveau begrenzt werden, was auch die normalen Mitglieder haben.
Die LINKE sollte alle parlamentarischen Ämter zeitlich auf maximal zwei Legislaturperioden begrenzen, politisch gesünder wären sogar vier oder fünf Jahre von nur einer Legislaturperiode, was Regelfall sein sollte.
In der LINKEN dominieren die Mandatsträger und die Mitarbeiter*innen in den Apparaten von Fraktionen und Partei heute immer mehr die Kreisvorstände, Landesvorstände, die bundesweiten Leitungsgremien und die Delegierten zu Parteitagen. Damit muss Schluss sein. Die sich jeden Tag ehrenamtlich und in den Parteistrukturen einbringenden Mitglieder müssen die entscheidenden Kräfte in der Partei sein. Um ihre Interessen und nur um ihre muss es gehen. Eine harte Trennung von Amt und Mandat sollte für die LINKE eine Selbstverständlichkeit werden.
Ein großes Problem – gerade auf lokaler und Landesebene – ist in der LINKEN auch ein weiteres Grundübel, was zu Anpassung, Erstarrung und Bürokratisierung schon vieler linker Parteien geführt hat: Die Ämterhäufung. Auch die muss strikt begrenzt und politisch in der Erziehung der Mitglieder geächtet werden.

Die LINKE hat durchaus eine gute Zukunft auch im zweiten Jahrzehnt des 21. Jahrhunderts. Aber es muss dafür einiges getan und einiges korrigiert werden. Wann? Jetzt!

akl - Antikapitalistische Linke

—————————————————————

Grafikquelle           :

Obern          —           Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom

Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg
  • Created: 2014-05-10 13:18:56

————————-

 

Unten          —      Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Berlin, Bundestag, Opposition, P. DIE LINKE | Keine Kommentare »

Landtagswahl in Thüringen

Erstellt von DL-Redaktion am 27. November 2019

Fast eitel Sonnenschein

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Aus Erfut Michael Bartsch

So könnte eine Minderheitsregierung klappen: In der ersten Sitzung nimmt der Thüringer Landtag seine Arbeit auf – und hält gegen rechts zusammen.

Warum sollen in Thüringen nicht Regierungsmodelle jenseits klassischer Koalitionsmehrheiten möglich sein? Die konstituierende Sitzung des Landtags vier Wochen nach der Wahl jedenfalls war nicht von Konfrontationen geprägt. Die Linke Birgit Keller wurde im ersten Wahlgang zur neuen Landtagspräsidentin gewählt.

Sie erhielt zehn Stimmen mehr, als von der bisherigen rot-rot-grünen Koalition zu erwarten waren, mit hoher Wahrscheinlichkeit aus der CDU. Gegen die Änderung der Geschäftsordnung, die künftig jeder der sechs Fraktionen einen Vizepräsidenten zubilligt, stimmte nur die AfD.

Seit jeher geht es im Thüringer Landtag freundlicher und verbindlicher zu als beispielsweise in Sachsen. Angesichts der uneindeutigen Mehrheitsverhältnisse mag die Überlegung mitschwingen, dass man womöglich aufeinander angewiesen sein könnte. Alterspräsident Karlheinz Frosch von der AfD eröffnete mit dem hehren Appell, bei Meinungsverschiedenheiten „fair, sachlich und vorwurfsfrei“ miteinander umzugehen. Auch AfD-Landeschef Björn Höcke, der im Moment ohnehin Kreide gefressen hat, redete länger auf Birgit Keller ein.

Die ging über die üblichen Antrittsformeln einer Präsidentin des gesamten Landtages hinaus, als sie an den Herbst 1989 und ihre eigene Rolle als hauptamtliche Funktionärin der FDJ und der SED in der DDR erinnerte. Fast auf den Tag genau vor 30 Jahren war der Aufruf „Für unser Land“ veröffentlicht worden, der auf einen demokratischen Sozialismus zielte. Sie habe sich 1990 dennoch nicht für einen Rückzug ins Private, sondern für das Engagement entschieden, sagte die bisherige Infrastrukturministerin. „Und ich habe mich nie der Verantwortung entzogen, SED-Unrecht klar zu benennen.“

Streit um die Vizepräsident*innen

Den einzigen Dissens trug die AfD als zweitstärkste Fraktion in die Eröffnungssitzung. Der parlamentarische Geschäftsführer Stefan Möller lehnte die Erweiterung des Landtagspräsidiums auf fünf Vizepräsidenten ab. Darauf hatten sich alle anderen Fraktionen verständigt. Das Argument der Chancengleichheit für alle Fraktionen sei nur vorgeschoben, wenn zugleich die Weigerung angekündigt werde, einen AfD-Vizepräsidenten zu wählen.

Quelle           :            TAZ             >>>>>              weiterlesen

Neue Landtagspräsidentin in Thüringen

Gesellschaftliche Brückenbauerin

Birgit Keller by Stepro 01.JPG

Ein Portrait von Michael Bartsch

In Erfurt wurde am Dienstag zum bundesweit ersten Mal eine Linken-Politikerin zur Landtagspräsidentin gewählt. Wer ist Birgit Keller?

In Thüringen übernimmt die Linke einen weiteren Erbhof der CDU. Auf der konstituierenden Sitzung des am 27. Oktober neu gewählten Landtages hat die bisherige Infrastruktur- und Landwirtschaftsministerin Birgit Keller das Amt der Landtagspräsidentin von Birgit Diezel (CDU) übernommen. Das Vorschlagsrecht steht nach der bisherigen Geschäftsordnung des Thüringer Landtags der stärksten Fraktion zu, und das ist seit der Wahl mit deutlichem Vorsprung die Linke. Keller wurde nun am Dienstag mit 52 Ja-Stimmen gewählt. Das sind sechs mehr als nötig gewesen wären.

Die 60-Jährige ist die erste von der Linken gestellte Landtagspräsidentin in Deutschland. Das passt Politikern wie dem Thüringer FDP-Chef Thomas Kemmerich nicht, der an alten Feindbildern festhält und die Entwicklung der gewendeten PDS seit 1989 ignoriert. Er hatte angekündigt, seine kleine FDP-Fraktion werde sich bei der Wahl der Stimme enthalten.

Denn die gelernte Elektromonteurin Birgit Keller trat bereits 1977 als 18-Jährige der SED bei und stieg über die Jugendorganisation FDJ bis zur Mitarbeiterin der SED-Kreisleitung in Nordhausen auf. Zu allem Überfluss erwarb sie über ein Fernstudium 1988 noch ein Diplom als Gesellschaftswissenschaftlerin.

Quelle         :         TAZ         >>>>>           weiterlesen

———————————————————–

Grafikquellen        :

Oben       —          Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —       Birgit Keller

Abgelegt unter L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 26. November 2019

Von Kreuzberg über Mölln zur Nordsee

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ebru Taşdemir

Wenn ich mal rauskomme aus meinem Kreuzberger Dorf und unterwegs bin in Deutschland, denke ich oft den Satz „Ach nee, sieh an, auch das ist Deutschland“. Vor allem geschieht das, wenn ich in Gegenden bin, wo ich a) ziemlich voreingenommen hinfahre (Sachsen, Brandenburg, you name it) und überrascht bin, doch wenigstens eine coole oder zumindest freundliche Person dort zu treffen, oder b) wenn ich in Gegenden fahre, die in solch einem krassen Gegensatz zu dem stehen, was ich aus meinem Berliner Alltag kenne.

In der vergangenen Woche war ich zum ersten Mal an der Nordsee. Auf einer der größten Nordseeinseln, auf Norderney, um genau zu sein – rein beruflich. Gibt Schlimmeres, würden die Norddeutschen einen Arbeitstermin auf Norderney kommentieren, während man sich bei uns in Berlin schon mega rufend und jubelnd in die nächste Düne werfen würde. Nicht wundern also, in dieser Woche gibt es fast nur Nachrichten von der Insel.

An meinem Anreisetag bekomme ich noch über Twitter mit, dass Idil Baydar die Möllner Rede im Exil doch in Frankfurt gehalten hat, trotz konkreter Morddrohungen. Das Stresspotenzial, dass im Vorfeld durch solch eine Morddrohung aufgebaut wurde, hat die Kabarettistin durch eine enorme Entschlossenheit, diese Rede zu halten, abgebaut. Die Möllner Rede im Exil wird seit dem rechtsradikalen Brandanschlag in Mölln 1992 von Freunden und der Familie Arslan organisiert. Ayşe, Yeliz und Großmutter Bahide Arslan starben in den Flammen, viele der Familienmitglieder überlebten schwer verletzt, so wie Ibrahim Arslan. Anlässlich des Gedenkens erinnerte die Stadt Mölln jedes Jahr an den Mord, doch ab Jahr vier nach Mölln fand man es besser, nicht mehr die Familie entscheiden zu lassen, wer diese Rede hält. Die Möllner Rede wird seitdem im Exil gehalten, in diesem Jahr eben in Frankfurt, Idil Baydar sollte sie halten. Das die Comedienne Baydar schon mehrere Morddrohungen in diesem Jahr erhalten hat, macht diese Rede umso aktueller. Nun wurde sie also unter Polizeischutz gehalten. Seltsamerweise war das 1. Frankfurter Polizeirevier damit beauftragt, wie die Kollegin Ayesha Khan in der taz vom 18. 11. berichtete. Aus diesem Revier wurden die rassistischen Drohfaxe an die NSU-Opfer-Anwältin Seda Başay-Yıldız verschickt. Auch das ist Deutschland. Während ich also am Montag noch nachlese, wie die Veranstaltung war, trinken Rentnerpärchen gemütlich ihren Kaffee.

Berliner Möwenclan ?

Ich komme ja auch von einer Insel. Berlin vor dem Mauerfall. Es ist natürlich kein Vergleich zu dem Inselstatus von Norderney. Berlin verband ich mit dem Inselvolk der Linken, Arbeiter*innen und Aussteiger, Wohlstand trug man nicht auf die Berliner Straßen. Anders dagegen auf der Nordseeinsel: gediegene Boutiquen, wenige, silbern glänzende Mülleimer, aus denen nichts quillt, nirgends ein Döner und sogar die Fast-Food-Läden sind eher Bistros mit Sektchen oder Schnäppsken zum Schnitzelbrötchen.

Quelle          :          TAZ            >>>>>           weiterlesen

—————————————————————–

Grafikquellen       :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Berlin, Feuilleton, Mensch, Umwelt | Keine Kommentare »

CDU und die Frauenquote

Erstellt von DL-Redaktion am 25. November 2019

Dröhnendes Schweigen

2018-12-07 Annegret Kramp-Karrenbauer CDU Pateitag in Hamburg-2568.jpg

Vom schrumpfeb der  Personen in der Verantwortung

Aus Leipzig von Anja Maier

Mit ihrem Antrag für eine Quote wollte die Frauen-Union als Tiger die CDU antreiben. Sie landet als Bettvorleger. Was ist da passiert?

Am Samstagmorgen ist Kristy Augustin spät dran. „Das Taxi kam nicht“, sagt sie und eilt auf ihren schwarzen Highheels Richtung Sitzungssaal in der Leipziger Messe. Dort sitzen die Brandenburger Delegierten. Augustin ist eine unter fünf Frauen und zwölf Männern. Dieses Geschlechterverhältnis umreißt recht anschaulich ein Problem der gesamten CDU, mit dem sich der 32. Bundesparteitag in Leipzig an diesem Wochenende befassen muss: dem Frauenanteil in der Partei und deren Zugang zur Macht.

Kristy Augustin, 40 Jahre und gerade wiedergewählte Landtagsabgeordnete, ist Landesvorsitzende der Frauen-Union, sie will eine Lösung. Der Parteitag aber wird die Frage erneut vertagen. Auch weil die Frauen so nett sein werden und der direkten Debatte ausweichen. Warum? Dazu später. Aber noch ist es Samstagmorgen, noch hat Kristy Augustin, die CDU-Familienpolitikerin aus dem Oderbruch kurz vor Polen, es eilig. Noch sagt sie: „Wir brauchen hier auf dem Parteitag eine deutliche Botschaft. Die Frauen-Union muss hier zeigen, was sie will.“

Was will sie denn, die Frauen-Union mit ihren 150.000 Mitgliedern? Kurz gesagt: endlich neue Regeln, um mehr Frauen an die Schaltstellen der Politik zu bringen und so die gesamte Partei anschlussfähiger, attraktiver für Wählerinnen zu machen, für die Chancengleichheit nicht nur eine Floskel ist. Anderen ist das egal oder sie sind strikt gegen Quoten – überraschenderweise nicht nur die Männer, sondern auch der Parteinachwuchs. Sie finden, die Frauen sollten einfach mitmachen, dann würde sich das Problem schon von selbst erledigen.

Es ist das alte Henne-Ei-Problem: Erfüllt die CDU ihre selbst gesetzte, eigentlich verpflichtende 30-Prozent-Quote nicht, gerade weil oder eben obwohl Frauen fehlen, die bereit sind, mitzutun, Verantwortung zu übernehmen? Die Frauen-Union findet, erst müssten die Strukturen geschaffen werden. Ihre KritikerInnen meinen, die Partei sei offen für jeden und jede. Kristy Augustin sagt es so: „Wir sind eine Volkspartei, also brauchen wir auch eine Repräsentanz von Frauen.“

Radikale Töne für eine konservative Partei

An diesem Samstag soll der Parteitag deshalb über einen mit viel Aufmerksamkeit bedachten Antrag der Frauen-Union im Bereich Struktur- und Satzungsfragen abstimmen. Auf Seite 166 des 363 dicken Buches findet sich Antrag C63: „Mehr Frauen in der CDU, in Ämtern und Mandaten“. Der Ton des Textes klingt für diese immer noch große bürgerliche Partei erstaunlich genervt. Die CDU, steht da, habe frauenpolitisch „ein Umsetzungs- und Durchsetzungsproblem“. Allen sei das bewusst, über verbindliche Zielvorgaben für mehr Frauen in Ämtern und Mandaten werde seit anno 1985 diskutiert. Gefasste Beschlüsse wie das 30-Prozent-Quorum würden nicht umgesetzt, sondern – im Gegenteil – permanent unterlaufen. Fraktionen der CDU in Kommunen, Kreistagen und Ländern zählten regelmäßig zu denen mit dem geringsten Frauenanteil.

So weit die Problembeschreibung. Nun zu den Lösungsvorschlägen. Das Quorum, fordern die Frauen, müsse endlich verbindlich werden. Wahllisten sollen künftig nach dem Reißverschlussprinzip besetzt werden. Dies müsse „mindestens für die Anzahl der Kandidatinnen und Kandidaten gelten“, wie es der Zahl der Abgeordneten entspricht. Das hieße: Parität. Und: Über den parteiinternen Finanzausgleich sollen außerdem Verbände belohnt werden, die das Paritätsprinzip tatsächlich durchsetzen. „Das Ziel ist die Erhöhung des Frauenanteils in der Mitgliedschaft, in allen Funktionen und auf allen Ebenen bis hin zur hälftigen Teilhabe.“ Das klingt nach Revolution, jedenfalls für eine konservative Partei. Doch noch bevor es an die Debatte über den Antrag geht, gilt als ausgemacht, dass der Parteitag nicht darüber abstimmen wird.

„Wir brauchen hier eine deutliche Botschaft. Die Frauen-Union muss hier zeigen, was sie will“

Denn die Antragskommission hat einen Kompromiss gefunden: Der Vorschlag der Frauen wird in eine – noch zu bildende – Struktur- und Satzungskommission verwiesen. Annette Widmann-Mauz, die Vorsitzende der Frauen-Union und Staatsministerin für Integration im Kanzleramt, sagte vor dem Parteitag der taz: „Wir ­geben unsere Ziele nicht auf. Es gibt unterschiedliche Wege, aber es muss klar sein: Beim Parteitag 2020, da wird die CDU sich entscheiden müssen.“

Dahinter steht auch die Einsicht, dass die Frauen in der Union ihrer Spitzenfrau Annegret Kramp-Karrenbauer in schwierigen Zeiten nicht auch noch eine Geschlechterdebatte ans Bein binden wollen. Ein Thema, bei dem es um verbriefte, nicht nur freundlicherweise zugestandene Beteiligung für Frauen geht, kommt in Zeiten der aufgebrachten Jungs nicht gut an. Die Truppen gegen Kramp-Karrenbauer werden für alle sichtbar von Männern angeführt; sie heißen Friedrich Merz, Tilman Kuban, Carsten Linnemann. Eine Fokussierung auf ihr Geschlecht, gar eine gönnerhafte Erzählung kann Annegret Kramp-Karrenbauer in Leipzig gar nicht gebrauchen. Die Abstimmung darüber würden ihre Gegner sie mit Freuden verlieren sehen. Ob sie eine Frau ist, soll dabei keine Rolle spielen.

Die Pointe: Dass sie eine ist, wird gerade von ihren Kritikern gern als Beweis dafür hergenommen, dass bei der CDU alle was werden können. Merkel, Kramp-Karrenbauer, von der Leyen – da sehe man es doch. Wozu also noch Quoten, die hier gern „Verbote“ genannt werden. Gemeint sind damit Verbote für Männer. Man kann das als typische CDU-Haltung verstehen, die Frauenfrage in diese extra zu bildende Strukturkommission zu verweisen. Intern strittige Themen werden nicht gern öffentlich debattiert – in der Hoffnung, dass man auf diese Weise einen Kompromiss finden möge, dem die Mehrheit zustimmen kann. Das Problem: Eine Quote für Frauen kann kein Kompromiss sein. Entweder es gibt sie oder eben nicht. Insofern ist nur zu verständlich, dass die ohnehin nur 26 Prozent der Mitgliedschaft ausmachenden Frauen die Faxen dicke haben und eine Entscheidung erzwingen wollen. Und wenn sie das schon nicht hinkriegen – diesmal nicht –, dann wollen sie wenigstens für Öffentlichkeit sorgen. Und Öffentlichkeit bedeutet bei der CDU: Streit. Unangenehm. Kristy Augustin sagt: „Jetzt wollen wir mal sehen.“

Wiebke Winter belässt es bei „Ich will #MehrMädels“

Extra zur Abstimmung ist Wiebke Winter nach Leipzig gereist. Winter ist 23 Jahre alt und seit diesem Jahr Vorsitzende der Jungen Union in Bremen. Sie ist eine Gegnerin der Frauenquote. Ihre Überzeugung: „Wir brauchen keinen Kampf der Geschlechter, sondern ein Miteinander.“ Winter ist außerdem für eine gewisse Leichtigkeit bei diesem hart umkämpften Thema, das in CDU und CSU gern als zweit- bis drittrangig beiseite gewischt wird. Im Oktober, beim Deutschlandtag der Jungen Union in Saarbrücken, haben Wiebke Winter und andere junge Frauen Sticker verteilt: „Ich will #MehrMädels (in der JU)“. „Das klingt nicht so aggressiv und verbissen, ist aber eine klare Message“, sagt Winter.

Überhaupt findet sie, dass jedeR was werden kann in der Union, egal welchen Geschlechts. Wenn ältere Frauen in der Partei ihr erzählen, auch für sie werde es einen Punkt geben, an dem sie in der Partei als Frau nicht weiterkommt, ist sie leicht genervt. „Meine Generation ist anders. Es ist nicht alles perfekt, aber schon deutlich besser als für die Frauen damals.“

Jetzt steht sie am Rande des Plenums, den Schal hat sie locker um den Blusenkragen geschlungen, am linken Arm trägt sie eine Handtasche. Sie ist bereit zur Auseinandersetzung. Mit anderen Aktiven der Jungen Union hat sie schon besprochen, wer für den Parteinachwuchs ans Rednerpult gehen soll, wenn die Frauen-Union ihre Plädoyers für ihren weitreichenden Antrag hält. Wiebke Winter rechnet mit mehreren Wortwechseln in der Sache.

Quelle       :      TAZ           >>>>>          weiterlesen

—————————————————————-

Grafikqiellen       :

Oben        —       Annegret Kramp-Karrenbauer: 31 Parteitag der CDU Deutschlands in Hamburg, Messe Hamburg

Annegret Kramp-Karrenbauer: 31 Parteitag der CDU Deutschlands in Hamburg, Messe Hamburg

——————————————

Unten        —       Diana Kinnert, 2019

Abgelegt unter P.CDU / CSU, Positionen, Sachsen, Überregional | Keine Kommentare »

Linken – Parteitag in Berlin

Erstellt von DL-Redaktion am 24. November 2019

Linke will nach Mietendeckel auch an die Böden

Katrin Lompscher (Martin Rulsch) 1.jpg

und diese ohne angefaulte Wagenbretter bauen ?

Von 

„Wem gehört die Stadt?“, ist das Motto des Berliner Linken-Parteitags. Der ging einher mit einem Angriff auf die großen Wohnungsunternehmen.

Der geplante Mietendeckel ist weder vom Senat noch vom Abgeordnetenhaus beschlossen, da plant die Linken-Stadtentwicklungssenatorin Katrin Lompscher die nächste Initiative zur Bekämpfung des „Mietenwahnsinns in der Stadt“.

Auf dem Landesparteitag der Linken am Samstag in Adlershof kündigte sie an: „Nach dem Mietendeckel müssen wir über Bodenpreise reden. Diese seien „derartig explodiert, dass wir Möglichkeiten schaffen müssen, preissenkende kommunale Beschlüsse zu fassen.“

Lompscher blickte dabei in die österreichische Hauptstadt und sagte: „Das kann man in Wien, das sollte man auch in Berlin und anderswo können.“ Die für ihre soziale Wohnungspolitik bekannte österreichische Hauptstadt gilt offenbar nicht nur den Berliner Sozialdemokraten, sondern auch der Linken als Vorbild.

Während der genau wie Grünen-Landesparteivorsitzender Werner Graf auf dem Linken Parteitag anwesende SPD-Fraktionschef Raed Saleh einräumte, mit dem Vorschlag Lompschers nicht viel anfangen zu können, erklärte diese ihr Anliegen in kleiner Runde. Ziel sei es, „die spekulative Überhöhung von Bodenpreisen mit politischen Instrumenten zu begrenzen“. Nötig seien „klare Regeln für die Ausrufung eines limitierten Kaufpreises“. Die „spekulative Erhöhung der Preise muss unmöglich gemacht werden“, forderte Lompscher.

Darüber hinaus kündigte Lompscher an, die Praxis kommunaler Vorkaufsrechte ausweiten zu wollen. Sie sprach sich für ein „generelles Eingriffsrecht der Kommunen beim Verkauf von Grundstücken“ aus und forderte, Spekulationen zu verbieten. Bei Haus- und Grundstücksverkäufen, auch außerhalb von Milieuschutzgebieten, müsse es einen Entscheidungsvorbehalt geben, der Kommunen beziehungsweise deren Wohnungsbauunternehmen den Vorkauf ermögliche.

Mit Blick auf die am kommenden Dienstag anstehende Abstimmung über den Mietendeckel-Entwurf im Senat zeigte sich Lompscher zuversichtlich. Dieser werde mit „zwei kleinen technischen Änderungen“ eingebracht, außerdem seien „zahlreiche Hinweise zur Begründung“ aus anderen Senatsverwaltungen übernommen worden. Dazu dürften auch Hinweise aus dem Rat der Bürgermeister zählen. Diese hatten am Donnerstag zwar mehrheitlich für den Mietendeckel gestimmt. Die für die Bezirke vorgesehenen Aufgaben wollen sie aber nicht wahrnehmen. Lompscher wiederum hatte in dem Abstimmungsergebnis eine „sehr qualifizierte Minderheit“ für ihre Position erkannt.

 Lob auch von Lederer, Wolf, Schubert und Breitenbach

Unterdessen haben führende Mitglieder der Linkspartei den Landesparteitag dafür genutzt, den Mietendeckel zu loben und sich des eigenen Erfolges zu vergewissern. Katina Schubert, Vorsitzende der Berliner Linken, erklärte, es sei „höchste Zeit, dass wir dem Mietenwahnsinn ein Ende setzen“. Sie verteidigte den Mietendeckel als Schritt, direkt in die Gewinnerwartungen von Vermietern einzugreifen und der „Profitschneiderei von Unternehmen wie Deutsche Wohnen, Vonovia, Akelius“ etwas entgegenzusetzen.

CSD Lay+Liebich+Lompscher+Lederer.jpg

[Von Wohnungsbau bis Mietendeckel: Die Auswirkungen der Politik auf das Leben in den Kiezen sind regelmäßig Thema in unseren Leute-Newslettern aus den zwölf Berliner Bezirken. Hier geht’s zur kostenlosen Bestellung: leute.tagesspiegel.de]

Harald Wolf, ehemaliger Wirtschaftssenator Berlins und Bundesschatzmeister der Linken, lobte den Einsatz der Hauptstadt-Genossen für den Mietendeckel. Ihnen sei es gelungen, die „Eigentumsfrage von einer theoretischen Frage zu einer realpolitischen Diskussion“ zu machen. Wolf, der als Grußredner des Parteivorstands angekündigt worden war, erklärte: „Die gesamte Bundespartei steht in dieser Frage solidarisch an der Seite des Berliner Landesverbandes.“

Quelle         :            Tagesspiegel              >>>>>         weiterlesen

——————————————————————-

Grafikquellen         :

Oben       —        Katrin Lompscher, Berlin politician (Die Linke) and member of the Abgeordnetenhaus of Berlin (as of 2013).

Abgelegt unter Arbeitspolitik, Berlin, P. DIE LINKE, Sozialpolitik | Keine Kommentare »

Abbruch oder Aufbruch

Erstellt von DL-Redaktion am 19. November 2019

Zwischen Abbruch und Aufbruch

DIE LINKE Bundesparteitag 10-11 Mai 2014 -118.jpg

Quelle       :        Scharf  —  Links

Von René Lindenau

An einem trüben Novemberwochenende (15.-17.11 2019) traf sich die sächsische LINKE in Dresden zu ihrer 2. Tagung des 15. Parteitages. Neben Trauerarbeit nach den aus Sicht der Partei dramatisch verlustreichen Landtagswahlen,vom 1. September, war ein neuer Landesvorstand, im Besonderen, ein neuer Vorsitz zu wählen. Bei allem stand Fehlerdiskussion, Ursachenforschung für die Wahlniederlagen des Jahres 2019 (Europa, Kommunal, Land) auf dem Programm, ohne jedoch auch den Blick nach vorn nicht zu vergessen.

Als „Ausländer“, der eigentlich im brandenburgischen Landesverband organisiert und angesichts eines nicht besseren Wahlergebnisses, immerhin verlor Rot-Rot die Regierungsmehrheit, genug eigene Sorgen hätte, zog es es mich wenigstens für einen Tag in die sächsische Hauptstadt. Aber was soll man machen: Wenn man sich persönlich mit einigen sächsischen Genossen verbunden fühlt und damit auch diesem Landesverband als Ganzes. Ohne Zweifel, trotz allem bleibt die sächsische LINKE ein ganz wichtiger Teil der Bundespartei. Auch wenn sie der Wähler jetzt geschrumpft hat, die Bedeutung der sächsischen LINKEN ist geblieben, ihre Verantwortung ist eher gestiegen. Jetzt erst Recht! Sachsen´s LINKE muss der Leuchtturm in Dunkel-Sachsen sein!

„Leuchtturm Wärter“ haben die Delegierten an diesem Wochenende gewählt.Wie gut und effizient ihre Strahlkraft in Partei und Gesellschaft sind, wir werden sehen; Stefan Hartmann und Susanne Scharper. Geben wir ihnen und der neuen genossenschaftlichen Führung eine Chance! Aber hatten die, die Genossen Feiks und Dudzak als (im doppelten Sinne?) abgetretene Landesvorsitzende und nicht wiedergewählte Landesgeschäftsführer? Will sagen, mir tut es persönlich um beide Genossen leid. Nichts (!) gegen ihre Nachfolger, im Gegenteil, ihnen sei im Interesse der Partei aller nur denkbarer Erfolg gewünscht. Mussten Feiks und Dudzak als Sündenböcke für die Wählereinbußen herhalten? Sündenböcke sollten jedoch lieber im bezahlten Fußball verortet bleiben, aber nicht in einer linken Partei mit solidarischen Antlitz – zumal ihr Spitzenkandidat Rico Gebhardt als Fraktionsvorsitzender weiter machen kann… Fragen auf Fragen.

Fragen zu stellen, Antworten zu suchen, was denn nun zu den Einbrüchen in der linken Wählerschaft führte und wie es weiter gehen soll, dazu hatten die Delegierten schon am ersten Tagungstag bis gegen 22 Uhr Zeit. Aber sie nutzten sie nicht! Über eine Stunde Redezeit; des Austausches, der Suche nach Antworten und neuen Wegen wurde verschenkt. Ich erlebte das jüngst auch auf einem Bundesparteitag. Aber die „Kaffee-Sachsen“ hätte ich für redseliger gehalten – insbesondere im Angesicht zwischen Abbruch und Aufbruch, habe ich da mehr erwartet: Wo sind die Ursachen für die Niederlagen, wie kommen wir da wieder raus? Wie gehen wir mit den Niederlagen um, lernen daraus und organisieren uns neue Erfolge? Alles schon klar? Vielmehr begann und endete die Debattenzeit mit einem Missbrauch. Eröffnet wurde mit NATO Manövern und Bedrohungen Richtung Russland statt diese nicht unwichtigen Gedanken in der üblichen Antragsdebatte einzubringen sowie ein verspätetes Parteilehrjahr, wo uns der Referent mit unbestritten den nach wie vor richtigen und wichtigen marxschen ökonomischen Grundrissen u.a. kam. Der aktuellen Situation in Sachsen und der Tagesordnung des Parteitages wurden diese Beiträge jedenfalls nicht gerecht.

Wenn man mich als brandenburgischen Zaungast nach möglichen Gründen für die krachende landtägliche Wahlniederlage befragt, meine ich, wesentlich Schuld trug das – plakative – Bekenntnis zum demokratischen Sozialismus. Nichts dagegen, deshalb ist man schließlich in dieser Partei. Aber in einem Landtagswahlkampf, auf Wahlplakate? Überfordern wir da nicht viele Bürger, einschließlich des alten und neuen CDU Ministerpräsidenten, Michael Kretschmar , wenn er geradezu reflexartig ablehnend oder einfach nur unwissend, nicht vom real existierenden gescheiterten DDR Sozialismus für den die SED stand, und einem demokratischen Sozialismus, für den ihre Nachfolgepartei, DIE LINKE heute kämpft, zu unterscheiden weiß. Die Idee des Sozialismus, wie auch immer sie in ihrer Geschichte bisher daher kam, ist nach der verheerenden Niederlage der Wendejahre von 1989/91 bis heute diskreditiert. Linke, sozialistische Ideen haben es bis in die Gegenwart schwer, öffentliche Räume zu erobern, geschweige denn Diskurs bestimmend in Prozesse einzugreifen und entsprechende Entwicklungen voranzutreiben. Die Linke als Partei und Bewegung ist halt immer noch in der gesellschaftlichen Defensive. Wo Veränderungen gelingen sind sie nur kleinteilig und gehen manchem nicht weit genug. Wenn Erfolge gelingen, Dinge schon längst von der Partei aufgeschrieben oder umgesetzt wurden und eigene Genossen nichts davon wissen – dann wird es ganz böse.In einem Landtagswahlkampf erwartet der Bürger zuerst Antworten auf landespolitische Fragestellungen. Dann hätte Sachsens LINKE möglicherweise mehr gepunktet. Programmatische Zielvorgaben einer Partei gehören meines Erachtens nicht in so einen Wahlkampf, auch nicht auf Plakate.

In einer Zeit, da die linksseitig ohnehin nie einfache sächsische Großwetterlage noch komplizierter geworden ist, hat der Dresdner Parteitag das Feld neu bestellt. Nun gilt es für den neuen Landesvorstand gemeinsam mit der geschwächten Landtagsfraktion neu zu säen und zu ernten. Sachsen ist ein zu schönes und ein politisch zu wichtiges Land, als dass es den schwarzen und blau – braunen Block allein überlassen werden darf. Dazu bedarf es einer starken LINKEN, die sich nicht nur in Mandatszahlen ausdrückt. Darüber hinausgehende Bündnisse in alle gesellschaftlich relevanten demokratischen Kräfte der Zivilgesellschaft werden in dieser Situation von noch größerer Bedeutung sein. Im Übrigen wäre das doch ein Weg, um verlorenes Terrain zurück zu erobern. Oder?

Cottbus, den 18.11. 2019  René Lindenau

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquelle       :          Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor      —      Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -118.jpg
  • Created: 2014-05-21 17:36:47

Abgelegt unter P. DIE LINKE, Positionen, Sachsen, Überregional | Keine Kommentare »

Demokratieförderung Bund

Erstellt von DL-Redaktion am 17. November 2019

Geld allein macht nicht glücklich

Unteilbar Dresden 2019 026.jpg

Von Pia Stendera und Simon Schramm

Wie wir zusamenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Deshalb investiert der Staat viel Geld in Großprogramme zur Demokratieförderung. Was können diese überhaupt leisten?

Demokratie, die Herrschaft des Volkes, bedeutet in Deutschland für die meisten Volljährigen, regelmäßig frei und geheim ihre Re­prä­sen­tan­t*in­nen wählen zu können. Gerade Jüngere halten das für selbstverständlich, sie kennen kein anderes politisches System. Und Demokratie bedeutet, die eigene Meinung frei äußern zu dürfen, auch wenn einige dabei gern weiter gehen würden, als es das Grundgesetz erlaubt. Doch demokratisches Leben ist noch viel mehr als wählen gehen und Meinungsfreiheit.

Wie wir zusammenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Und manchmal braucht es eine Erinnerung, wie sehr wir von unserem politischen System profitieren. Es braucht Überzeugungsarbeit – ob im Betrieb oder in der Kneipe. Um diese Arbeit zu fördern, hat der Staat 2001 beschlossen, Geld zu verteilen. Zusammengefasst hat er das mit dem Begriff Demokratieförderung.

Was heißt das? Konkret geht es um Fördergroßprogramme des Familienministeriums, wobei Geld an Organisationen und Bür­ge­r*in­nen verteilt wird, die sich um die Demokratie kümmern. Unterstützt werden zum Beispiel Bildungsprojekte für Schü­le­r*in­nen, Schulungen für Leh­re­r*in­nen, Projekte zur präventiven Extremismusbekämpfung, aber auch Aus­stei­ge­r*in­nen­pro­gram­me für Ex­tre­mis­t*in­nen.

In den vergangenen 20 Jahren hat die Regierung konstant immer mehr Geld dafür bereitgestellt, Kritik gab es trotzdem. Das Problem: Bisher liefen diese Großprogramme maximal fünf Jahre. Somit waren auch die Förderungen der Projekte immer begrenzt, ihre weitere Existenz stets bedroht. Nun wird mit „Demokratie leben“ zum ersten Mal ein solches Großprogramm verlängert.

Natürlich kann ein Förder-programm nicht alles heilen, was falsch läuft

„Weil Demokratieförderung Planungssicherheit braucht“, begründete Familienministerin Franziska Giffey (SPD) diese Entscheidung. Mit dem Jahr 2020 beginnt dann der zweite Förderzeitraum. Jährlich sollen bis 2024 115,5 Millionen Euro in demokratiefördernde Projekte fließen. Die Entfristung allein schafft aber keine Planungssicherheit.

Unteilbar Dresden 2019 006.jpg

Die Kritik an Großprogrammen zur Demokratieförderung ist so alt wie die Programme selbst. Jedes Mal, wenn diese Programme auslaufen, sagen Ver­tre­te­r*in­nen bisher geförderter Projekte, dass das Geld nicht reicht. Mit „Demokratie leben“ wurden aber allein 2019 115 Millionen Euro verteilt. Das ist mehr als in jedem vergleichbaren Programm in Europa.

Viel Unmut gab es wegen der neuen Verteilung der Fördergelder. Besonders ein offener Brief an das Familienministerium sorgte für Aufsehen. Der Brief wurde von Joseph Blank und Martin Nanzig von der Deutschen Gesellschaft für Demokratiepädagogik initiiert und von 315 Organisationen und Personen unterzeichnet. Wo genau ist das Problem?

Quelle         :     TAZ         >>>>>        weiterlesen

—————————————————————-

Grafikquellen      :

Oben         —          Unteilbar Dresden 2019

Abgelegt unter APO, Kultur, Sachsen, Überregional | Keine Kommentare »

Die LINKE in Thüringen

Erstellt von DL-Redaktion am 16. November 2019

Für ein sozialistisches Regierungsprogramm der LINKEN in Thüringen

Quelle       :     AKL

Beschluss der AKL Berlin vom 14.11.2019

Angesichts des Wahlergebnisses in Thüringen, aus dem DIE LINKE als stärkste Partei hervorgeht, fordern wir Bodo Ramelow und DIE LINKE-Fraktion in Thüringen auf, keine Koalition oder Tolerierungsabkommen mit der CDU oder anderen im thüringischen Landtag vertretenen Parteien einzugehen. Stattdessen sollte DIE LINKE jetzt das Wahlergebnis zum Anlass nehmen, ein sozialistisches Regierungsprogramm zu verabschieden, dessen Umsetzung einerseits die Lebensbedingungen in Thüringen verbessert und andererseits aufzeigt, dass sich DIE LINKE von allen anderen Parteien unterscheidet. Dieses Programm kann nicht im Bündnis mit bürgerlichen Parteien umgesetzt werden, sondern nur im Bündnis mit der arbeitenden und erwerbslosen Bevölkerung und den Gewerkschaften und sozialen Bewegungen.

Da laut Landesrecht der jetzige Ministerpräsident im Amt bleibt, solange keine neue Regierung gebildet ist, sollte DIE LINKE jetzt die Chance nutzen, als Minderheitsregierung Maßnahmen zur Abstimmung zu stellen wie zum Beispiel: Einführung eines kostenlosen ÖPNV und massiver Ausbau des Schienenverkehrs in Stadt und Land; Beschlagnahmung von spekulativem leerstehendem Wohnraum, Enteignung von Immobilienkonzernen unter demokratischer Kontrolle und Verwaltung, Mietsenkung und Deckelung der Mieten auf Kostenmiete, Bau von kommunalen Wohnungen; Einführung der 35-Stundenwoche bei vollem Lohn- und Personalausgleich im öffentlichen Dienst als Einstieg in weitere Arbeitszeitverkürzung; Rekommunalisierung und massiver Stellenaufbau in Krankenhäusern, Verkehrsbetrieben sowie allen Bereichen der Daseinsvorsorge unter demokratischer Kontrolle und Verwaltung durch demokratisch gewählte Räte von Beschäftigten, Nutzer*innen, Gewerkschaften und Landesvertreter*innen; Unternehmen, die mit Entlassungen oder Kürzungen drohen, in Landeseigentum unter demokratischer Kontrolle und Verwaltung zu überführen; das Nutzen aller Möglichkeiten von Besteuerung der Reichen und Gewinne durch das Land und die Kommunen; massive Investitionen in Infrastruktur und Soziales; Abschaffung aller Gebühren und Kosten im Bildungswesen, Aufsetzen eines Programms zur vollständigen Deckung offener Stellen in den Schulen, Auflösung des Landesamtes für Verfassungsschutz und Einsetzung eines unabhängigen NSU-Untersuchungsausschusses unter Beteiligung von antirassistischen Organisationen, Migrant*innenverbänden und Gewerkschaften.

Für die Durchsetzung und Verteidigung dieser Maßnahmen muss DIE LINKE die arbeitende und erwerbslose Bevölkerung demokratisch einbeziehen. Dazu sollte eine Informationskampagne einschließlich Massenversammlungen durchgeführt werden, die die Basis für Demonstrationen und Streiks in Thüringen und bundesweit sein können. Es darf der LINKEN dabei nicht um Stellvertreter*innenpolitik gehen: Alle diese Maßnahmen aus dem Parlament heraus müssen zu einer Selbstermächtigung derer führen, die vom Kapitalismus ausgestoßen und erniedrigt sind. Die Enteignung der großen Mehrheit der Menschen muss beendet werden – dazu bedarf es der Rückaneignung von dem, was den Menschen unter dem Stichwort „Sachzwänge“ Jahrzehnte lang genommen wurde: Geld, Perspektiven, Würde, Gerechtigkeit. Eine Politik im Sinne dieser Rückaneignung würde auch die Erfolge der AfD unter Arbeiter*innen und Jugendlichen untergraben, welche diese mit rechtspopulistischer Politik, Rassismus und Nationalismus in die Irre führt. Ein solches Programm könnte der LINKEN bundesweit Unterstützung bei denjenigen sichern, die nach einer Alternative Ausschau halten. So wäre garantiert, dass dieser Wahlerfolg keine Eintagsfliege, sondern einen Schritt auf dem Weg der LINKEN zu einer sozialistischen Massenpartei markiert.

akl - Antikapitalistische Linke

————————————————————————–

Grafikquelle         :            –Blogsport

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | 3 Kommentare »

Thüringer Regierung

Erstellt von DL-Redaktion am 15. November 2019

Thüringen – Minderheitsregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–09.jpg

Von Tom Strohschneider

Minderheitsregierung, das klingt erst mal doof. Dabei bietet sie viele Chancen.

Vor ein paar Tagen sorgte eine Meldung auf Twitter für Aufsehen: „CDU führte konkrete Gespräche mit der AfD“, so die Schlagzeile. Und das, so las man weiter, obwohl CDU-Fraktionschef Mike Mohring „zuvor jede Kooperation ausgeschlossen hatte“. Passiert da etwas Heimliches, Ungeheuerliches hinter den Kulissen der Erfurter Nachwahlpolitik? Eine Kooperation mit den Rechtsradikalen gegen Rot-Rot-Grün? Einige Politiker und Journalisten verbreiteten die irritierende Kunde weiter. Bis es jemandem auffiel: Die Meldung ist von 2014. Ein Kollege schrieb: „Geschichte wiederholt sich hoffentlich nicht.“

Was hätte sein können

Es gibt das berühmte Diktum von Karl Marx, dass so etwas eben doch passiert, „das eine Mal als Tragödie, das andere Mal als Farce“. Aber was, wenn es nach der Landtagswahl anders gekommen wäre, nur ein kleines bisschen anders, aber mit großen Wirkungen?

Vielleicht so: Es ist der 28. Oktober 2019, Mike Mohring macht sich am frühen Montagmorgen auf den Weg ins Fernsehstudio, eine schwere CDU-Klatsche im Nacken, unklare Mehrheitsverhältnisse, die Frage einer Kooperation mit der Linkspartei liegt wie ein zwei Tonnen schwerer Stein auf dem Tisch, man kann ihn nicht mal eben mit dem Handrücken wegfegen. „Die CDU in Thüringen ist bereit für Verantwortung, wie auch immer die aussehen kann und sollte“, sagt Mohring. „Deswegen muss man bereit sein, nach diesem Wahlergebnis auch Gespräche zu führen. Ohne was auszuschließen.“ Im Übrigen liege die Hoheit für den weiteren Erfurter Weg „alleine in Thüringen“.

Danach fährt Mohring in die CDU-Bundeszentrale, die Gremien tagen, zerknirschte Gesichter ob des Wahlausgangs – aber der Geist von Altmeister Bernhard Vogel ist in allen Köpfen: Man könne sich doch „Gesprächen nicht versagen“, keine Koalition mit der Linkspartei, das ist klar, aber daneben geht ja auch was. Auch die Thüringer Wirtschaft sieht das so: „Neue Situationen erfordern neue Maßnahmen“, heißt es vom Unternehmensverband. In der CDU-Bundeszentrale stimmt man zu, es wird eine Sprachregelung gesucht, Mohring bekommt sein Mandat. Nur eines nicht: irgendwelche Offenheit zur AfD zeigen. Und Mohring weiß auch: Selbst wenn er so denken würde, sollte er in dieser Runde nie und nimmer Sätze sagen wie: „Ramelow ist inhaltlich leer. Und wir werden als Union alles mit ihm machen können.“

Denn natürlich haben auch die Gegner der „neuen Maßnahmen“ Ohren, SMS-fähige Telefone und sie wissen, an wen sie sich wenden müssen. In der Bild-Zeitung wetzen sie ohnehin schon die Tastaturen, ein Gespräch mit Mohring wird als „Verhör“ verkauft, die alte Leier: Eine Zusammenarbeit mit der Linkspartei sei Verrat der CDU an einem „ihrer letzten heiligen Werte“, der „Markenkern der Partei der Wiedervereinigung“ sei bedroht. Doch Mohring bleibt aufrecht, die CDU bleibt es fast ausnahmslos auch, keine Heckenschützen, kein verbales Störfeuer.

Eine neue Situation erfordert auch neues Verhalten. Hier wird es geliefert. Zumal alle wissen: Wer jetzt gegen Gespräche mit der Linkspartei auftritt, macht jene lauten Minderheiten stark, die am liebsten über die Brandmauer zur AfD hinüberklettern wollten. Ortsfunktionäre aus der vierten Reihe. Ein paar Anhänger der Werte-Union, die von der Frankfurter Allgemeinen Zeitung als „eine kleine Gruppe am rechten Rand der CDU“ beschrieben wird. Auch ein früherer Verfassungsschutzpräsident treibt dort gern sein Wesen.

Aber die CDU im ganzen bleibt stabil. Der Generalsekretär der CDU wehrt einen Vorstoß von der Vorgestern-Fraktion ab, die ihn zu einem Gastbeitrag gegen die Linkspartei drängen wollen. Stattdessen gibt Paul Ziemiak einen Text heraus, in dem er CDU und AfD „wie Feuer und Wasser“ nennt, eine Zusammenarbeit wäre „Verrat an der Christdemokratie“. Mohring sieht sich bestätigt und unterstützt, er nimmt das vertrauliche Angebot von Bodo Ramelow ganz vertraulich an. SMS werden ausgetauscht, aber nicht weitererzählt. Es wird jetzt eine Weile dauern, das wissen alle Beteiligten. Und es wird kompliziert. Der Erfurter Weg ist eine ziemlich steinige und steile Straße.

Mohring wird tags darauf natürlich auf seine Kanäle zu Ramelow angesprochen. Er reißt sich am Riemen: „Private Kommunikation ist aus gutem Grund vertraulich.“ Als sich der Moderator einer Talkshow später nachfragend an ihn heranlanzt, lächelt der CDU-Politiker bloß. Er denkt an das Bild-Interview, Schweigen ist in dieser Situation eine „Frage des Anstands“.

2019-10-27 Wahlabend Thüringen by Sandro Halank–83.jpg

Apropos Anstand, dass das Blatt das Gespräch zum „Verhör“ erklärt hat, wurmt Mohring. Ein Bonmot von Max Goldt kommt ihm in den Sinn: „Diese Zeitung ist ein Organ der Niedertracht.“ Auch dagegen muss man nun aufrecht bleiben. Drei Tage ist die Wahl erst her, der junge CDU-Fraktionschef blickt in eine ungewisse aber auch spannende Zukunft. Ja, eine neue Situation ist das. Thüringen, die politische Landschaft, CDU und Linkspartei – er erinnert sich an den Morgan am Tag nach der Wahl, an seine Worte: „Ruhe und Besonnenheit“.

Was wirklich war

Hätte, hätte, Fahrradkette – die ersten drei Tage nach der Wahl sind in Wahrheit anders verlaufen. Die Lage ist dadurch nicht einfacher geworden, sondern komplizierter. Mike Mohring hat daran großen Anteil, taktisch unsicher, strategisch unvorbereitet, machtpolitisch ungeschickt. Hat er mit dieser Lage etwa nicht gerechnet? In der Talkshow, in der er in Wahrheit auch die Vertraulichkeit Ramelows herumplappernd brach, sagt Mohring: Es sei ein Wahlergebnis „mit dem man nicht rechnen konnte. Vielleicht wollte ich auch nicht damit rechnen.“ Markus Lanz darauf: „Aber damit musste man doch rechnen.“ Mohring: „Klar, konnte man.“

Konnte? Und doch lässt sich die verfahrene Kiste nicht allein auf Mohring schieben. Sein Versuch, unmittelbar nach der Wahl die Tür zur Linken entgegen vorheriger Absagen ein kleines bisschen offenzuhalten, ist vor allem von Politikern der Union vereitelt worden, die Thüringen nur zum Spielball ihrer eigenen Machtlogiken gemacht haben.

Die Mohring-Debatte in der CDU war nicht zuletzt eine um den Kopf der Vorsitzenden Annegret Kramp-Karrenbauer und gegen den Einfluss Angela Merkels. Nicht wenige haben nach dem Motto „Mohring schlagen, AKK und Merkel treffen“ agiert und dabei, man musste das ahnen können, jene angefeuert, die tatsächlich mit Rechtsradikalen reden wollen. Wie ein ausgerollter brauner Teppich für die, die glauben, man müsse die CDU noch weiter nach rechts abbiegen lassen.

Quelle         :     Der Freitag          >>>>>         weiterlesen

——————————————————————-

Grafikquellen              :

Oben       —           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Synode Dresden: Missbrauch

Erstellt von DL-Redaktion am 14. November 2019

im Evangelischen Kirchenbezirk Ravensburg ?

Bavendorf Ev Kirche 2011b.jpg

Offener Brief von Stefan Weinert an Herrn Dekan Dr. Friedrich Langsam

Sehr geehrter Herr Dekan Dr. Langsam,

sehr geehrte Damen und Herren im Ravensburger

Evangelischen Gesamtgemeinderat,

auf dem Hintergrund der aktuell stattfindenden EKD-Synode in Dresden und der Tatsache, dass es auch aus dem Kirchenbezirk Ravensburg Bewerber/innen für das zukünftige Amt einer/s Synodalen gibt und unter der Prämisse einer schonungslosen Aufarbeitung hätte ich gerne von Ihnen gewusst, ob es auch im Dekanat Ravensburg, Fälle von sexuellen Übergriffen von Pfarrern, Pastoren, Diakonen, Jugendmitarbeitern, Kirchenmusikern oder Ehrenamtlichen gegenüber ihnen anvertrauten Mädchen, Buben und Erwachsenen gab und gibt. Zwar bin ich kein Mitglied der Evangelischen  Kirche und ich frage auch nicht als Christ, der ich zwar bin, sondern als Mitglied der Gesellschaft, die auch die Evangelische Kirche erheblich finanziert. Es kann und darf nicht nur eine gewisse Transparenz in Dresden geben, sondern sie muss in jeder Kirchengemeinde beginnen. Zudem hätte ich gerne von Ihnen gewusst, wie Sie zu dem Thema „Entschädigung“ stehen. Bitte verzichten Sie bei einer etwaigen Antwort auf  Allgemeinplätze und Verweise nach Oben. Danke.
Denn eigentlich – so die Idee ihres Gründers – sollte die Kirche eine für den, durch den Alltag gebeutelten Menschen, entlastende lebendige Bewegung sein. „Einer trage des anderen Last,“ betont deshalb auch der zum Paulus gewordene frühere Christenverfolger, und fährt fort: „So erfüllt ihr das Gesetz Christi.“ Doch die Kirche – und seit 502 Jahren, die Kirchen – sind für die Gesellschaft ganz im Gegenteil  – wie einst Bruno – zum „Problembär“ geworden. Bereits vor einem Jahr (2018), auf der EKD-Synode in Hannover, sagte die Hamburger Bischöfin Kirsten Fehrs: Eine Kirche, die solcher Gewalt nicht wehrt, ist keine Kirche mehr“.
 
Damals berichtete die Bischöfin von Johanna (15) , die ihr berichtete, wie alles anfing. Sie (Johanna) fand es eklig, als der Pastor sie das erste Mal überfallartig küsste und an die Brust fasste.Ein Fall von sexuellem Missbrauch, ein Teil einer Serie in Ahrensburg, einer Kleinstadt nördlich von Hamburg. Die evangelische Kirche habe, so Fehrs, aufgrund ihres  Systems ganz spezifische Risikofaktoren. Sexualisierte Gewalt werde an Kindern und Jugendlichen gegangen, aber auch an Erwachsenen in Beratungsszenarien und Abhängigkeitsverhältnissen. Die Täter seien Pastoren, aber auch Jugendmitarbeiter, Kirchenmusiker oder Ehrenamtliche. Gerade weil in der evangelischen Kirche so viele Berufsgruppen und auch Ehrenamtliche Verantwortung gegenüber Kindern und Jugendlichen trügen, müsse man sie alle in den Blick nehmen. Dazu kämen die vereinsartigen Strukturen der evangelischen Kirche: Oft sei es unklar, wer für was zuständig ist, und weil jeder jeden kenne, rede man nicht öffentlich über die Taten. Es gebe unreflektierte Vermischung von Privaten und Dienstlichem und Einrichtungen, die als „Closed Shops“ geführt würden.
Kerstin Claus ist die erste Betroffene von sexuellem Missbrauch, die vor der aktuell stattfindenden EKD-Synode in Dresden spricht. Die heutige Journalistin, Kerstin Claus, wurde als Jugendliche von ihrem evangelischen Gemeindepfarrer über längere Zeit missbraucht.
 Vor einem Jahr in Würzburg hatte die Synode einen Elf-Punkte-Plan beschlossen. Insgesamt sind der evangelischen Kirche mittlerweile 770 Missbrauchsopfer bekannt. 60 Prozent davon betreffen Fälle aus dem Bereich der Diakonie. 40 Prozent ereigneten sich in Kirchengemeinden. 
 
Einen offenen Dissens gibt es zwischen der EKD und den Betroffenen über die Frage, ob Entschädigungen gezahlt werden sollen. Ein Mitglied des Beauftragtenrats betont, dass die in der katholischen Kirche genannten Entschädigungssummen zwangsläufig zu Auseinandersetzungen über die Beweisbarkeit von Sachverhalten führen könnten, also genau zu den Verfahren, die die Betroffenen über lange Zeit stark belasten und retraumatisieren würden. Bischof Bedford-Strohm sogar meint, sexueller Missbrauch sei ein solch schlimmes Vergehen, dass es mit Geld nicht wieder gut zu machen sei. Anders als es die katholische Kirche seit Jahren tut, wolle die evangelische Kirche keine pauschalen Summen an Opfer zahlen, hatte selbige Bischöfin Fehrs zuvor betont. Wie Claus sagte, gehe es nicht darum, dass die Kirche sich freikaufe. Nötig sei ein lebenslanges Bemühen, den Opfern gerecht zu werden. 
 
Das ist blanker Zynismus und auch Kerstin Claus sieht das anders. Ihr und den Opfern gingen die Schritte der Kirche nicht weit genug. Die evangelische Kirche habe lange gezögert, ehe sie die Missbrauchsproblematik erst 2018 offensiv angegangen habe. Nun müsse die Kirche die Bedürfnisse der Betroffenen in den Mittelpunkt rücken, es sei eine transparente Entschädigungsregelung nötig.Sie meint, sexueller Missbrauch habe vielfältige biografische Folgen. Auch deswegen müsse es solch eine Debatte geben. Vor allem aber ruft die Betroffene die evangelische Kirche zu einem Mentalitätswechsel auf. „Sie und ihre Kirche haben noch immer keine klare Haltung gefunden, was den Umgang mit uns Betroffenen angeht“, sagte Claus vor der Synode und fuhr fort: „Sie werden Ihre Deutungshoheit aufgeben müssen.“ Und dann meldet Claus auch ganz konkrete weitere wichtige Forderungen an: „Täter dürfen nicht weiter im Verkündigungsdienst der Kirche stehen.“
 
Für eine erhellende, transparente und zeitnahe Information wäre ich dankbar.
 
Mit freundlichen Grüßen,
 
Stefan Weinert
———————————————————————
Grafikquellen         :

Oben       —           Evangelischer Friedhof Bavendorf (Ortschaft Taldorf, Stadt Ravensburg) mit der evangelischen Kirche

Abgelegt unter Baden-Württemberg, Kommunalpolitik, Kultur, Religionen | Keine Kommentare »

Das Fanal von Halle:

Erstellt von DL-Redaktion am 13. November 2019

Der neue, alte Antisemitismus

File:MKBler - 393 - Synagogen-Mahnmal (Halle).jpg

von Christian Bangel

Mit den Morden von Halle hat der Judenhass in Deutschland ein neues Fanal gesetzt. Nun kann man hoffen, dass die Tat Wirkung zeigt, dass sie so etwas wie eine Selbstüberprüfung der gesellschaftlichen Mitte auslöst. Doch bisher deutet wenig darauf hin. Stattdessen machte nach den Verbrechen erneut das sedierende Wort vom Einzeltäter die Runde, suchte der Innenminister nach Gründen für die Taten in der Gamingszene.

Doch so viel ist sicher: Stephan B. ist ein Rechtsextremer, und dass er wahrscheinlich allein handelte, darf nicht verschleiern, dass er Erzählungen benutzte, die auch von Rechtspopulisten in Talkshows vorgetragen werden.

Kurz bevor der Mörder sich aufmachte, seine widerwärtigen Phantasien in die Tat umzusetzen, wandte er sich in einem Video an eine globale Blase von Neonazis, Rechtsextremisten und Antisemiten und sagte etwas, das so dumm und hasserfüllt wie bedeutend ist. Er leugnete in dem kurzen Video erst den Holocaust, dann sprach er vom Feminismus, der der Grund für niedrige Geburtenraten im Westen sei, was wiederum zu Massenimmigration führe. Und erklärte, dass „der Jude“ der Grund für all das sei.

Zu wem genau sprach er da? Das Video zeigt, dass B., der zum Teil auf Englisch spricht, offenbar einerseits einer weltweiten, in Foren organisierten Community von Rechtsextremen imponieren wollte. Leuten, die sich in einem Kampf gegen den Islam und die Juden sehen und deren Helden rassistische Mörder wie Breivik und die Täter von Charlottesville und Christchurch sind. Beunruhigend genug. Doch da ist noch mehr. B. versuchte in dem Video nicht nur, Neonazis zu gefallen. Bemerkenswert ist das direkte Nebeneinander seines Antisemitismus mit Thesen, die heute auch innerhalb der AfD-Anhängerschaft weit verbreitet sind. Thesen, die in abgeschwächter Form auch manche, die sich konservativ nennen, in Talkshows vortragen. Der Judenhass des Täters wird in einen direkten Zusammenhang gebracht mit den Narrativen von „Genderwahn“ und „Bevölkerungsaustausch“.

Auch wenn jeder Rechte bei Verstand und nicht zuletzt die AfD sich umgehend so weit möglich von dem Täter distanzierten, so meinte dieser doch offenbar, auch im Sinne jener zu handeln, die daran glauben, dass Angela Merkel und die linken Eliten einen groß angelegten und perfiden Plan verfolgen, die deutsche Bevölkerung auszutauschen. Natürlich kann man als Rechtspopulist behaupten, man habe damit nichts zu tun. Aber der Mörder von Halle benutzt ihre Argumente, er benutzt ihre Worte und ihre Erzählungen.

Nun sind die Neuen Rechten nicht mehr die Neonazis von früher. Sie haben in Deutschland den Durchbruch geschafft, als sie sich konzeptionell vom Nationalsozialismus trennten. Isolierten sich Rechtsradikale früher durch ihre Hitlerei regelmäßig selbst, so lassen sie heute kaum eine Gelegenheit verstreichen, sich von Nationalsozialismus und Antisemitismus zu distanzieren. Wenngleich sie hin und wieder mit Ein- oder Zweideutigkeiten dem faschistischen Teil ihrer Wählerinnen und Wähler zuzwinkern, versuchen sie mit wachsendem Erfolg, sich sogar als die wahren Verteidiger der Juden aufzuspielen. Die Figur, die es dafür brauchte, war der pathologisch antisemitische Muslim. Mit ihm ließ sich die Verächtlichmachung des Islam prächtig hinter dem „Nie wieder!“ der Bundesrepublik verstecken. Wie stark diese Reinwaschung wirkt, kann man daran erkennen, dass die Behauptung, der wahre Antisemitismus sei inzwischen ein zugewanderter, auch in bürgerlichen Milieus wirkt. Der Beitrag von „Springer“-Chef Mathias Döpfner nach dem Anschlag – er schaffte es, den rechten und linken Antisemitismus unter anderem mit einem „einseitigen Verständnis für antisemitische Grundhaltungen mancher muslimischer Einwanderer“ zu begründen[1] – sagt da eigentlich alles.

Der Antisemitismus der AfD braucht keine Juden mehr

Dabei darf und sollte dieser Tage nicht verschwiegen werden, dass in Berlin erst fünf Tage vor dem Anschlag von Halle ein 23jähriger Syrer mit einem Messer in der Hand auf die Wachmänner vor einer Synagoge zulief. Der Judenhass aber wirkt längst wieder in allen Teilen der Gesellschaft. Der Versuch, ihn zu ethnisieren und ihn damit weit weg von der weißen deutschen Bevölkerung zu halten, hilft niemandem außer der AfD. Antisemitismus hat keine Hautfarbe und keine Religion, es gibt ihn unter Linken und unter Rechten, unter Arbeitslosen und unter Superreichen. Er ist die Geißel der menschlichen Zivilisation, seit Jahrtausenden. Doch es hat schon seinen Grund, warum der Zentralrat der Juden immer wieder besonders vor der AfD warnt, vor einem neu aufkeimenden Rassismus, der sich insbesondere gegen Muslime, aber auch gegen Juden richtet. Es ist derselbe Grund, warum auch die sicher nicht linke israelische Regierung jeden Kontakt zu den deutschen Rechtspopulisten verweigert.

HalleSynagoge 01.JPG

Ein Wesenszug des klassischen Antisemitismus liegt in der Bereitschaft, die Juden als eine kollektiv nach einem düsteren Plan handelnde Gruppe zu markieren. Sie als Fremdkörper zu betrachten, der innerhalb einer Gesellschaft seine eigenen Ziele verfolgt, der irgendwann unweigerlich den Niedergang seiner „Wirtsgesellschaft“ auslöse. Ein anderer ist die Beschreibung von Juden als wurzellose, wohlhabende Kosmopoliten, denen die Werte und Normen der Mehrheitsgesellschaft fremd seien.

Beide antisemitischen Erzählfiguren kommen zusammen, wenn die AfD und ihre Anhänger von der demographischen Katastrophe sprechen, die der linke Feminismus ausgelöst habe und die nun handstreichartig durch arabische Massenzuwanderung gelöst werde, unterstützt von linken Bildungsbürgern, die nichts von den Normen und Werten des Normalbürgers wüssten. Nicht viel anderes sagte ja auch der Täter von Halle, bevor er den Juden daran die Schuld gab. So unelegant gehen heutige Rechtspopulisten natürlich nicht vor. Sie überlassen es meist den Zuhörerinnen und Zuhörern, ihre Schlüsse zu ziehen. Der Antisemitismus der AfD braucht keine Juden mehr. Er braucht nur noch die antisemitischen Stereotype.

Doch es ist nicht nur die verbrecherische Tat von Halle, es sind auch kleinere Zeichen, die einen sorgen müssen. Die wachsende Zahl von Leuten beispielsweise, die meinen, Deutschland müsse einen Schlussstrich unter seine Vergangenheit ziehen oder, mit Björn Höcke, eben eine 180-Grad-Wende vollbringen. Die von einem Drittel der Deutschen geteilte Behauptung, die Juden würden den Holocaust zu ihrem Vorteil nutzen. Die völlig unproportionale Anzahl von Deutschen, die behaupten, ihre Vorfahren seien im Widerstand gewesen. All das sind Zeichen dafür, dass viele Deutsche aufgehört haben, sich aktiv mit dem antisemitischen Erbe zu befassen, das in die Katastrophe des Völkermordes an den Juden führte. Wenn sie es denn je getan haben. Stattdessen wird ein lächerlicher Begriff wie „Aufarbeitungsweltmeister“ zum Symbol dieser versteinernden Erinnerungskultur. Als sei die Bewältigung unserer Vergangenheit längst mit Bestnote abgeschlossen und jetzt etwas zum Angeben wie der Tiguan im Carport.

Quelle       :         Blätter           >>>>>        weiterlesen

———————————————————————-

Grafikquellen         :

Oben            —            Auf dem Jerusalemer Platz in Halle an der Saale befindet sich das Synagogen-Mahnmal. Von der 1870 gebauten Synagoge konnte nur das Portal, welches nun das Mahnmal darstellt, erhalten werden, während das sonstige Gebäude in der Reichspogromnacht von den Nationalsozialisten zerstört wurde.

MKBler (CC BY-SA 4.0)

————————

Unten          —        Synagoge in Halle (Saale), Jüdischer Friedhof, Humboldtstraße

Abgelegt unter Deutschland, Innere Sicherheit, Kultur, Sachsen-Anhalt | Keine Kommentare »

Oskars letzter Versuch ?

Erstellt von DL-Redaktion am 13. November 2019

Ganz, ganz viel zu tun

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Von Anna Lehmann

Amira Mohamed Ali wird Nachfolgerin von Sahra Wagenknecht. Das Erbe wird schwer. Denn die Fraktion ist nach der Wahl gespaltener denn je.

Es gab da dieses Bild, kurz nachdem Amira Mohamed Ali am Dienstagnachmittag gegen halb vier zur Fraktionschefin der Linken gewählt worden war. Sie stand im Clara-Zetkin-Saal der Linksfraktion im Reichstagsgebäude, umringt von zwei Herren: zum einen Co-Fraktionschef Dietmar Bartsch und zum anderen Diether Dehm, einst Vorsitzender ihres niedersächsischen Landesverbandes und bis heute einflussreicher Strippenzieher in der Partei. Mohamed Ali lächelte in eine Kamera, Dehm und Bartsch neben ihr reckten die Fäuste. Gewonnen!

Die Szene war eigentlich nicht für die Öffentlichkeit bestimmt, der Fraktionssprecher scheuchte Neugierige schnell wieder aus dem Saal. Diether Dehm veröffentlichte es dennoch auf Facebook. Danach gingen Mohamed Ali und Bartsch aus dem Raum und vor die Presse und sie stand im Rampenlicht. Das erste Mal so richtig, seitdem sie vor zwei Jahren in den Bundestag eingezogen war.

2017 war Mohamed Ali auf Platz 5 der niedersächsischen Landesliste und als fünfte Niedersächsin für die Linke gerade noch in den Bundestag gerutscht. Zwei Jahre später ist sie Fraktionschefin, Nachfolgerin der bekanntesten Linken-Politikerin Sahra Wagenknecht. Eine Traumkarriere als Politikerin. Oder doch eher ein Knochenjob als Trümmerfrau?

Wie tief die Fraktion nach dieser knappen Wahl mit zwei Wahlgängen gespalten ist, zeigte sich im weiteren Verlauf des Nachmittags. Caren Lay, die ihre Kandidatur für den Fraktionsvorsitz als Erste angekündigt hatte, hätte als erfahrenere und bekanntere Kandidatin eigentlich die besseren Karten haben müssen. Die Vizefraktionvorsitzende und mietenpolitische Sprecherin sitzt seit 2009 im Bundestag.

Der Frust entlädt sich

Mohamed Ali ist nun mit Unterstützung des sogenannten Hufeisens ins Amt gekommen, jenes machttaktischen Bündnisses aus Reformern und Partei-Linken, das vier Jahre lang eine knappe Fraktionsmehrheit gesichert hatte. Doch der Groll gegen diese Machtbündnis war in den letzten Jahren gewachsen. Nun bekamen die übrigen Kandidat:innen für den Fraktionsvorstand den geballten Frust über diesen knappen Wahlsieg und das Wirken des Hufeisens zu spüren.

Sahra Wagenknecht and Dietmar Bartsch. Hannover Parteitag 2017.jpg

Vom Winde verweht

Der erste parlamentarische Geschäftsführer Jan Korte erhielt nur 39 von 68 möglichen Ja-Stimmen. Und das, obwohl er im Bundestag souverän auftritt und ohne Gegenkandidat:in angetreten war. Von den sechs potenziellen Arbeitskreisleiter:innen, die sich auf sechs Stellen bewarben, fielen zwei im ersten Wahlgang durch, Fabio de Masi und Heike Hänsel. De Masi wurde im zweiten Anlauf gewählt, Hänsel fiel erneut durch. Bartsch wird drei Kreuze gemacht haben, dass er mit 64 Prozent in einem Rutsch zusammen mit Mohamed Ali gewählt wurde. In einem anderen Wahlprozedere wäre er wohl genauso abgestraft worden.

Quelle          :         TAZ         >>>>>          weiterlesen

Neue Fraktionsspitze der Linken

Der Verfeindungskomplex

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Kommentar von Stefan Reinecke

Politische und persönliche Fehden sind in der Linksfraktion eng verwoben. Genau das kann für die unverbrauchte Mohamed Ali eine Chance sein.

Amira Mohamed Ali, Muslimin und Juristin aus Hamburg, wird zusammen mit Dietmar Bartsch die Linksfraktion führen. Das ist eine erstaunliche Umkehrung des Prinzips demokratischer Elitenauswahl. Eigentlich wird an die Spitze gewählt, wer sich als besonders robust, vertrauenswürdig oder taktisch versiert erwiesen hat. Mohamed Ali ist eine sympathische, eher nachdenkliche denn agitatorische Parteilinke. Doch sie ist erst seit vier Jahren in der Partei und nicht nur in der Öffentlichkeit ein unbeschriebenes Blatt.

Auch in der Fraktion kann sich niemand an wegweisende Beiträge erinnern. Manche behaupten, sie solle Wagenknecht bloß den Sessel warm halten, bis die wieder Lust hat auf den Job. Gewissermaßen das Modell Putin/Medwedjew. Das ist eines jener bösartigen Gerüchte, die ziemlich typisch sind für die giftige Atmosphäre bei den GenossInnen. Die Wahrheit ist: Der linke Flügel hat schlicht niemand anderen gefunden.

Ein Sieg des Bündnisses von Reformern und linkem Flügel, von Bartsch und Wagenknecht gegen Caren Lay und Katja Kipping also? So sieht es aus. Aber die Sache ist komplexer. Die Grenzen zwischen den drei Lagern sind ausgefranst und überlagert von persönlichen Animositäten.

Quelle         :         TAZ         >>>>>          weiterlesen

——————————————————————-

Grafikquellen           :

Oben      —      Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Hamburg, P. DIE LINKE, Überregional | Keine Kommentare »

Elektroautos : Aus Aachen

Erstellt von DL-Redaktion am 12. November 2019

Versucht die fossile Autoindustrie dies zu verhindern?

File:StreetScooter C16.jpg

Quelle       :     Scharf  —  Links

Von Walter Schumacher

Vor über 100 Jahren wurden in Aachen schon mal Autos hergestellt [1].
Seit 2014 gibt es erneut eine Autoproduktion: mit dem „Streetscooter“ und dem e.Go“ werden zwei besonders sinnvolle Elektro-Auto-Typen [2] entwickelt, serienreif gemacht und hergestellt, die wirklich beispielhaft sind für „vernünftige“ E-Autos! [3]

Während einerseits alle politischen und wirtschaftlichen Indikatoren in Richtung eines großen Erfolgs für das Produkt stehen, kommen aber weder die Produktion noch die Auslieferung dieser Fahrzeuge richtig in Gang!

Manipuliert die „fossile“ Autoindustrie die Herstellung vernünftiger Elektro-Autos?

Als kraz beobachten wir diesen erstaunlichen Widerspruch schon seit langem und stellen uns die Frage: Wird die Produktion vernünftiger E-Autos in Aachen gewollt behindert? Und warum könnte das geschehen?

Vorweg das Besondere an Streetscooter und e.Go

  • Der erste war der „Streetscooter“ (10/2015). Er ist ein Elektro-Lieferwagen und es gibt ihn in zwei Größenvarianten: „klein“ wie ein VW-Transporter und „groß“ wie ein Mercedes-Sprinter. Es ist ein zweckmäßig konstruiertes, einfaches Fahrzeug. Die Einzelkomponenten sind weitestgehend Standardprodukte.
    Er passt perfekt in das Anforderungsprofil „Versorgungs- und Arbeitsfahrzeuge im Nahbereich“ (<150km) mit vielen Zwischenhalten, Rückkehr zu einem festen Standort und einem Fahrzeugpool bei flexibler Nutzung von Firmen. Ein perfektes Fahrzeug für ALLE städtischen und regionalen Lieferdienste.
    Die Streetscooter gingen sehr schnell an die Kunden. Seither laufen etwa 10.000 Fahrzeuge in einem harten Alltagsbetrieb. Es sind keine bemerkenswerten Produktionsfehler bekannt geworden.
  • Das zweite Aachener Fahrzeug ist der „e.Go“ (seit 2016), ein kleiner Stadtwagen. Vom Raumangebot her ist er zwischen Smart und Fiat 500/VW Lupo angesiedelt. Technisch ist er komplexer als der Streetscooter, basiert aber auf den Erfahrungen bei dessen Entwicklung. Auch hier werden sehr einfache Komponenten verwendet. Es gibt keine technisch-sachlichen Gründe für Lieferprobleme der Komponenten (außer: man will nicht liefern). Ebenso wenig sind Probleme bei der Zulassung des Wagens bekannt.
    Das Anforderungsprofil ist gezielt für den innerstädtischen Ein-/Zwei-Personenverkehr konzipiert; entweder als Firmenpool-Wagen oder aber als privater Zweitwagen. Mit einem Preis von <20.000€ ist der e.Go deutlich preiswerter als die heutigen anderen E-Autos!

Beide Wagen sind auf ein Käuferpublikum mit folgenden Eigenschaften ausgerichtet: Zweckmäßige Nutzung eines Fahrzeugs, ökologische Orientierung, kein Bedarf an psychologischem Imageaufbau/Protzen (ich-bin-männlich, ich-bin-sportlich, ich-bin-reich).
Diese positive Bewertung bezieht sich ausdrücklich auf das genannte Nutzersegment. [3] Es sind keine klassischen Allzweckautos – da müsste sich noch deutlich was an der Batterietechnik tun. Aber für die genannten Nutzungssegmente gibt es zur Zeit nichts besseres als diese beiden Wagentypen!

==> Hierzu ein positiver Bericht in Auto-Motor-Sport

Die bisherige (kurze) Geschichte von Streetscooter und e.Go

  • Der „Streetscooter“ startete 2014 fulminant und machte ansehnliche Produktionszahlen. Die Firma (Produktionsanlagen) wurde 2014 von der Post AG aufgekauft und sogar noch in Düren durch ein zweites Werk erweitert – und dann würde es plötzlich ganz ruhig um den Wagen.
    Anfangs war er ein Verkaufsrenner. Die Post hat über 10.000 Fahrzeuge im Einsatz, man sieht das Fahrzeug aber auch bei anderen Lieferdiensten. Trotz dieser Erfolge wird der Streetscooter mittlerweile als Sorgenkind präsentiert, Gerüchte besagen, dass die Post das Werk wieder verkaufen will.
  • Den „e.Go“ gibt es seit 3/2017. Seit 5/2017 kann man den Wagen prinzipiell! kaufen. Und mittlerweile arbeiten 500 Leute in dem e.Go-Werk – aber der Wagen wird einfach nicht ausgeliefert!
    Seit mindestens 11/2018 gibt es auf der Hohen Straße in Köln einen großen ‚e.GO Pop-Up Store‘, in dem systematisch Werbung für den Kauf des e.Go macht. Die Verantwortlichen werden das Geld dafür doch nur in die Hand genommen haben, weil sie selber den baldigen Verkauf des Wagens erwartet hatten.
    Stattdessen werden halbjährlich Ausreden für die Nicht-Auslieferung veröffentlicht und die (willigen) Kunden immer wieder vertröstet. Ursprünglich sollten 3000 Fahrzeuge bis Ende 2019 produziert werden. Die Auslieferung ist aber erneut ins Jahr 2020 verschoben worden.
    Den e.Go gibt es „theoretisch“, aber aus irgendwelchen dubiosen Gründen ist er einfach nirgends zu kaufen! Auch der OB Philips wartet nach eigener Aussage immer noch auf „seinen“ e.Go!

Warum also Probleme – bei beiden E-Fahrzeugen?

Diese mysteriöse Geschichte über „Produktionsprobleme“ wird halbjährlich in den lokalen Zeitungen mit wortreichen Ausreden und erstaunlichen Meldungen begründet. Die letzte Überschrift dazu lautet am 19.10.2019 in den AN „e.Go räumt Produktionsprobleme ein.

  • Zu Problemen beim „Streetscooter“ ist (öffentlich) nichts bekannt!
  • Beim e.Go werden öffentlich folgenden Gründe genannt:
    • Der Lieferant ‚Ford‘ liefert nicht. (Was, welche Teile und warum? Ist unklar)
    • Der Batterielieferant ‚BMZ‘ ziert sich mit Lieferungen.
    • Und echt witzig: in den AN vom 19.10.19 wird eine „IP67-Regel für technische Geräte“ zitiert, die folgende skurrile Auflage enthält: „technische Geräte müssen auch nach einem mind. 30 minütigem Tauchbad im bis zu einem Meter tiefen Wasser voll funktionsfähig sein“. Und weil Lieferkomponenten diese Regel nicht erfüllen, darf der e.Go nicht gebaut werden?? Hmm!?

Es gibt ein ganz anderes, aber echtes Problem beim e.Go

Dort entstehen monatliche Unkosten von 2-3 Mio Euro! Seit Monaten sind dort ca. 500 Leute beschäftigt, was bei e.GO mindestens 2-3 Mio Euro Kosten, ohne jedwede Einnahmen erzeugt. Es müsste also ein Kostenproblem existieren – das aber öffentlich NICHT problematisiert wird.

Wieso führt das eigentlich nicht zum Bankrott? Wer bezahlt das?
Sorgt VW dafür, dass das Werk nicht pleite geht? Sorgt VW für Ruhe an den Arbeitsplätzen (wo ja faktisch nicht produziert wird) und „erkauft“ sich (wörtlich) so die Zeit, um seine wesentlich teureren Modell an den Markt bringen zu können? Die Erklärung könnte in der „Strategischen Partnerschaft“ von VW und e.Go liegen (siehe weiter unten).

Unsere Vermutung:
Es gibt einen Boykott der Auto-Industrie gegen ein vernünftiges E-Auto!

Je öfter sich die Ausreden für die Nicht-Lieferung des e.Go wiederholen, desto mehr fragen wir uns, ob wir gerade Zeugen werden, wie die (fossile) deutsche Autoindustrie mit trickreichen Mitteln verhindert, dass endlich mal vernünftige Elektro-Autos (statt der gigantischen E-SUVs) auf den Markt kommen?

Wir haben deshalb mal zusammengestellt, was wirklich hinter dieser eigenartigen und für Aachen (als perspektivischem Produktionsstandort) etwas bitteren Geschichte stecken könnte.

Indizien für eine „gewollte Produktionsbehinderung der sinnvollen E-Autos“

Unser Denkansatz lautet: Die Produkte Streetscooter und e.Go sind (vom Timing und der Funktionsweise) viel zu gut, sodass sie den ganz Großen in der Automobilbranche als Konkurrent echten ökonomischen Ärger machen und deshalb auf dem Markt stark „eingehegt“ oder besser noch „verhindert“ werden müssen. Möglicherweise hatte die fossile Autoindustrie beim Streetscooter noch erwartet, dass die RWTH-Newcomer es nicht schaffen würden. Aber nachdem der Streetscooter dann doch ein Erfolg wurde, wollten sie beim e.Go „besser aufpassen“. Die folgenden Argumente gelten für beide Fahrzeuge.

  • „Zeit schinden, um noch ein/zwei Jahre fossile Autos verkaufen zu können“ (= ExtraProfit-sichern). Jeder Monat spätere Auslieferung guter E-Autos schafft „Zeitraum“ für den Verkauf weiterer (gewinnbringender) Fossil-Autos.
  • „Zeit schinden, um als erstes Protz-E-Autos verkaufen zu können“ (=ExtraProfit-sichern). Solche sinnvollen E-Autos kommen für die fossile Autoindustrie „zu früh“, weil:
    • der Markt für dicke E-SUVs & schnelle E-PKW frei bleiben soll. Leute mit viel Geld wollen sich ein „grünes Image“ kaufen und zahlen dafür auch gerne viel Geld ….
    • erst nach Abdeckung dieses Marktanteils, „lohnt“ sich auch die Belieferung des preiswerteren Marktsegments.
      Sobald einmal der e.Go für 16.000 – 19.000 € auf der Straße zu sehen sein wird, brechen mit Sicherheit die Verkaufszahlen all der wunderschönen E-Golfs E-Opels, E-BMW, E-Benz ein, die zwar (sinnloserweise) in 3 Sek von Null auf 100 km/h „können“, aber preislich mindestens ein/zwei Klassen teurer sind.
  • „Diskreditieren“
    Diese Protz-E-Autos werden die Diskussion um die E-Mobilität bestimmen, weil viele ernsthafte Umweltschützer leider ausschließlich den Irrsinn der Protz-E-Autos sehen werden. Die Relevanz von sinnvollen E-Autos wird dann (wie beabsichtigt?) in den Hintergrund gedrängt.
  • „E-Auto als Spielzeug“?
    siehe zusätzlich auch den Artikel „Produziert e.Go Mobile bald ein VW-Funcar?

Eine vergiftete „strategische Partnerschaft“ mit VW?

Es gibt eine vertraglich/kommerzielle Verbindung zwischen VW und e.Go, die ebenfalls für die von uns unterstellte, bewusste Behinderungs-Strategie spricht: Wir wissen, VW will e.Go als Basis für die eigene, zukünftige E-Mobilitätssparte haben. (In den AN vom 5. März 2019 heißt es dazu: „… Der Weltkonzern öffnet seinen Elektrifizierungsbaukasten (MEB), mit dem es ab 2020 die neue Generation von Elektroautos bauen will, … e.GO ist weltweit der erste Partner in der Elektrosparte … Das Aachener Unternehmer profitiert doppelt von der Kooperation: Zum einen kann der Baukasten in die gerade anlaufende Produktion des eigenen e.GO life integriert werden. Und beide Unternehmen entwickeln in den kommenden Monaten gemeinsam ein Elektro-Auto, das die VW-Flotte ergänzen soll….“ (https://www.aachener-nachrichten.de/nrw-region/kooperation-von-ego-und-vw-neue-elektroautos-in-aachen-produziert_aid-37182963)

Das würde einerseits erklären, wer und warum die Übernahme der aktuell entstehenden Kosten übernimmt. Unfreundlich formuliert ist das dann ein „Leerlauf-Geld“ oder „Bestechungsgeld“ von VW, damit im Aachener e.Go-Werk Ruhe herrscht und man „freiwillig“ nicht liefert, um so den Markt für die in 2020 kommenden (erhofften) VW-Modelle „frei“ zu halten.

Beides macht Sinn für VW: Einerseits so den gefährlichen Newcomer klein halten; gleichzeitig sich dessen Know-how für die eigenen (eigentlich zu spät) kommenden Goliath-Aufgaben an zu eignen!

Es KÖNNTE aber auch ganz anders sein…

Es gibt doch echte Probleme bei der Produktion – eine simplere Erklärung?
Dann wären die Produktions- und Auslieferungsverzögerungen Ergebnis echter Probleme und zeigen nur, dass eine RWTH (bzw. das kommerzielle Spin-Off) nicht in der Lage ist, ein sinnvolles verkäufliches Produkt zu entwickeln, technisch zu planen und zu produzieren. Wir von der kraz glauben DAS nicht.

Zum Schluss eine Bitte

Wir haben versucht, eine wichtige Wirtschaftsentwicklung in Aachen zu beschreiben. Uns fehlen eine Reihe von Fakten, wir haben nur „mögliche“ Erklärungen geliefert. Unsere LeserInnen mögen selber entscheiden, was da eigentlich los ist.

Als kraz-Redaktion würden wir uns aber freuen, wenn wir Insider-Informationen bekämen, die unsere genannten Thesen entweder stützen oder aber widerlegen. Uns geht nicht um das „Recht-Haben“, wir wollen „verstehen“.

Anmerkungen

[1] Zur Geschichte der Aachener Auto-Produktion
Zu Beginn des vorigen Jahrhunderts (1903) gab es eine Automobilproduktion in Aachen durch die Firmen Fafnir und Cudell. Aber schon 1926 war alles wieder vorbei. Deshalb war es schon eine Sensation, als Streetscooter und e.Go als Spin-Offs der RWTH neu auftauchten.

[2] Das Missverständnis im Namens „Elektro-Auto“
Ein Elektro-Auto heißt so, weil der Antrieb „elektrisch“ ist. Der Strom für den Antrieb kann prinzipiell auf unterschiedliche Art ins Fahrzeug gelangen (Straßenbahnen und O-Busse bekommen ihn per Oberleitung). Bei Autos ist der heutige Standard eine (Lithium)-Batterie. Sie könnten aber genauso gut durch Brennstoffzellen (Wasserstoff) mit Strom versorgt werden! Eine (veraltete) Zwischenlösung war ein kleiner fossiler Motor im Fahrzeug, der dessen Batterie und damit die Elektromotoren mit Strom versorgt.

[3] Unser hohes Lob für den Streetscooter und den E.Go könnten so wirken, als ob wir E-Autos für DIE Lösung der städtischen oder gesellschaftlichen Problematik des Autoverkehrs halten.
Nein, wir wissen sehr wohl, dass Elektrofahrzeuge auch den gleichen Platz verbrauchen, den Fuß- und Radverkehr gefährden und verdrängen, die Städte mit Lärm verpesten usw. usf.. Elektroautos sind nur in einigen Bereichen ein echter Fortschritt gegenüber den fossilen Autos. In anderen sind sie genauso schlecht und für das „schlechte Gewissen bei der Autonutzung“ sind E-Autos sogar eher verführerisch, um sich so ein reines Gewissen zu verschaffen!
Wir wissen, dass die wirkliche Lösung ein anderes Verkehrskonzept (= anderer Modalsplit) mit viel mehr Öffentlichem Verkehr (ÖV) sein muss und sein wird. Hierzu gab und gibt es in Aachen Überlegungen („Renaissance der Tram“), über die wir in einem längeren Artikel berichten werden.

Datei:Streetscooter 3.JPG

ABER: Wir wissen auch, dass die Umformung unserer Lebenswelt in Auto-gerechte-Städte – und leider auch des „Denkens“ der Menschen im Sinne einer ‚Windschutzscheibenperspektive‘ – „erfolgreich“ gesteuert durch die Profitlogik der Autoindustrie gelungen ist und dass mit dem aktuellen Höhepunkt der Perversion durch SUVs und der aktuellen Automode mit den hochgeschürzten, aggressiven Frontpartien der Autos eine spezielle Form der „Männlichkeit“ bedient wird.

Deshalb wird es – egal wie schnell ein deutlich besserer ÖV entwickelt wird – noch lange individuell fahrende Autos geben, die bestimmte Bereiche in den Städten und Regionen mit Autos statt mit ÖV bedienen. Unklar ist, wie lange es noch dauert, bis die selbstgesteuerten durch autonom fahrende Fahrzeuge ersetzt werden. Und spätestens DANN wird ein hoher Bedarf an elektrischen – statt fossilen Antrieben bestehen.

Deshalb wünschen wir uns jetzt schon die beschleunigte Entwicklung der Elektroautos – und gerne auch Aachen als die Stadt, in der die Vorreiterfahrzeuge entwickelt und produziert werden. Heute polemisieren noch nur noch genau diejenigen gegen E-Fahrzeuge, die bisher immer die fossile Industrie und ihre Protz-Autos erhalten wollten. Wenn sie dabei heute das Argument „mehr ÖV“ verwenden, ist das nur verlogen. Wir sagen das aus Kenntnis der Verkehrspolitik der letzten 35 Jahre, die sich an zwei wichtigen Lobbyorganisation manifestiert hat: Dem ADAC (als reine Autolobby) und dem VCD (=Verkehrsclub Deutschland), der sich seit seiner Gründung 1986 eindeutig für ein sinnvolles Miteinander ALLER Verkehrsteilnehmer: Fußgänger, Radfahrer, ÖV-Nutzer und Autofahrer einsetzt.

Quelle: https://www.kraz-ac.de/elektroautos-made-in-aachen-5974

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen          :

Oben           —         Prototyp StreetScooter Leichtelelektromobil     C 16

Author Franz Haag

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

——————————-

Unten      —          Streetscooter – Ein batteriebetriebenes Lieferfahrzeug für die Deutsche Post, gebaut in Aachen von der Talbot Services GmbH

Urheber RudolfSimon

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Medien, Nordrhein-Westfalen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Linker Krieg oder Frieden

Erstellt von DL-Redaktion am 11. November 2019

Die Linke vor der Wahl:

Wagenknecht, Sahra, 2013.JPG

Sekt oder Selters ?

Aus Berlin Anna Lehmann

Am Dienstag wählt die Fraktion eine Nachfolgerin für die scheidende Fraktionschefin Sahra Wagenknecht. Doch es geht um mehr: Gelingt der zerstrittenen Fraktion ein Aufbruch?

Sahra Wagenknecht geht es anscheinend gerade richtig gut. Die Fraktionschefin wirke entspannt und gut gelaunt, berichten Abgeordnete. Als die Linksfraktion am vergangenen Dienstag über den Klimaaktionsplan stritt und sich die Sprit-Junkies und die Auto-Hasser in der Fraktion gegenseitig Ignoranz vorwarfen, habe Wagenknecht vermittelt: Es sei doch klar, dass man die Akzeptanz des Klimaschutz stärken müsse, auch bei denen, die nicht bei Fridays for Future mitmarschierten.

Wagenknecht hat, so scheint’s, endlich in ihre Rolle als Fraktionsvorsitzende gefunden. Und das in den Tagen ihres Abgangs. Am Dienstag wird die Fraktion Wagenknecht nach vier Jahren an der Spitze als Fraktionschefin verabschieden. Bereits im März hatte sie angekündigt, dass sie den Posten abgeben wird, wegen Stress und Überlastung.

Es zog sich länger als geplant, Wagenknecht absolvierte noch pflichtgemäß Wahlkampftermine für die Europawahl sowie in Sachsen, Brandenburg und Thüringen. Bis zu dieser letzten Wahl hatte sich die Partei strikte innerparteiliche Ruhe verordnet.

Ab Dienstag darf Wagenknecht endlich wieder einfaches Fraktionsmitglied sein und die Linke wählt eine neue Fraktionsspitze.

Es geht um viel, um viel mehr als die Nachfolge der populären und polarisierenden Spitzenfrau. Die Neuwahl ihres Führungspersonals wird für die Linke auch zu einer Bewährungsprobe: Versinkt die Fraktion erneut im Machtkampf der verfeindeten Lager – grob umrissen in die Truppen um Parteichefin Katja Kipping und die Getreuen von Sahra Wagenknecht und Dietmar Bartsch. Oder nehmen die Linken nach zwei zerstrittenen Jahren und drei verlorenen Wahlen den kleinen Aufschwung der Thüringer Landtagswahl mit und zeigen, dass sie interne Auseinandersetzungen solidarisch und zivilisiert klären können. In Thüringen ist die Linke Ende Oktober erstmals in ihrer Geschichte stärkste Partei geworden. Das Grundrezept: ein überaus beliebter Ministerpräsident und eine Partei, die geschlossen hinter ihm stand.

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–103.jpg

Leicht wird es nicht, diesen Schwung mitzunehmen. Wagenknecht hinterlässt eine zerrüttete Fraktion. Sie ließ kaum eine Gelegenheit aus, die Migrationspolitik der Partei und den Kurs der Parteiführung öffentlich in Frage zu stellen. Innerparteiliche Diskussionen mied sie, lieber gründete sie die Sammlungsbewegung „Aufstehen“, die Menschen zusammenbringen und den etablierten Parteien Druck machen sollte. Das scheiterte.

Die Parteivorsitzenden Kipping und Bernd Riexinger wiederum ließen sich auf einen Dauerstreit mit Wagenknecht und ihren Fans ein und damit zu, dass die Linke sich öffentlich zerlegte. Eine Fortsetzung dieses Dramas ist nicht ganz ausgeschlossen.

Leicht wird es nicht: Sahra Wagenknecht hinterlässt eine zerrüttete Linksfraktion

Zwei Frauen haben ihre Kandidatur für den weiblichen Part der Doppelspitze angekündigt: Caren Lay und Amira Mohamed Ali. Lay, die Vizefraktionsvorsitzende und mietenpolitische Sprecherin ist, stammt aus Rheinland-Pfalz, ihr Wahlkreis aber ist seit Langem Bautzen in Sachsen. Sie zählte mal zur „Jugendbrigade“ um Katja Kipping. Vielen gilt sie wegen ihrer Nähe zur Parteichefin als Teil des Konflikts. Lay bemüht sich jedoch gerade um Distanz zu Kipping und betont gern, dass sie sich nicht als deren Anhängsel verstehe.

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Mohamed Ali ist in Hamburg geboren und lebt seit vielen Jahren in Oldenburg. Sie arbeitete als Rechtsanwältin, bevor sie vor zwei Jahren über die niedersächsische Landesliste in den Bundestag einzog. Als verbraucherpolitische Sprecherin hielt sie dort engagierte Reden für die Kennzeichnung von Nahrungsmitteln und gegen falsche Subventionen an Landwirte, denen allerdings nicht mal ihre eigene Fraktion vollzählig beiwohnte. Mohamed Ali soll von Diether Dehm, der Wagenknecht verehrt und Kipping verteufelt, zur Kandidatur überredet worden sein.

Quelle          TAZ          >>>>>           weiterlesen

——————————————————————

Grafikquellen           :

Oben     —         Sahra Wagenknecht während einer Wahlkampfveranstaltung zur Bundestagswahl 2013 auf dem Friedensplatz in Bonn

2.)  von Oben      —             Bundesparteitag Die Linke 2018 in Leipzig

———————————–      — 

Unten         —             Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

Schöner Kämpfen in Berlin:

Erstellt von DL-Redaktion am 10. November 2019

Das Hauskollektiv der K9

File:Berlin-Friedrichshain Kinzigstraße.jpg

Quelle       :        untergrund-blättle CH.

Von kinzig 9

Die Geschichte der Hausbesetzung an der Kinzigstrasse 9. Das Haus an der Kinzigstrasse 9 in Berlin ist mehr als ein reines Wohnprojekt. Es ist der Versuch, gemeinsam ein anderes Leben jenseits von gesellschaftlichem Anpassungsdruck, Vereinzelung und Entpolitisierung zu ermöglichen. Nach jahrelanger Besetzung wurde das Haus gekauft und in ein Genossenschaftsmodell überführt.

Im Jahre 1874 wurde die Kinzigstrasse strassenbaulich und planerisch erschlossen. Bereits 1881 errichtete man eine Remise, Ställe und kleinere Lagerschuppen auf dem Grundstück. Auf den Fundamenten dieser Erstbebauung entstanden später der Seitenflügel und die heutige Remise. Die für den damals noch Kolonie Friedrichsberg genannten Berliner Vorort rund um die Kinzigstrasse typische Bebauung mit kleineren Manufakturgebäuden und Ställen kann heute noch auf den benachbarten Grundstücken Kinzigstr. 25-29 besichtigt werden.

Die Entstehungszeit 1874 – 1900

1892/93 wurden die heute erhaltenen fünfgeschossigen Gebäude auf dem Grundstück Kinzigstrasse 9 (damals noch Blumenthalstrasse 42) unter der Leitung des Zimmerermeisters W. Schlundt errichtet. Auftraggeber war Tischlermeister T. Weinrich. Vorderhaus und Seitenflügel wurden als Wohngebäude, das Quergebäude als Fabrikgebäude für Weinrichs Tischlerei errichtet. 1893/94 wurden die noch vorhandenen Schuppen im Hof abgerissen und durch die heute vorhandene zweigeschossige Remise ersetzt.

Das Vorderhaus wurde im historisierenden Stil des Neobarock gestaltet. Die aufwändig gestaltete, repräsentative strassenseitige Stuckfassade enthält neben hauptsächlich barocken auch Renaissance-Motive und ist heute noch in weiten Teilen erhalten. Während die Strassenfassade in den ersten acht Jahren keinen Farbanstrich erhielt, wurden für die Innengestaltung, vor allem der Treppenräume des Vorderhauses, aufwändige Handmalereien angebracht. Für die damalige Zeit ebenso aufwändig und entsprechend kostspielig fielen die Tischlerarbeiten aus, welche in weiten Teilen erhalten geblieben sind. Auffällig ist auch die für den Erbauungszeitraum ungewöhnlich massive Bauweise mit preussischen Kappendecken und diversen Stahlkonstruktionen im Quergebäude und äusserst soliden Holzbalkendecken im Vorderhaus.

Ab 1894 wurde im grossen Laden im Vorderhaus rechts, sowie im Erdgeschoss des Seitenflügels eine Schlachterei betrieben. Im Hof wurde geschlachtet und Wurst gemacht. Der kleine Laden wurde zunächst von einer Blumenhandlung, später aber durchgehend als Wohnung genutzt. Im Quergebäude betrieben mehrere Tischlereien Manufakturen, die Remise diente als Holzlager.

Die Wurstfabrik 1901 – 1945

1901 erwarb ein Schlächtermeister das gesamte Gebäude und begann das Quergebäude zur Wurstfabrik umzubauen. Die räumliche Nähe zum Viehhof an der Eldenaer Strasse machte diese Nutzung lukrativ. Mehrere Räucherkammern und grosse Wurstkessel wurden eingebaut, die Remise zum Pferdestall umgebaut.

1910 erwarb der Schlächtermeister Ernst Remané das Gebäude. Remané besass noch mehrere andere Gebäude. Die Kinzigstrasse wurde jedoch zum Stammsitz der Familie ausgebaut. Bereits im Jahre 1911 liess er umfangreiche Umbauten am Gebäude vornehmen. Das 1. OG des Vorderhauses und des Seitenflügels wurde zur herrschaftlichen Wohnung mit grossem Salon, Badezimmer und gefliester Dienstbotenküche umgebaut. Aufwändige Mosaikparkett- und Linoleumböden, teure Linkrusta-Tapeten sowie neue Deckenstuckelemente wurden in die Wohnung eingebaut. Die Vorderhaus–Treppenräume wurden vermutlich zu dieser Zeit mit kostspieligen Jugendstilmalereien neu gestaltet. Diese Malereien sind heute als Nachbildung wieder im Treppenhaus vorhanden. Zur selben Zeit wurden auch alle hofseitigen Fenster einschliesslich der des Quergebäudes mit neuen Jugendstil- Profilen versehen.

Schon 1910 liess Remané einen grossen Lastenaufzug am Quergebäude montieren. Dieser wurde vermutlich im 2. Weltkrieg zerstört, seine Lage ist aber heute noch an fehlenden Gesimsteilen des Quergebäudes zu erkennen. Bis zum 2. Weltkrieg wurde die Nutzung des Gebäudes als Wurstfabrik immer weiter intensiviert. Bald wurde die linke Hälfte des Seitenflügels in die Produktionsstätten integriert. Das Quergebäude wurde vom Keller bis unter das Dach mit Kühlräumen und Räucherkammern versehen, die Kellerräume des Seitenflügels dienten als Schweineställe, die des Vorderhauses teilweise als Kühl- und Lagerräume. Der grosse Laden im Vorderhaus wurde zum geräumigen Verkaufsraum, die Remise zum Schlacht- und Brühraum ausgebaut.

Im Hof wurden zahlreiche Kochkessel, Lagerschuppen und Sickergruben errichtet. Die meisten dieser Ein- und Umbauten waren illegal, was 1929 die Bauaufsicht zu mehreren Anzeigen veranlasste. Das Quergebäude erlitt vermutlich zu dieser Zeit durch die zu grossen Lasten der Wurstkessel und stark überdimensionierten Feuerstätten schwere, statisch relevante Bauschäden, welche bei der Sanierung im Jahre 2000 zu erheblichen technischen Problemen führten.

Friedrichshain, Berlin, Germany - panoramio (74).jpg

Die Wohnverhältnisse in der Kinzigstrasse 9 waren exemplarisch für die soziale Situation in Berlin am Beginn des 20. Jahrhunderts. Während die Eigentümerfamilie unter luxuriösen Verhältnissen ein ganzes Geschoss des Hauses bewohnte, lebten in den anderen Geschossen bis zu fünf Familien unter extrem ärmlichen Bedingungen. In der Kinzigstrasse 9 existierten von Beginn an so genannte 2-Generationen-Wohnungen, in denen sowohl die Eltern, als auch Tochter und Schwiegersohn mit Kindern und Grosseltern in einer gemeinsamen Wohnung bestehend aus zwei Küchen und zwei Zimmern lebten.

Eine dieser Wohnungen ist heute noch weitgehend im 2.OG des Vorderhauses erhalten. In einer solchen etwa 60qm grossen Wohnung lebten bis zu 12 Personen. Die Toiletten lagen teilweise in den Treppenhäusern, zum Teil aber auch im Hof. Die hygienischen Bedingungen in der Kinzigstrasse 9 waren katastrophal. Schriftliche Berichte von Mietern der damaligen Zeit beschreiben, dass es aufgrund der Dampf- und Rauchentwicklung durch die Wurstfabrik nie möglich war, über den Hof, geschweige denn in den Himmel zu blicken. Einzelne Wohnungen grenzten direkt an schlecht isolierte Kühlräume und waren dadurch nicht ausreichend zu beheizen. Das ganze Jahr hindurch wurden die Schlachtabfälle offen im Hof gelagert. Mehrere Fälle von Tuberkulose sind aktenkundig. Die Gesundheitsbehörden wurden mehrfach in der Kinzigstrasse 9 aktiv.

Über die Verhältnisse im Haus während des Nationalsozialismus ist wenig bekannt. Nachweisbar ist nur, dass Eigentümer Remané noch in den dreissiger Jahren das gesamte Vorderhaus-Treppenhaus im expressionistischen Stil der damaligen Zeit neu streichen liess. Diese Wandbemalung ist in ihrer aufwändigen Gestaltung die einzige heute in Berlin bekannte, da zu jener Zeit in der Regel nicht die notwendigen finanziellen Mittel für solche Arbeiten vorhanden waren. Im 2. Weltkrieg wurde der Dachstuhl des Quergebäudes zerstört. Ansonsten erlitt die Kinzigstrasse 9 keine relevanten Kriegsschäden.

Die Lederwarenfabrik 1945 – 1980

Nach dem Krieg wurde das Quergebäude zunächst von einer Firma für Maschinen- und Anlagebau genutzt. 1954 liess die Tochter des ehemaligen Eigentümers Brunhilde Waschke geb. Remané das Quergebäude für die Lederwarenfabrik Ludwig Georg Lumpe umbauen und fast alle noch von der Wurstfabrik vorhandenen Einbauten entfernen. Das Erdgeschoss des Seitenflügels diente als Büroraum, die Remise als Lagerschuppen. 1962 wurde auch der grosse Laden im Vorderhaus für die Lederwarenfabrikation umgebaut. Im gleichen Jahr wurde auch die Sichtmauerwerksfassade des Quergebäudes verputzt. Dazu wurden alle Gesimse abgeschlagen und grosse Teile des Sichtmauerwerks schwer beschädigt. Diese Fassade wurde im Jahr 2000 aufwändig rekonstruiert.

Verfall und Abrissplanung 1980 – 1989

Zu Beginn der 80er Jahre begann die Kommunale Wohnungsverwaltung (KWV) mit der Umgestaltung der Wohnblöcke südlich der Frankfurter Allee. Geplant war der Abriss fast sämtlicher Altbauten von der Niederbarnimstrasse bis zum S-Bahnhof Frankfurter Allee und deren Ersetzung durch Neubauten in industrieller Plattenbauweise. Das Planungskombinat des so genannten „Baufeld Nr. 5“ sollte ursprünglich in der Kinzigstrasse 9 residieren.

Die dafür geplanten Umbauten wurden jedoch nie realisiert. Während sich die Eigentümerin die 80er Jahre hindurch beharrlich gegen ihre Enteignung wehrte, wurde in der Umgebung ein Häuserblock nach dem anderen gesprengt. Teile des Gebäudes standen nun leer. Der Seitenflügel wurde baupolizeilich gesperrt. Das Quergebäude wurde zunächst von einer Firma für Elektroarbeiten, später durch eine Schlosserei und für Lager- und Unterkunftsräume des VEB Bau genutzt.

Die Kinzigstrasse 9 wurde zur Sprengung vorbereitet. Davon zeugen heute noch die rot-weissen Sprengzeichen an der Strassenfassade, sowie ein Sprengschlitz unterhalb des untersten Fassadengesimses. Aufgrund der Verzögerungen bei der Zwangsenteignung endete die Neubaustelle zunächst in der Kinzigstrasse 7. Am 30.September 1989 wurde Brunhilde Waschke rechtskräftig enteignet und in ein Altenwohnheim umgesiedelt. In der Folgezeit stand das Haus vollständig leer. Im Mai 1990 wurden die Häuser Kinzigstrasse 11-15 gesprengt.

Die Zeit der Hausbesetzung 1990 – 1999

Am 4. August 1990 verhinderte die Besetzung des Gebäudes schliesslich die Sprengung. Die Kinzigstrasse 9 wurde aus einer Grossdemonstration gegen die Wohnungspolitik des Berliner Magistrats heraus und mit massgeblicher Unterstützung von Hausbesetzern aus der benachbarten Mainzer Strasse besetzt. Zu diesem Zeitpunkt waren die Plattenbauten gegenüber und neben dem Haus noch im Bau. Der Grund für die Besetzung der Kinzigstrasse 9 war nicht nur die drohende Sprengung, sondern auch die umfangreichen Möglichkeiten, die die grossen Räume im Quergebäude boten.

In der Folge diente das Quergebäude sowohl für Tagungen des Berliner Besetzerrates, als auch für Parties und andere grössere Veranstaltungen. Während der militärischen Räumung der besetzten Häuser in der Mainzer Strasse vom 12. bis 14. November 1990 existierte auch ein Räumungstitel für die Kinzigstrasse 9, der jedoch – vermutlich wegen logistischer Probleme der Berliner Polizei – nicht umgesetzt wurde. Dennoch verliess die ursprüngliche Besetzergruppe noch im November desillusioniert das Haus. Die Kinzigstrasse 9 stand daraufhin für kürzere Zeit wieder leer.

Im Winter 1990/91 wurde das Haus Stück für Stück von kleineren Besetzergruppen und Einzelpersonen bezogen, die jedoch keine zusammenhängende Hausgruppe darstellten. Darunter waren Punks, Obdachlose und Trebejugendliche, aber auch Drogendealer. In der Folge kam es zu zwei Drogentoten in der Kinzigstrasse 9. Die Punks warfen schliesslich die Drogendealer aus dem Haus und etablierten eine geschlossene Hausgemeinschaft. In der Folge erlangte die Kinzig 9 als „härtestes Punkhaus Deutschlands“ grosse Bekanntheit und wurde zum Treffpunkt für Punks aus ganz Europa. Das gesamte Quergebäude wurde im Jahr 1991 Tag und Nacht für Parties genutzt, in Vorderhaus und Seitenflügel wohnten zeitweise bis zu 80 BewohnerInnen und Gäste.

Es kam zu schweren Konflikten zwischen den neu eingezogenen Nachbarn der Plattenbauten und den BesetzerInnen, vor allem aufgrund von ruhestörendem Lärm und Sachbeschädigungen. Mehrere Räumungsbegehren der zuständigen Wohnungsbaugesellschaft wurden vom Senat ignoriert. In den Jahren 1991-92 verübten Neonazis mehrere Brandanschläge auf die Kinzigstrasse 9. Dabei wurden Teile des Vorderhauses, vor allem die herrschaftliche Wohnung im 1.OG und die Stuckdecken der Durchfahrt unwiederbringlich zerstört. Von der Ausstattung des 1.OG blieben lediglich die Fliesen der Küche, sowie einige grossflächige Teile der Mosaiklinoleumböden und der Linkrusta-Tapete erhalten, die heute in Berlin Einzelstücke aus der Erbauungszeit darstellen. Teile des Vorderhauses waren in der Folge unbewohnbar; die Zahl der BesetzerInnen nahm stark ab.

Anfang 1992 zog eine weitere Besetzergruppe aus dem Umfeld der ehemaligen Mainzer Strasse in den mittlerweile wieder leerstehenden Seitenflügel und das Quergebäude ein und begann mit der Instandsetzung. Das Vorderhaus wurde weiterhin von Punks bewohnt. Die beiden BewohnerInnengruppen konnten sich nicht auf ein gemeinsames Vorgehen einigen, und es kam zu gewalttätigen Auseinandersetzungen untereinander. In den Folgejahren agierten beide Gruppen isoliert voneinander. Der grosse Laden des Vorderhauses wurde als Kneipe genutzt. Im Quergebäude entstanden eine gemeinnützige Tischlerei und ein Veranstaltungssaal, die von der BesetzerInnengruppe als Jugend- und Kulturprojekte betrieben wurden. Teile des Quergebäudes wurden zu Wohnräumen umgebaut. Einzelne Wohnungen im Seitenflügel erhielten Mietverträge, der Rest des Hauses blieb bis 1998 besetzt.

Die senatseigene Wohnungsbaugesellschaft WBF führte in den 90er Jahren mehrfach Bau- und Instandsetzungsmassnahmen durch, welche die denkmalschutzrelevante Substanz des Gebäudes teilweise zerstörten. So wurde der Seitenflügel 1993/94 so saniert, das heute fast nichts mehr an sein ehemaliges Erscheinungsbild erinnert. Obwohl das Gebäude bereits im September 1995 unter Denkmalschutz gestellt wurde, liess die WBF 1996 die beiden Hoftore der Durchfahrt entfernen und verschrotten. Das jetzige Hoftor ist ein Nachbau.

Friedrichshain, Berlin, Germany - panoramio (36).jpg

Ebenfalls 1996 begann die WBF mit dem Abschlagen der maroden Strassenfassade, was nur durch die Intervention der BesetzerInnen und des Denkmalamtes unterbunden werden konnte. Der fehlende Stuck auf der linken Fassadenseite wurde damals zerstört. Die WBF versuchte in dieser Zeit mehrfach das Gebäude zusammen mit dem angrenzenden Bauland an grössere Investoren zu verkaufen. Diese Bemühungen scheiterten jedoch aufgrund der Denkmalschutzauflagen und der Besetzung des Gebäudes. Am 8.10.1996 wurde das besetzte Vorderhaus polizeilich geräumt, in der Folgezeit aber von den BesetzerInnen des Quergebäudes nach und nach wiederbesetzt.

Legalisierung und Selbstverwaltung

Ende 1998 erwarb die BesetzerInnengruppe mit ihrem gemeinnützigen Verein die Kinzigstrasse 9 von der WBF. Das Haus wurde der Wohnungsbaugenossenschaft Selbstbau e.G. geschenkt und mit dieser ein langfristiger Pachtvertrag abgeschlossen, da das Ziel von Hausgruppe und Verein hauptsächlich in der gemeinnützigen Arbeit, jedoch nicht im Eigentum an Immobilien liegt. In den Jahren 1999-2002 rekonstruierten die BewohnerInnen das die Gebäude in Eigenregie. Die Finanzierung wurde durch Fördergelder aus dem Selbsthilfe-Programm des Berliner Senats, durch Zuwendungen des Landesdenkmalamtes, sowie durch Eigenmittel der BewohnerInnen gesichert.

Bei der denkmalgerechten Rekonstruktion wurde versucht, die wechselhafte Geschichte des Hauses in seinem Erscheinungsbild zu dokumentieren. So zeigt vor allem die strassenseitige Fassade die vielseitigen Spuren und Narben der Hausgeschichte.

Auch die heutige Nutzung des Gebäudes zeigt Parallelen zu vergangenen Zeiten. So ist der Anteil der Gewerbeflächen nach wie vor relativ hoch: Auf 600qm verteilen sich verschiedenste gemeinnützige Dienstleistungsangebote. Siebdruckwerkstatt und Kneipe nutzen die strassenseitigen Läden. Die Remise dient als Gästehaus, in den Gewerberäumen des Seitenflügels sitzt das Vereinsbüro. Das 1. OG des Quergebäudes wird als Atelier genutzt. Hochparterre und Souterrain des Quergebäudes werden unter dem Namen „Grössenwahn + Leichtsinn“ von den BewohnerInnen gemeinschaftlich als öffentliche Kiezkulturstätte betrieben. Die Räume können von verschiedensten politischen und kulturellen Initiativen für Veranstaltungen und Parties genutzt werden. (Diesbezügliche Anfragen können an groessenwahn@kinzig9.de gestellt werden.) Nach wie vor ist die Kinzigstr. 9 ein selbstverwaltetes Projekt. Alle 35 BewohnerInnen entscheiden auf gemeinsamen Plena über die Belange des Hauses und die Nutzung der öffentlichen Räume.

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-SA 2.0) Lizenz.

————————————————————————

Grafikquellen      :

Oben        —         Berlin-Friedrichshain Kinzigstraße

Author Assenmacher
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————–

2. ) von Oben          —      Friedrichshain, Berlin, Germany

————————

Unten         —           Friedrichshain, Berlin, Germany

Abgelegt unter Berlin, Mensch, Positionen, Regierung | Keine Kommentare »

Charlie : Erinnerung to go

Erstellt von DL-Redaktion am 10. November 2019

Checkpoint Charlie in Berlin

Aus Berlin Jan Pfaff, Hanna Voß, Felix Zimmermann

Einst ein Ort der Weltgeschichte, heute ein Rummelplatz: Wie der Checkpoint Charlie wurde, was er ist – und was er sein könnte.

Wie selbstverständlich steht sie plötzlich da, eine orangefarbene Hütte am Checkpoint Charlie, gerade groß genug für eine Person. „Sharepoint Charlie“ kann man auf ihrer Seite lesen. Aufgebaut ist sie vor der Nachbildung des U.S. Army Checkpoints und den aufgetürmten Sandsäcken, hinter denen jeden Tag Touristen aus aller Welt posieren. Ein Kameramann macht sich bereit, ein Mann in Soldatenuniform und einer mit Klemmbrett nehmen Positionen ein. Ein Werbespot für eine Autovermietungsfirma soll hier gedreht werden.

Aber bevor die erste Einstellung aufgenommen wird, kommen zwei Polizisten und erklären den Männern, dass sie hier nicht drehen dürfen. Sie hätten eine Drehgenehmigung für ganz Berlin, behaupten die Werbefilmer, nur gerade nicht dabei. Allgemeine Genehmigungen hätten hier keine Gültigkeit, für den Checkpoint Charlie bräuchten sie eine Sondernutzungserlaubnis, referiert ein Polizist. Aus dem Dreh wird nichts.

Die Szene erzählt von dem besonderen Status dieses Ortes – und seinen heutigen Problemen. Der Checkpoint Charlie ist ein Stück Weltgeschichte. Das Schwarzweißfoto, auf dem sich am 27. Oktober 1961 genau hier gefechtsbereite Panzer der zwei Supermächte gegenüberstanden, ihre Geschütze aufeinander gerichtet, gehört zum globalen Bildergedächtnis. Am Checkpoint Charlie trafen Ost und West aufeinander, Kapitalismus und Kommunismus, GIs und rote Armee, getrennt durch eine weiße Linie, die die Grenze zwischen den Berliner Bezirken Mitte und Kreuzberg markierte.

Heute besuchen den Ort jedes Jahr rund 4 Millionen Menschen. Und viele versuchen den Mythos für sich auszuschlachten, ein Geschäft damit zu machen – da sind die Straßenhändler, die Sowjetuniformen, Pelzmützen und Gasmasken anbieten, daneben die vollgestopften Souvenirläden mit ihren bunten Mauerbröckchen, DDR-Fahnen und Miniatur-Trabis.

Fastfoodketten und Würstchenbuden rangeln um Kundschaft, Sightseeingbusse rollen im Schritttempo über die einstige Grenzlinie, Hütchenspieler und Bettlergruppen tauchen plötzlich auf und verschwinden wieder. Das zügige Tempo, mit dem sich die Menschen sonst in dieser Gegend bewegen, kommt hier fast völlig zum Stillstand. Schulklassen blockieren die Gehwege, Touristen stehen auf der Straße herum.

Wer heute nur einige Minuten am Checkpoint Charlie herumläuft, hat das Gefühl, über einen großen Rummelplatz zu gehen. Geboten wird historische Erinnerung to go, hier schnell ein Selfie, da schnell eine Bratwurst. Wie hat sich der Ort, an dem einmal Menschen bei Fluchtversuchen starben und die Angst vor einem Dritten Weltkrieg ständig präsent war, in eine schäbige Flaniermeile verwandelt? Wie wurde der Checkpoint Charlie, was er heute ist? Und was erzählt das über unseren Umgang mit historischer Erinnerung?

Im Hinterzimmer des Cafés Einstein, direkt am ehemaligen Grenzverlauf, hängen Schwarzweißbilder aus den 60er Jahren, darauf Stacheldraht, Brachen und Soldaten in Wintermänteln. Darunter sitzt Smiley Baldwin und macht seinem Vornamen alle Ehre – er lächelt, während er sich zu erinnern versucht, wie das damals war, als er als amerikanischer Soldat Dienst am Checkpoint Charlie tat.

Baldwin kam 1987 als Militärpolizist nach Berlin, zuvor war er zwei Jahre bei Frankfurt stationiert. „Dort war die Studentenszene in den Reagan-Jahren gegenüber US-Soldaten sehr ablehnend. In Westberlin waren die Leute so nett zu uns – sie waren dankbar, dass wir da waren.“ Als Militärpolizist fuhr er zusammen mit Berliner Polizisten Patrouille. Er interessierte sich für die Geschichte der Stadt, lernte Deutsch. Abwechselnd wurde er am Checkpoint Bravo an der Transitautobahn zur BRD und am Checkpoint Charlie eingesetzt.

In dem Kontrollhäuschen arbeitete er als Assistent des Non-Commissioned Officer in Charge, des verantwortlichen Unteroffiziers. „Ich habe ihm beim Papierkram geholfen oder auch mal den Müll rausgebracht.“ Eigentlich sei das ein Bürojob gewesen. Die Russen wollten genau wissen, wer, wann, wieso in den Ostteil wollte, dafür galt es unzählige Formulare auszufüllen.

Aber wichtiger als die Bürokratie sei etwas anderes gewesen: „Es ging um Ästhetik. Es musste alles gut aussehen. Vor allem große, sportliche Jungs wurden hier eingesetzt“, erzählt Baldwin. „Meine Uniform konnte allein stehen, so steif war sie, damit sie keine Falten warf. Die Schuhe blitzten. Das Häuschen roch ganz neu und nach Putzmittel.“

Der Kontrollposten und die GIs gehörten zum „Schaufenster des Westens“, als das die Amerikaner Westberlin verstanden. „Wir mussten unserem Gegner zeigen, wie wir aussehen – und zwar tiptop“, sagt Baldwin. „Militärstrategisch waren wir ja tot.“ Es gab zwar Szenarien, wie sich die Soldaten der Westalliierten im Kriegsfall auf das Gebiet der BRD hätten zurückziehen sollen. „Aber jeder wusste, dass das bei der Übermacht der Sowjets und NVA-Soldaten völlig aussichtslos gewesen wäre.“

Das Schaufenster des Westens

Er erinnert sich an eine Situation am Checkpoint, die ihm gezeigt habe, was das eigentlich bedeutete: Kalter Krieg. „Ich stand hier und sah jemand, der von der anderen Seite auf uns zurannte. Fünf Meter vor der weißen Linie ist der Mann gestolpert. Wir durften ihm nicht helfen. Wenn einer von uns nur einen Schritt über diese Linie gemacht hätte, wäre die Welt in der nächsten Minute nicht mehr in Ordnung gewesen.“ In dem Moment war der Kalte Krieg kein abstraktes Konzept mehr, kein komischer Arbeitsplatz in einem fernen Land, sagt Baldwin. „Es war plötzlich sehr ernst. Wir haben zugeschaut, wie der Mann abgeführt wurde.“

1992 scheidet er aus der Armee aus und bleibt in dem nun wiedervereinigten Berlin. Er arbeitet als Türsteher, wird feste Größe des Berliner Nachtlebens, 17 Jahre macht er die Tür des legendären Clubs „Cookies“. Er ist der Einzige aus seiner ehemaligen Einheit, der in Berlin geblieben ist.

Wie blickt er heute auf diesen geschichtsträchtigen Ort? „Was mit dem Checkpoint Charlie geschieht, ist allein Sache der Deutschen“, sagt Baldwin. „Mit dem Fall der Mauer und dem Abzug der Soldaten ist unsere Verantwortung dafür vorbei. Und das ist gut so.“

Die Zeit nach 1989 bedeutet für den Checkpoint Charlie erst mal Rückbau. Die Mauer ist durchlässig geworden, jetzt soll sie ganz weg. Zwischen Juli 1990 und November 1991 werden in Berlin 155 Kilometer Mauer abgerissen, 302 Beobachtungstürme, 20 Bunkeranlagen, dazu die Grenzübergänge. Den Anfang macht der Checkpoint Charlie. In einer feierlichen Zeremonie mit den Außenministern beider deutscher Staaten, der USA, Frankreichs, Großbritanniens und der Sowjetunion wird die Kontrollbaracke der Amerikaner am 22. Juni 1990 abtransportiert. Die 298th U.S. Army Band spielt dazu „Berliner Luft“. Die taz, deren Redaktionsgebäude um die Ecke liegt, schreibt: „Letzte Vorstellung für Onkel Charlie“.

Und zunächst gibt es keinen Plan, was mit dem ehemaligen Grenzübergang passieren soll. Von einem Ort des Geschehens zu einem Ort des Erinnerns – das geht nicht von heute auf morgen. Was eben noch Gegenwart war, ist nicht gleich Geschichte, und damit ist es auch nicht gleich erinnerungswürdig.

Ganz nah am Unrecht

Es gibt aber jemand, der am Checkpoint Charlie praktisch von Anfang an da ist. Jemand, der Räume füllt, die andere offen lassen. Rainer Hildebrandt, ein ehemaliger Widerstandskämpfer gegen die Nazis, eröffnet im Juni 1963 am Checkpoint sein Mauermuseum. Weil viele Geschäfte wegen der schlechten Lage nach dem Mauerbau 1961 wegzogen, kann er die Räume eines ehemaligen Cafés übernehmen. Axel Springer, der in der Nähe sein neues Verlagshaus baut, schickt einen Elektriker vorbei, der die Leitungen verlegt. Viele Redaktionen und Bildarchive stellen für die Ausstellung kostenlos Fotos zur Verfügung.

„So nahe wie möglich am Unrecht sein, dort entfaltet sich die menschliche Größe am stärksten“, erklärt Hildebrandt zur Eröffnung mit dem Pathos eines Freiheitskämpfers die Ortswahl. Das letzte Haus vor der Mauer ist damals auch nicht nur Museum. Fluchthelfer beobachten durch ein kleines Fenster alle Bewegungen am Grenzübergang, Geflüchtete werden aufgenommen, Fluchtpläne entwickelt.

Nach der Wende wollen Rainer Hildebrandt und seine Frau Alexandra den Checkpoint zu einem Denkmal für die Westalliierten machen, dafür soll auch die ehemalige Kontrollbaracke zurückkehren. Nicht die größere Baracke, die 1990 feierlich abtransportiert wurde, sondern eine Nachbildung der ersten Alliiertenbaracke aus den 60er Jahren. Eine winzige Holzhütte mit einem Schild auf dem Dach: US Army Checkpoint. Die Hildebrandts lassen sie anhand von Fotos nachbauen, am 13. August 2000 wird sie enthüllt.

Da war die Mauer für Merkel und Gauck noch ein Schutzwall.

2004 stirbt Rainer Hildebrandt. Im Inneren der nachgebauten Baracke erinnern ein Porträtfoto und ein Gedenktext an ihn, am Eingang des Mauermuseums steht eine eiserne Statue des Gründers. Das Museum selbst wirkt heute, als ob ein Messie mit Hang zur Zeitgeschichte sich mal so richtig austoben durfte.

Quelle              :         TAZ        >>>>>         weiterlesen

——————————————————————-

Grafikquellen        :

Oben      —         Passing Checkpoint Charlie on the way to Berlin (West) 14 November 1989

———————————–

2.) von Oben      —      Checkpoint Charlie

Abgelegt unter Berlin, Deutschland, Regierung, Schicksale | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle  streifzuege.org

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.

Keep-it-in-the-ground.jpg

Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.

—————————–

2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.

—————————-

3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.

——————————–

Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

Debatte um Mietendeckel

Erstellt von DL-Redaktion am 7. November 2019

Wohneigentum ist keine Schande

File:Potsdamer Platz, Berlin, April 2016.JPG

Kommentar von Anja Maier

Die Diskussion um den Mietendeckel wird grotesk: Einige arbeiten sich an Eigentümern einzelner Wohnung ab. Der Feind ist ein anderer.

Fangen wir mit den Begrifflichkeiten an. Gerade hat der Berliner Senat den sogenannten Mietendeckel beschlossen. Ein richtig blödes Wort, das doch eigentlich etwas Gutes meint. Deckel auf Töpfen, in denen es brodelt und kocht, waren noch nie eine gute Idee, weder physikalisch noch politisch. So betrachtet darf meine Geburtsstadt Berlin künftig als einzigartige sozialpolitische Versuchsanordnung betrachtet werden: Entweder das Ding fliegt irgendwann komplett in die Luft. Oder der Deckel bleibt drauf und am Ende werden alle satt – auch die bislang hungrig Gehaltenen.

Eigentlich handelt es sich beim Mietendeckel um einen auf fünf Jahre begrenzten Mietenstopp. Betroffen sind davon anderthalb Millionen hauptstädtische Wohnungen, was bei dreieinhalb Millionen BerlinerInnen keine Kleinigkeit ist. Künftig müsse jene um ihr als Naturrecht verstandenes Renditeversprechen bangen, die schon bisher den Hals nicht voll bekommen haben: Anleger von börsennotierten Immobilientrusts, denen die Menschen in ihren „Mietsachen“ herzlich egal sind. Zumindest solange sie ohne zu mucken pünktlich zum 1. d. M. zahlen.

Das Problem ist nun jedoch, dass das Leben, wie so oft, nicht ganz so eindimensional zu erklären ist. Denn weil es den anonymen Immobilienmillionären aus Barcelona, Moskau oder Bad Godesberg bislang herzlich egal war und weiterhin ist, wenn Menschen in Berlin, München oder Frankfurt sauer auf sie sind und vor Sorge um ihren Platz im Leben schlecht schlafen, verlegen sich kritische MieterInnen neuerdings lieber darauf, EigentümerInnen einzelner Wohnungen oder Häuser zu schmähen.

Statt sich prinzipiell und gemeinsam gegen den überhitzten Wohnungsmarkt und globale Hedgefonds zu positionieren, richtet die Wut sich der Einfachheit und ideologischen Übersichtlichkeit halber auf EigentümerInnen einzelner Wohnungen und Grundstücke. Leute also, die sich privat Geld für einen Kredit borgen, sich von ihren Eltern und Großeltern schon zu deren Lebzeiten ihr Erbe oder einen Teil davon auszahlen lassen oder – ja, das gibt es – die ganz gut verdienen.

Bei Twitter etwa wurde diese Woche eine Kollegin, die den Mietendeckel wegen seiner Auswirkungen auf KleinvermieterInnen kritisiert hat, teils aufs Übelste beschimpft. Sie bekam Drohmails, wurde sexistisch angegangen oder ultimativ aufgefordert, ihre private finanzielle Situation öffentlich darzulegen. Sie wurde als wahlweise dummes junges Ding oder abtrünnige Neoliberale geschmäht.

Der schlichte argumentative Angang in der Debatte ist in der Regel etwa dieser: Dass du eine Wohnung bezahlen kannst, ich aber nicht, beweist, dass du ein privilegiertes Arschloch bist. Es wird dann gern ein bisschen persönlich, die Aufforderung, sich für Privatestes zu rechtfertigen, steht im Raum. Der eigene Distinktionsgewinn, zumal im zeigefreudigen digitalen Raum, wächst bei ansteigendem Ton recht angenehm.

Hier meine Gegenthese: Sorry, Wohneigentum ist keine Schande, erst recht nicht, wenn es um die selbst genutzte Immobilie geht.

Um die Sache hier etwas zu verklaren, soll nicht unerwähnt bleiben, dass ich als Autorin dieses Textes glasklar der Arschloch-Fraktion angehöre. Ich besitze mit meinem Mann ein Haus im Brandenburgischen, das wir vor über zwanzig Jahren mit Unterstützung durch unsere Familien anfinanziert und dann fleißig abbezahlt haben. Wir waren Anfang dreißig, hatten zwei kleine Kinder und keinen Bock mehr, jeden Monat die üppige Szenequartier-Miete zu zahlen. Dann doch lieber das bisschen Geld, das wir verdienten, in was Eigenes investieren. Klingt uncool? War es auch. Aber eben auch nicht unschlau.

Wir hatten damals, Mitte der Neunziger, nicht gut verhandelt, der Kasten war im Grunde zu teuer und für den Preis nicht im allerbesten Zustand. Als dann während der deutschen Wirtschaftskrise in den 2000er Jahren der Wert der Immobilie sank und sank, befürchteten wir, das Ersparte unserer Nachkriegs-Elterngeneration hoffnungslos in den märkischen Sand gesetzt zu haben.

Unsere Stimmung hellte sich erst wieder etwas auf, als die ersten Freunde und Kollegen uns scheinbar nebenbei fragten, ob da draußen in den Weiten Brandenburgs noch etwas käuflich zu erwerben sei. Wenn diese hippen Hobos zu uns in die Provinz kommen wollten, dachten wir, mussten wir wohl irgendwas richtig gemacht haben. Und da hatten wir verdammt noch mal recht.

Quelle        :         TAZ          >>>>>         weiterlesen

——————————————————————-

Grafikquellen         :

Oben         —         Potsdamer Platz, Berlin, April 2016

Author Another Believer       /       Source   :    Own Work
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

—————————-

Unten      —         Kanaldeckel auf dem Odeonplatz München – hier hört man einen unterirdischen Stadtbach rauschen: besichtigt auf der Radtour zu den Münchner Stadtbächen am 17.5.12, Wikipedia-Stammtisch München

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
Author Amrei-Marie

Abgelegt unter Berlin, Deutschland, Positionen, Regierung | Keine Kommentare »

AKL – Thüringen-Wahl:

Erstellt von DL-Redaktion am 7. November 2019

Linke Positionen in Gefahr

2019-10-27 Wahlabend Thüringen by Sandro Halank–54.jpg

Quelle      :     AKL 

Von Steve Hollasky, Dresden

Keine Kooperation mit den bürgerlichen Parteien – für ein sozialistisches Regierungsprogramm!

Drei Dinge zeigen die Landtagswahlen in Thüringen: Dreißig Jahre nach der Revolution gegen die in der DDR herrschende stalinistische Bürokratie befinden sich die bürgerlichen “Volks”parteien SPD und CDU weiterhin in ihrer tiefsten Krise seit 1945; die gesellschaftliche Polarisierung schreitet fort und der Anpassungskurs eines Teils der LINKEN erreicht zu einer Zeit, in der linke Positionen wie zum Beispiel die Forderung nach Enteignung der Immobilienhaie oder kostenlosem öffentlichen Personennahverkehr Zuspruch in größeren Teilen der arbeitenden Bevölkerung bekommen, eine neue Qualität. Und es stellt sich die Frage, was man mit der jetzigen Situation anfangen solle. Die Regierungsbildung gestaltet sich schwierig und in den Führungskreisen der LINKEN wird offen über ein Bündnis oder Kooperation mit der CDU schwadroniert.

Krise der Etablierten

SPD und CDU haben in Thüringen erneut Verluste hinnehmen müssen. Die Sozialdemokrat*innen büßten 4,2 Prozentpunkte ein und stürzten auf ein Thüringer Allzeittief von 8,2 Prozent. Weit dramatischer fielen die Verluste der CDU aus. Mit 11,7 Prozentpunkten minus im Vergleich zu 2014 fiel sie noch hinter der AfD auf Platz drei und landete bei 21,8 Prozent der Stimmen.

Abgestraft wurden bei der Wahl am Sonntag die Regierungsparteien im Bund – und zwar unabhängig davon, ob sie sich in Thüringen aktuell in der Regierung befinden, wie die SPD, oder aber in der Opposition, wie die CDU. Damit setzte sich augenscheinlich der Trend der letzten Landtagswahlen in Sachsen und Brandenburg fort.

Mehr noch, die schleichende Krise den Unionsparteien scheint nun auch offen auszubrechen. Bislang konnten sich die in Wahlumfragen geschwächten CDU und CSU mit Blick auf die SPD als gesund präsentieren. Anders als die SPD fuhr man keine einstelligen Ergebnisse ein. Dass diese Zeiten nun aber vorbei sein könnten, meint auch Ursula Münch, Politikwissenschaftlerin an der Akademie für politische Bildung in Tutzingen und Mitglied im Wirtschaftsrat der Bundesregierung. Im Interview mit der tagesschau erklärte sie am 29.10., der CDU drohe aus ihrer Sicht „das gleiche Schicksal wie der SPD“. Auch vorgezogene Neuwahlen im Bund schloss Münch in diesem Interview nicht aus.

Die Zerschlagung der Industrie durch die Treuhand nach 1990, die Wiedereinführung kapitalistischer Verhältnisse und die anhaltende Perspektivlosigkeit in ganzen ostdeutschen Landstrichen, hat die Menschen in den neuen Bundesländern nicht nur ungeheuer wütend gemacht, sondern in der Folge auch von den Etablierten entfremdet.

Gesellschaftliche Polarisierung

Nicht selten vernimmt man zur Beschreibung der politischen Lage das Wort „Rechtsruck“. Dass dies nur eine ungenaue Wiedergabe der Situation ist, zeigt das Wahlergebnis in Thüringen. Was sich zusehends abspielt, ist eine Polarisierung nach links und rechts. Nicht nur die AfD erzielte Zugewinne und schnellte auf 23,4 Prozent, wodurch sie Platz 2 besetzte. Auch die LINKE fuhr ein Plus von immerhin 2,8 Prozentpunkten ein und landete bei 31,0 Prozent. Dabei hat auch die Regierung unter Bodo Ramelow in der Koalition mit SPD und Grünen nicht eine grundlegende andere Politik gemacht, die klar erkennbar im Interesse der Masse der arbeitenden Bevölkerung ist. So bekam in der Konsequenz diese Regierung keine Mehrheit. Viele wählten die LINKE als stärkste Kraft, um zu verhindern, dass die AfD stärkste Kraft wird, so wie es auch in Brandenburg mit der SPD oder in Sachsen der CDU der Fall war. Doch Rot-Rot-Grün hat den Aufstieg der AfD in Thüringen nicht verhindert.

Die gern erwähnten Einstellungen von Lehrer*innen in Thüringen sind bei Weitem nicht ausreichend. Und die Gemeindereform des Landes Thüringen bedeutete in der Realität nur längere Wege für Anwohner*innen, weil Ämter verlegt oder geschlossen wurden. Wirklich linke oder gar sozialistische Maßnahmen wie Initiativen zur Rekommunalisierung von Wohnraum oder Kliniken sucht man in den vergangenen fünf Jahren vergebens.

Dass die Thüringer Linkspartei ausgerechnet mit Ramelow an der Spitze dennoch ihr bestes Ergebnis überhaupt einfuhr, beflügelt nun den rechten, in der Konsequenz prokapitalistischen Teil der LINKEN. Dietmar Bartsch, Vorsitzender der Fraktion der Linkspartei im deutschen Bundestag, erklärte inzwischen, man müsse an den Erfolg von Bodo Ramelow anschließen und als Bundespartei davon lernen“. Das ist aber genau der falsche Weg und die Linken in der LINKEN müssen jetzt klar dagegen halten.

Gerade die Tatsache, dass die LINKE die Wut über Sozialabbau, Niedriglohnpolitik und Rentenkürzungen nicht zum Ausdruck bringt und konsequente Lösungen anbietet, macht es der AfD leicht. Auf rechtspopulistische Art verbindet sie soziale Demagogie mit dem Gift des Rassismus und Nationalismus. So erklärte Höcke im Wahlkampf gern, Zuwanderer würden gute medizinische Versorgung erhalten und Hiergeborene hätten mit dem Pflegenotstand zu kämpfen. Darauf aufbauend versucht die Thüringer AfD unter der Führung von Höcke, rechtsextreme Positionen zu verankern und hoffähig zu machen. Dass die Positionen der AfD Lügen sind, wird dann leichter zu erklären, wenn Migrant*innen, Geflüchtete und Hiergeborene gemeinsam gegen den Pflegenotstand kämpfen. Das zu organisieren wäre eigentlich Aufgabe der LINKEN.

Anpassungskurs der LINKEN

Dass die LINKE auch nach dieser Wahl einen anderen Weg, nämlich den des Parlamentarismus und Regierungsbeteiligung beschreiten wird, steht zu befürchten. Schon kurz nach der Wahl rief die Führung der Thüringer LINKEN nicht etwa zu Kämpfen auf, sondern erklärte die grundsätzliche Verhandlungsbereitschaft mit allen im Landtag vertretenen Parteien, mit Ausnahme der rechtspopulistischen AfD.

Was damit gemeint war, offenbarte sich schnell. Als der konservative Spitzenkandidat, Mike Mohring, am Tag nach der Wahl im ARD-Morgenmagazin, ganz anders als noch am Abend zuvor, verkündete, seine Partei müsse nun „Verantwortung übernehmen“, sprang die LINKE-Führung sofort auf den Zug auf. Ramelow erklärte, man werde sehen, was möglich sei, „eine festere Koalition, eine absolute Koalition oder ein Tolerierungsmodell“. Unterstützung kam von der LINKEN-Bundesspitze. Bernd Riexinger meinte glatt, der Ball läge im Feld der CDU. Eine Absage an ein Bündnis mit einer Partei, die für die Situation in Ostdeutschland verantwortlich ist, kam nicht. Die Befürchtung, die LINKE könnte sich wirklich auf ein Bündnis mit der CDU einlassen war jedoch fehl am Platz. Aber nicht, weil die LINKE dieses Angebot prinzipienfest ablehnte, sondern, weil die CDU und auch Mike Mohring die diesbezüglichen Andeutungen wieder zurückzog. Das spricht Bände über die Situation in der LINKEN, wo führende Teile die Partei lieber als “verlässlichen” Bestandteil des Establishments sehen wollen, anstatt als Partei des Widerstands.

Was jetzt?

DIE LINKE muss endlich aufhören, das Bündnis mit den Sozialabbauparteien einzugehen und stattdessen das Bündnis mit der arbeitenden Bevölkerung und den Gewerkschaften schmieden, um den gemeinsamen Kampf mit Beschäftigten, Arbeitslosen, antirassistischen Initiativen, Rentner*innen und Mieter*innen zu organisieren. Das Potenzial dafür besteht auch unter dem mit Abstand erneut größten Teil aller Wahlberechtigten – den Nicht-Wähler*innen, die weder dem bürgerlichen Einheitsbrei, noch den Rechtspopulisten etwas zutrauen. Wenn aber die LINKE in Thüringen zum festen Bestandteil dieses Establishments wird – und das wäre bei einem Bündnis mit der CDU der Fall – dann wird für noch mehr Menschen der scheinbar einzige Weg ihre Wut zu artikulieren das Kreuz bei der AfD sein. Das darf man nicht zulassen.

Datei:Goldlauter-Blick.jpg

Eine Regierung der LINKEN in dieser Situation kann nur eine Minderheitsregierung mit sozialistischem Programm sein. Die müsste ohne Zweifel um jedes kleine Gesetz kämpfen. Gerade dazu müsste sie die lohnabhängig Beschäftigten unabhängig von Herkunft, Sprache, Religion, Alter oder Geschlecht mobilisieren. Das zu erreichen wäre ohne Frage nicht leicht. Es wäre zudem nur möglich, wenn man der Bevölkerung zeigen würde, dass eine LINKE-Regierung wirklich in ihrem Interesse wäre. Das Programm für eine solche Regierung müsste aus Eckpunkten bestehen wie der Kommunalisierung von Wohnraum unter demokratischer Kontrolle die Mieter*innen, Verstaatlichung von Pflegeinrichtungen und Krankenhäusern, massiven Stellenaufbau an den Schulen, eine Absage an die Schuldenbremse und stattdessen die Besteuerung der Reichen, sowie antirassistische Mobilisierungen gegen AfD und Co. Eine solche Landesregierung könnte – sogar aus der Minderheit heraus – zu einem bundesweiten Fokus von Opposition gegen eine immer schwächer werdende Bundesregierung werden und den Widerstand gegen Sozialabbau, den Kampf für wirkliche Verbesserungen inspirieren und voran bringen. Sozialistische Ideen könnten wieder greifbar werden. Das wäre auch ein großer Schritt auf dem Weg hin zu einer sozialistischen Massenpartei. Und es wäre das wirksamste Mittel gegen Rechts, um die Basis der AfD zu untergraben.

Würde man dieses Programm vertreten, könnte man den Landtag von außen mit einer großen Bewegung unter Druck setzen. Doch Ramelow wird diesen Weg nicht gehen. Auch da braucht man sich keiner Illusion hinzugeben. Eine Koalition der LINKEN unter der Führung von Ramelow mit – oder Tolerierung von – Sozialabbauparteien, von SPD, Grünen, FDP und CDU, wird in Thüringen leider kaum zu verhindern sein. Wahrscheinlich sogar dann noch, wenn die zu erwartende Wirtschaftskrise hart zuschlagen und die Lebensbedingungen der arbeitenden Bevölkerung stark einschränken wird. Das zeigt, dass es darauf ankommt um grundlegende Positionen innerhalb der LINKEN bundesweit zu kämpfen. Dafür muss man jetzt endlich die linke Opposition in der LINKEN organisieren. Sol tut das im Rahmen der AKL. Wir fordern alle auf, uns dabei zu unterstützen.

akl - Antikapitalistische Linke

—————————————————————–

Grafikquellen         :

Oben          —         Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

 

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Linke PV am 27. /28. 10. 19

Erstellt von DL-Redaktion am 6. November 2019

Konversion der Autoindustrie, Geschlechterparität im Bundestag und Thüringen-Wahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle     :  AKL

Bericht von Lucy Redler

Der Parteivorstand (PV) widmete sich am Sonntag, 27.10. schwerpunktmäßig einer interessanten Debatte über die Zukunft der Autoindustrie, einem Gesetzesentwurf zur Herstellung von Geschlechterparität im Bundestag und der Vorbereitung der Strategiekonferenz der LINKEN am 29.2. bis 1.3.2020 in Kassel.

Am Montag, 28.10. ging es neben der Wahlauswertung in Thüringen vor allem um die neue Forderung der LINKEN zur Mindestsicherung. Darüber hinaus gab es Berichte aus dem Jugend- und Studierendenverband und wurden etliche weitere Vorlagen beschlossen. Da Thies Gleiss derzeit leider die Stimme versagt, verantwortet Lucy Redler diesen Bericht allein.

Autoindustrie

Bernd Riexinger hatte eine Diskussionsvorlage zur Zukunft der Autoindustrie und deren „soziale, ökologische, demokratische Transformation“ eingereicht, die auf hohem Niveau diskutiert wurde. In der Debatte ging es um das von ihm vorgeschlagene Ziel der Halbierung der Anzahl der Autos bis 2030, ob E-Autos eine Alternative sind oder nicht, die nötige Konversion der Produktion, einen Fünf-Stufen-Plan zum kostenfreien ÖPNV, das Ziel einer emissionsfreien Wirtschaft in 15 bis 25 Jahren, der Forderung nach Arbeitszeitverkürzung bei vollem Lohnausgleich und Fragen der Vergesellschaftung.

Angesprochen wurde, dass all dies nicht in der bisherigen Form der kapitalistischen Verwertung möglich sei. Klar wurde dabei auch, dass es im Parteivorstand unterschiedliche Vorstellungen darüber gibt, ob eine Transformation der Autoindustrie und die Einführung von Wirtschaftsdemokratie im Rahmen des Systems möglich sind, oder es nötig ist (Lucys und Thies Meinung), offensiver die Eigentums- und Systemfrage zu stellen. Das Ziel, das Klima zu retten, erfordert die Konversion der Autoindustrie. Das ist nur durch die Vergesellschaftung der Autoindustrie möglich und muss einhergehen mit der Überführung anderer Schlüsselindustrien in öffentliches Eigentum, der Abschaffung der kapitalistischen Produktionsweise und der Einführung demokratischer Planung.

Eine Debatte gab es erneut (wie bereits beim letzten PV zur CO2-Bepreisung) zur Frage, ob es ausreicht, das Angebot des ÖPNVs zu erweitern und Ordnungsmaßnahmen zu ergreifen, oder ob die Nutzung von Autos in der Innenstadt verteuert werden muss durch Parkraumbewirtschaftung und andere Maßnahmen, um marktwirtschaftlich ein anderes Verhalten zu erzwingen. Letzteres würde aus Sicht der AKL aber vor allem Menschen aus der Arbeiter*innenklasse treffen, Reiche könnten sich weiter leisten, ihre Autos in die Städte zu fahren (Umweltverbände sagen zudem, dass solche marktwirtschaftlichen Steuerungen viel zu langsam und viel zu wenig Wirkung erzeugen).

Bernd Riexinger hatte vorgeschlagen, das Konzept der LINKEN als „linken Green New Deal“ zu betiteln. Lucy sprach sich aus verschiedenen Gründen dagegen aus. Für viele klingt Deal nach einem Deal mit den Konzernen und nicht nach dem nötigen Kampf gegen Konzerninteressen. Bernd Riexinger verwies dagegen darauf, dass der Begriff international von Linken geprägt sei, zeigte sich aber offen für andere Begriffe.

Als Lesehinweis empfahl Lucy das Buch „Mit dem Elektroauto in die Sackgasse“ von Winfried Wolf (erschienen 2019 bei Promedia) und die Durchführung von Veranstaltungen mit ihm zum Thema alternative Verkehrspolitik. Winfried Wolf spricht sich darin sehr deutlich gegen E-Autos als angeblich grüne Alternative aus.

Geschlechterparität im Bundestag

Als zweiten Schwerpunkt unter Aktuelles diskutierte der PV einen Gesetzentwurf der Bundestagsfraktion zur Umsetzung der LINKE-Forderung nach Geschlechterparität im Bundestag. Dazu nahm Conny Möhring, frauenpolitische Sprecherin der Bundestagsfraktion, an der Sitzung teil und stellte den Entwurf vor. Während die Quotierung der Kandidat*innen auf den Listen und in Wahlkreisen der LINKEN unstrittig ist, ging es darum, ob die Partei einen Gesetzentwurf einbringen soll, der alle Parteien dazu verpflichtet, Wahllisten und Kandidat*innen für Direktmandate in den Wahlkreisen geschlechterparitätisch aufzustellen. Die gesetzliche Verpflichtung zur paritätischen Aufstellung der Wahllisten ist noch einfach vorstellbar, komplizierter wird es bei den Wahlkreisen. Der Vorschlag von Conny Möhring und anderen ist, die Umsetzung als paritätische Doppelbesetzung der Wahlkreise zu ermöglichen, indem die heutige Anzahl von Wahlkreisen halbiert und dann doppelt mit Mann und Frau besetzt wird. Die Alternative zur Einführung der vollen Geschlechterparität wäre die Abschaffung der Wahlkreise und die Umsetzung der Wahl über ein reines Verhältniswahlrecht. Diese Vorschläge wurden konstruktiv und kontrovers diskutiert.

Das Stimmungsbild zum Gesetzentwurf ging dann auch dementsprechend ungefähr 50:50 aus.

Eine Entscheidung darüber wurde auf die nächste PV-Sitzung am 23./24.11. verschoben. Positiv wurde festgehalten, dass Conny Möhring diese Diskussion im PV sucht, da ja sonst nicht selten die Fraktion Entscheidungen trifft und die Partei vor vollendete Tatsachen stellt.

Strategiekonferenz 2020

Am 29.2. bis 1.3.2020 soll eine bundesweite Strategiekonferenz der LINKEN im Kulturbahnhof im schönen Kassel stattfinden, die offen für alle Mitglieder ist. Dort sollen keine Beschlüsse gefasst werden, aber Räume in Plena und workshops geöffnet werden, um über die weitere Strategie der LINKEN zu sprechen. Die Konferenz soll sich vor allem an Mitglieder und Aktive richten und zudem an Akteur*innen aus dem Umfeld der Partei.

Ilja Seifert brachte es gut auf den Punkt, als er sagte, es sei nicht zentral, dass dort hundert Journalist*innen rumspringen, um sich keine Agenda von außen aufzwingen zu lassen.

Was genau diskutiert werden soll, wird Gegenstand von Debatten und auch Kontroversen sein. Ein Mitglied des geschäftsführenden PVs meinte, es solle dort kein Best-of der Kontroversen der letzten Jahre geben, sondern das diskutiert werden, was gesellschaftlich nötig sei. Es ist natürlich richtig, dass die Strategiekonferenz neue (und alte) Fragen wie Zukunft der Autoindustrie, Klimapolitik, internationale Handelsbeziehungen- und kriege, Aussichten auf eine Rezession diskutieren muss, aber zugleich müssen auch die Kontroversen der letzten Jahre ihren Platz haben. Denn diese sind ja nicht losgelöst von den gesellschaftlich notwendigen und aktuellen Fragen.

Mitglieder der Partei sind aufgerufen, bis zum 10.1.2020 eigene Strategiebeiträge von bis zu 10.000 Zeichen einzureichen. Diese könnt ihr hier einreichen:

strategiedebatte@die-linke.de . Die Beiträge sollen online und eine Auswahl in einem Printreader veröffentlicht werden. AKL-Mitglieder werden sich mit Beiträgen zu Wort melden.

Der PV wählte eine Vorbereitungsgruppe, der folgende Mitglieder aus dem PV angehören: Jörg Schindler, Harald Wolf, Lucy Redler (Vertretung Thies Gleiss), Ralf Krämer, Jan van Aken. Dazu kommen Genoss*innen aus dem Bundesausschuss, aus Parteiströmungen, Jugendverband, SDS und der Bundesgeschäftsstelle.

Vorschläge zur Strategiekonferenz könnt ihr gern an die Vorbereitungsgruppe oder auch direkt an Lucy richten. Die Vorbereitungsgruppe wird nun noch erweitert durch Genoss*innen aus Landesverbänden (also meldet euch schnell über euren Landesverband, wenn ihr mitmachen wollt.)

Weitere Themen unter Aktuelles waren die Massenproteste in Chile, Katalonien, Libanon und Irak, die Parteikampagnen zu Pflege und Mieten, die geplanten Studierendenstreiks ab dem 23.11., die Aufklärung des Lübke-Mordes und die Rolle des Verfassungsschutzes.

Neue Forderung: 1200 Euro Mindestsicherung

Angesichts der gestiegenen Lebenshaltungskosten lagen vier Vorschläge zur Erhöhung der sanktionsfreien Mindestsicherungsforderung der LINKEN (derzeit 1050 Euro) vor. Von diesen wurden in der Debatte im Wesentlichen drei diskutiert:

Erstens: Die BAG Hartz IV, bei der Sitzung durch zwei Genoss*innen vertreten, stellte ihr Konzept von einer sofortigen Erhöhung der Mindestsicherung auf 1200 Euro vor.

Zweitens: Der Gegenvorschlag kam von Ralf Krämer, der eine Erhöhung von 1150 Euro errechnet hatte.

Drittens: Der dritte Vorschlag war, die Forderung auf 1200 Euro zum nächsten Bundestagswahlkampf zu erhöhen.

Die Debatte drehte sich dann weniger um die Differenz von 50 Euro, sondern um die Frage, nach welchen Gesichtspunkten wir Forderungen aufstellen. Während die BAG Hartz IV, Lucy und andere Parteilinke politisch dafür plädierten, die objektive Notwendigkeit zum Ausgangspunkt zu nehmen und mit der Forderung nach 1200 ein Signal an Bündnispartner*innen in Erwerbsloseninitiativen und Sozialverbänden auszusenden und eine überfällige Debatte in den Gewerkschaften anzustoßen, argumentierten andere entweder stärker mathematisch oder damit, dass für die Durchsetzung von 1200 Euro die starken Bündnispartner in den Gewerkschaften fehlen und 1200 Euro gegenüber Lohnabhängigen schwerer vermittelbar seien. Es stimmt, dass die Gewerkschaften diese Forderung nicht aufstellen, dasselbe gilt jedoch auch für die Forderung nach 1050 und 1150 Euro. Es stimmt auch, dass manche prekär Beschäftigte eine Forderung nach 1050, 1150 oder 1200 Mindestsicherung nicht nachvollziehen können, doch das spricht wohl eher für Lohnerhöhungen statt einer niedrigeren Mindestsicherungsforderung. Lucy sprach sich dafür aus, flankierende Forderungen nach einem Mindestlohn von 13 Euro aufzustellen.

Die Abstimmung ergab eine Mehrheit für die Forderung nach 1200 Euro, in der Stichwahl setzte sich dann der moderatere Vorschlag durch, diese Forderung zum nächsten Bundestagswahlkampf statt unmittelbar aufzustellen.

Wenn euch die Vorlage der vier Varianten interessiert, schicken Thies oder Lucy euch diese gern zu.

Wahlerfolg für „Landesvater Bodo Ramelow“

Die Auswertung der Thüringenwahl kam viel zu kurz. Bodo Ramelow und Susanne Hennig-Wellsow konnten Montag aufgrund vieler Termine erst ab 11:30 an der Sitzung teilnehmen und eilten um 12 Uhr mit den Parteivorsitzenden zur Bundespressekonferenz.

Landtag Erfurt 2011-05-18 mnII (55).JPG

Nach minutenlangen Standing Ovations für Bodo Ramelow für die Presse, an denen sich die Autorin nicht beteiligte, gab es hochlobende Beiträge der Parteivorsitzenden und dann Inputs von Susanne Hennig- Wellsow und Bodo Ramelow. Bodo Ramelow erklärte die Arbeitsteilung so, dass er alle drei Parteien vertrete und Susanne Hennig-Wellsow die Partei und diese Arbeitsteilung beim Arbeitskampf der Uniklinik Jena gut geklappt habe. Susanne Hennig-Wellsow lobte, dass Bodo Ramelow als „Landesvater“ überall respektiert sei. Sie verteidigte, dass es Wahlplakate mit Bodo Ramelow ohne Logo der LINKEN gab.

Leider werden diese Sichtweisen aus Sicht der Autorin von wenigen kritisch hinterfragt.

Bodo Ramelow verwies darauf, dass er Ministerpräsident bleibe und auch bereit sei, sich mit einfacher Mehrheit im dritten Wahlgang wählen zu lassen.

Natürlich sind 31 Prozent für DIE LINKE in Thüringen ein gutes Ergebnis. Es stellt sich jedoch zum einen die Frage, warum die AfD so stark werden konnte und ob DIE LINKE mit diesen 31 Prozent linke Politik betreiben wird und diese nutzt, die gesellschaftlichen Verhältnisse zu ändern oder nicht.

An Diskussionszeit verblieben genau 10 Minuten und es gab nur zwei Beiträge, unter anderem von Lucy, die neben den bekannten Differenzen zur Regierungsbeteiligung und einer Warnung vor Bündnissen mit der CDU fragte, ob DIE LINKE Thüringen die 31 Prozent denn nun gesellschaftlich für die Mobilisierung zur Umsetzung eines Gesetzes zu Mietabsenkung, Mietendeckel und einem Gesetz für bedarfsgerechte Personalbemessung im Krankenhaus nutzen werde. Bodo Ramelow antwortete, ein Mietendeckel sei Symbolik und die Regierung habe gerade erst 6000 Wohnungen zurückgekauft.

Das erinnerte die Autorin an das Motto des Berliner Bürgermeisters Müller statt auf Enteignungen auf „Kaufen, Bauen, Deckeln“ zu setzen – nur ohne Deckeln.

Die AKL bleibt gespannt, ob die 31 Prozent für wirklich linke Politik genutzt werden, oder ob es so weitergeht wie bisher mit sozialdemokratischer Politik. Die AKL spricht sich für eine Minderheitsregierung allein der LINKEN in Thüringen mit sozialistischer Politik, gestützt auf gewerkschaftliche Kämpfe und soziale Bewegungen, aus. Vier Beiträge aus dem Kreis der AKL zu Thüringen (vom Bundessprecher Thies Gleiss und von den AKL- Mitgliedern Claus Ludwig und Sebastian Rave) findet ihr hier:

https://www.antikapitalistische-linke.de

Weitere Beschlüsse

Außerdem wurde (neben weiteren Vorlagen) das Folgende beschlossen:

• Die Unterstützung der Proteste gegen den AfD-Bundesparteitag am 30.11./1.12. in Braunschweig und der bundesweiten Demonstration in Solidarität mit Rojava am 2.11. in Berlin

• eine finanzielle Unterstützung von Aufstehen gegen Rassismus, der Roten Ruhr-Akademie in Essen, des politischen Aschermittwochs in Bayern, dem Gedenken an 100 Jahre Kapp-Putsch des Kreisverbands Wesel

• politische Vorlagen zur Abschaffung des Solidaritätszuschlags, eine Rekommunalisierungskampagne

• die Durchführung des Jahresauftakts am 10.1.2020 ab 18h im „refugio“ in Berlin-Neukölln und der Gremienberatung mit dem Themenschwerpunkt 15 Jahre Agenda 2010 am 11.1.2020

Darüber hinaus wurden die Berichte zur Mitgliederentwicklung im dritten Quartal, der Finanzbericht und der Genderbericht 2018 zur Kenntnis genommen (und leider aus Zeitgründen nicht diskutiert, wir empfehlen die Lektüre) und die Berichte aus dem Jugend- und Studierendenverband entgegen genommen. Für Letztere soll in Zukunft mehr Zeit auch zur Diskussion eingeplant werden.

Berlin, 30.10.2019, Lucy Redler (und schöne Grüße von Thies Gleiss)

akl - Antikapitalistische Linke

————————————————————-

Grafikquelle           :

Oben        —       Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —        Susanne Hennig, 18. Mai 2011

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Stadtgespräch aus Zwickau

Erstellt von DL-Redaktion am 5. November 2019

Gedenken der NSU-Opfer in Zwickau – Nichts ist klar

Von Konrad Litschko

Vor acht Jahren flog der NSU auf. Das Erinnern an die zehn Mordopfer in Zwickau zeigt, wie wenig aufgearbeitet die Terrorserie ist.

In Zwickau stehen seit diesem Wochenende zehn Gedenkbäume im Schwanenteichpark. An Enver Şimşek, Abdurrahim Özüdoğru, Süleyman Taşköprü, Habil Kılıç, Mehmet Turgut, İsmail Yaşar, Theodoros Boulgarides, Mehmet Kubaşık, Halit Yozgat und Michèle Kiesewetter. Den zehn Mordopfern des „Nationalsozialistischen Untergrunds“, erschossen zwischen 2000 und 2007. Es ist ein Zeichen, dass Zwickau diese Menschen nicht vergessen will. Menschen, die starben, auch weil sich die NSU-Rechtsterroristen jahrelang unerkannt in Zwickau aufhalten konnten. Es ist ein überfälliges Zeichen.

Denn es ist inzwischen genau acht Jahre her, dass die Rechtsterrorserie aufflog – als sich in Eisenach Uwe Mundlos und Uwe Böhnhardt nach einem gescheiterten Bankraub erschossen und Beate Zschäpe in Zwickau den letzten Unterschlupf in die Luft jagte. Am Montag besuchte deshalb Bundeskanzlerin Angela Merkel die Zwickauer Gedenkbäume und legte Blumen ab. „Wir werden alles tun, damit sich so etwas nicht wiederholt“, sagte Merkel. Sachsens Ministerpräsident Michael Kretschmer geißelte die „furchtbare, menschenverachtende Ideologie“ des Rechtsextremismus. Auch dies: ein deutliches Zeichen, klare Worte.

Nur leider ist bei der NSU-Aufarbeitung, acht Jahre „danach“, nur wenig so klar. Und die Gedenkbäume in Zwickau legen dies schonungslos offen.

Es ist bereits vielsagend, dass die Stadt so viele Jahre brauchte, um diese Bäume aufzustellen. Lange wurde das Thema NSU in der Stadt nicht angefasst. Die CDU warnte vor einem Stigma für Zwickau, die AfD unterschrieb bis zuletzt ein Memorandum zum NSU-Opfergedenken nicht. Als BürgerInnen 2016 Gedenkbänke aufstellten, wurden diese sofort zerstört. Gleiches geschah vor wenigen Wochen mit einem ersten gepflanzten Baum für Enver Şimşek. Die Stadt wiederum befragte die Opferangehörigen erst gar nicht, was sie von der Pflanzaktion halten, lud sie auch nicht zur Gedenkfeier ein. Gamze Kubaşık, Tochter des Dortmunder NSU-Opfers Mehmet Kubaşık, spricht von einer „Unverschämtheit“.

Zwickau, Hauptmarkt 13-004.jpg

Als die Bäume nun am Sonntag eingeweiht wurden, waren die zehn Opfernamen auf den Gedenkplatten nur „eingedeutscht“ geschrieben. Auch legte die AfD nun doch einen Kranz nieder. Einige TeilnehmerInnen empfanden dies als Provokation: von einer Partei, die Rassismus befeuert und deren Vertreter den NSU-Prozess einst als „Schauprozess“ verunglimpfte. Eine Frau schnitt das AfD-Band ab, die Polizei nahm sie vorübergehend fest und löste so einen Tumult aus. Ein NSU-Opfergedenken, das die Opfer brüskiert: Es ist ein Sinnbild.

Abgeschreckt fühlt sich keiner

Denn es ist ja nicht nur Zwickau. Auch in Thüringen wurde vor Jahren schon eine NSU-Mahnstätte beschlossen, es gibt sie bis heute nicht. Gleiches in Köln. Und auch in Kassel, Heilbronn, Nürnberg oder Rostock wurden Gedenkplatten an die Opfer zerstört. Es ist also schon zu viel, unschuldig Ermordeten zu gedenken. Das ist infam.

Quelle        :    TAZ           >>>>>        weiterlesen

————————————————————

Grafikquelle          :

Oben          —          Die letzte Wohnung des NSU-Trios in Zwickau wurde von Beate Zschäpe im November 2011 zur Verdeckung zerstört

  • CC BY-SA 2.5Hinweise zur Weiternutzung
  • File:Nationalsozialistischer Untergrund – Explosion in Zwickau 2011 3 (aka).jpg
  • Erstellt: ‎16‎. ‎November‎ ‎2011

 

———————————-

Unten        —        Zwickau, Hauptmarkt 13

Abgelegt unter Innere Sicherheit, Medien, Regierung, Sachsen | Keine Kommentare »

Sind nun alle Bodo ?

Erstellt von DL-Redaktion am 5. November 2019

Für eine LINKE-Alleinregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–11.jpg

Quelle       :      AKL

Von Claus Ludwig.

Es ist gut, dass die LINKE zur stärksten Partei in Thüringen geworden ist und bei gestiegener Wahlbeteiligung in absoluten Zahlen und prozentual zulegen konnte. Doch Grund zum Jubeln ist dieses Ergebnis nicht. Zwei Wochen nach dem Doppelmord von Halle haben die Stichwortgeber der Nazi-Terroristen unter dem offenen Rechtsextremisten Björn Höcke ihre Stimmen mehr als verdoppeln können. Jetzt werden Rufe laut, die LINKE solle mit der CDU koalieren oder die FDP zu R2G dazuholen. Die LINKE sollte  dies ablehnen.

Wie in Brandenburg und Sachsen hat es bei der Landtagswahl in Thüringen eine scharfe Polarisierung anhand der Frage “für oder gegen die AfD” gegeben. Viele dieser Wähler*innen haben ihre Stimme der stärksten Anti-AfD-Kraft und damit der Partei des Ministerpräsidenten Bodo Ramelow gegeben. In Sachsen profitierte davon die CDU, in Brandenburg die SPD.

Die LINKE gilt – nicht zu Unrecht – im Osten als Teil des Establishments. Die Regierungsbeteiligung hat die LINKE verändert, nicht aber die Verhältnisse. Auch unter Bodo Ramelow gab es keinen Politikwechsel, sondern überwiegend ein “weiter so”.

Es ist rechnerisch nicht möglich, eine Regierung ohne LINKE oder AfD in Thüringen zu bilden. Eine Regierung mit der CDU würde, gerade angesichts der nahenden Wirtschaftskrise, dazu führen, dass die LINKE die Mitverantwortung für eine Politik übernimmt, die gegen die arbeitenden Menschen gerichtet ist. Das würde der AfD die Möglichkeit eröffnen, noch stärker zu werden. Das gleiche gilt, wenn die LINKE mit SPD, Grünen weiter regiert und sich die FDP als neoliberale Laus in den Pelz holt.

DIE LINKE hat 31% der Wähler*innen für sich mobilisiert. Was macht sie daraus? Wie baut sie auf der Grundlage eine starke antirassistische Bewegung auf, um die AfD zu bekämpfen? Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, mit klaren Eckpunkten und dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren (siehe unten).

In den nächsten Wochen wird viel von Verantwortung die Rede sein. Die wahre Verantwortung der LINKEN ist es, eine gesellschaftliche Alternative zu Sozialabbau, Niedriglöhnen, Armutsrenten und Rassismus zu formulieren und dafür auf allen Ebenen zu kämpfen – auf der Straße, im Parlament und – bei 31 Prozent Wähler*innen – auch in der Regierung. Das geht nicht mit den Establishment-Parteien von CDU, FDP, GRÜNEN und SPD, das geht nur mit einer linken Alleinregierung. Wenn die LINKE klare Beschlussvorlagen im Interesse der arbeitenden Menschen in den Landtag einbringt, müssen die etablierten Parteien Farbe bekennen, ob sie mit der AfD gegen die LINKE opponieren oder deren Anträge passieren lassen.

akl - Antikapitalistische Linke

Grafikquelle    :           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

LINKE vs. Höcke-AfD

Erstellt von DL-Redaktion am 4. November 2019

Analyse der Thüringer Landtagswahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle       :     AKL   

von Claus Ludwig, Köln

Der Aufstieg der AfD ist alarmierend und führt viele an die Wahlurne. Auch wenn es in Thüringen eine klare Mehrheit gegen die AfD gibt und nur 15 Prozent aller Wahlberechtigten (inkl. der Nichtwähler*innen) die rechtsextreme AfD unter Björn Höcke gewählt haben: Die politische Polarisierung war selten so deutlich wie bei dieser Wahl. Von der Stimmung gegen rechts hat die LINKE profitiert, die ihre Stimmen von 265.000 auf 344.000 (Zahlen auf Tausend gerundet) steigern konnte. Doch Jubeln und Freudenfeiern seitens der LINKEN sind fehl am Platz.

Die AfD konnte ihre Stimmen von 100.000 auf 259.000 um den Faktor 2,6 vermehren. Die AfD ist die Partei der erwerbstätigen Männer im mittleren Alter, liegt bei den 18-24jährigen knapp vor der LINKEN und bei den Erstwähler*innen knapp hinter ihr. Die stark von Senior*innen geprägte Altersstruktur des Landes ist einer der Faktoren, welche einen Durchmarsch der AfD verhindert haben.

Ein anderer Faktor ist das unterschiedliche Wahlverhalten von Frauen und Männern. Frauen haben in stärkerem Maße die LINKE gewählt. Das wird auch an der beruflichen Aufteilung deutlich: Bei der stärker weiblich geprägten Gruppe der Angestellten dominiert die LINKE mit 34 Prozent gegenüber 19 Prozent der AfD, bei Arbeiter*innen liegen beide nah beieinander (31 und 29 Prozent). Bei den Selbstständigen liegt die AfD vorn. Gewerkschaftsmitglieder haben zu 36,6 die LINKE und zu 22,6 Prozent die AfD gewählt, bei den Gewerkschaftsfrauen waren es 40,2 zu 16,2 Prozent.

Die AfD hat mit 34 Prozent eine besonders hohe Unterstützung unter denjenigen, die ihre eigene wirtschaftliche Situation als schlecht ansehen. Allerdings waren  nur 13 Prozent der Befragten der Meinung, die Lebensverhältnisse hätten sich in ihrem direkten Umfeld verschlechtert, für 31 Prozent sind sie gleich geblieben, 34 Prozent sehen sogar Verbesserungen. Bei den “Sorgen” dominierten die Angst vor “politischen Anschlägen” (80 Prozent), dem Klimawandel (65 Prozent), Kriminalität und dem Islam (54 Prozent). Sorgen um den eigenen Lebensstandard machen sich 31 Prozent.

Bei der Wahl der AfD gibt es Elemente von Protestwahl, aufgrund zuvor erlebter sozialer Ausgrenzung und der Benachteiligung des Ostens. Diese waren jedoch bei dieser Wahl nicht entscheidend. Die AfD wird zwar von vielen gewählt, die sich vernachlässigt oder abgehängt fühlen. Dies ist allerdings nicht deckungsgleich mit einem bereits erfolgten sozialen Abstieg. Es handelt sich auch um eine Zunahme verfestigter rassistischer und rechtsextremer Einstellungen, auch wurzelnd in der massiven Intervention von Nazi-Organisationen in den 1990er Jahren und der Förderung von Rassismus durch staatliche Institutionen und die Debatten der bürgerlichen Parteien. All dies wurde und wird begünstigt durch das Fehler einer wirklich klaren linken Alternative und starken Gewerkschaften.

Björn Höcke ist auch unter AfD-Wähler*innen umstritten – was diese nicht daran hindert, ihn zu wählen. 82 Prozent aller Wähler*innen sehen die AfD zu nah an rechtsextremen Positionen. Aber 47 Prozent der Befragten finden es gut, dass sie “die Zuwanderung begrenzen” will und 39 Prozent halten sie für eine “demokratische Partei wie die anderen Parteien auch”. 44 Prozent der AfD-Wähler*innen sehen Höcke zu nah am Rechtextremismus, aber 77 Prozent “finden es gut, dass er kein Blatt vor den Mund” nimmt.

Bei der AfD-Unterstützer*innen handelt es sich nicht überwiegend um harte Faschist*innen, die bereit zur Aktion sind. Doch die Akzeptanz völkisch-faschistischer Sprache und Propaganda ist hoch. Das Potenzial, von einer Phase überwiegend parlamentarischer Agitation zu Straßenaktionen überzugehen und die Landes-AfD zu einer aktiven faschistischen Kraft wie die NPD zu machen, wächst.

Die LINKE hat es mit ihrer Fokussierung auf den Ministerpräsidenten Bodo Ramelow geschafft, die Rolle von SPD und Grünen gleich mit zu übernehmen. Anders als in Sachsen und Brandenburg konnte sie ihre starke Position bei den über 60jährigen halten. Gleichzeitig wurde sie zur Gegenspielerin der AfD, legte in größeren Städten wie Jena, Erfurt, Weimar, Suhl und Gera sowie unter Erstwähler*innen, bei Menschen mit höherer Bildung und bei Frauen im erwerbstätigen Alter besonders stark zu. Dies sind Schichten, die in anderen Bundesländern vor allem die Grünen wählten, auch wegen ihrer scheinbar konsequenten antirassistischen Positionierung. Dieses Ergebnis ist vor allem der Bündnis-Konstellation auf Landesebene geschuldet. Dazu beigetragen hat allerdings auch die glaubhafte Positionierung von Bodo Ramelow und vieler bekannter LINKER, die sich an Blockaden gegen Nazi-Aufmärsche beteiligt haben oder im NSU-Untersuchungsausschuss aktiv waren.

Der Verlust der Regierungsmehrheit für R2G bei Stärkung der LINKEN ist ein Hinweis darauf, dass die Lager-Arithmetik der Regierungsbefürworter*innen in der LINKEN nicht stimmt. Es wird keine starke LINKE neben einer stabilisierten SPD und dynamischen Grünen geben. Wenn die LINKE erfolgreich ist, geht das auf Kosten der SPD und der Grünen. Der Aufschwung der Grünen ist hingegen mit einer Begrenzung der LINKEN verbunden.

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -96.jpg

Solange nicht auf der Basis verstärkter Klassenkämpfe die Gesellschaft in Bewegung gerät und weitere Schichten von bisherigen Nicht-Wähler*innen erreichbar werden, bleiben die Verschiebungen bei den Wahlen im Großen und Ganzen innerhalb der Lager. Die Grünen profitieren vom Niedergang der SPD, die LINKE vom Schwächeln der Grünen. Die CDU verliert an die AfD. Ausnahmen bestätigen die Regel: In Thüringen gab es eine bedeutende, aber nicht entscheidende Wanderung von 23.000 CDU-Wähler*innen zur LINKEN. Die CDU-Spitze hatte versucht, LINKE und AfD gleichermaßen auszugrenzen, dies wurde von deren Wähler*innenschaft mehrheitlich abgelehnt.

Die in Berlin regierenden Parteien kommen nicht aus ihrer Krise heraus, und das am Vorabend des wirtschaftlichen Abschwungs. Die Meinung der meisten Thüringer*innen über die SPD ist eindeutig: “nur mit sich, ihrem Personal und Posten beschäftigt”.

Die Zahlen stammen aus: “Die Wahl zum 7. Thüringer Landtag am 27. Oktober 2019, WAHLNACHTBERICHT UND ERSTER KOMMENTAR”, Horst Kahrs und Benjamin-Immanuell Hoff, Rosa-Luxemburg-Stiftung sowie von Infratest Dimap im Auftrag der ARD-Tagesschau.

akl - Antikapitalistische Linke

————————————————————————–

Grafikquelle        :

Oben           —         Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —         Landtagswahl Thüringen am 14. September 2014

Abgelegt unter L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Linke sollte Kämpferisch sein

Erstellt von DL-Redaktion am 3. November 2019

Statt Sozialdemokratie 2.0

2019-10-27 Wahlabend Thüringen by Sandro Halank–53.jpg

Besser nicht so ?

Quelle       :       AKL 

Von von Sebastian RaveBremen

Die ernüchternden Wahlergebnisse in Brandenburg und Sachsen scheinen bei der LINKEN fast schon wieder vergessen zu sein. Nach dem Wahlerfolg von Bodo Ramelow in Thüringen und der ersten Regierungsbeteiligung im Westen in Bremen gehen kritische Stimmen im Knallen der Sektkorken unter. Dabei liegt gerade in diesen vermeintlichen Erfolgen eine Gefahr für DIE LINKE.

Es gibt nichts Grundlegendes, was die LINKE, die in Sachsen und Brandenburg verloren hat, von der LINKEN unterscheiden würde, die in Thüringen gewonnen hat. Alle drei Landesverbände stehen für die Hoffnung, als linker Teil eines “linken Lagers” in der Regierung eine graduelle Verbesserung der Verhältnisse erreichen zu können.

Tatsächlich sind die Regierungserfolge beispielsweise in Thüringen aber eher überschaubar. Der Verfassungsschutz blieb ebenso unangetastet wie die Schuldenbremse (wie in Bremen), ein Landesmindestlohn, der auch bei Aufträgen von Kommunen gilt, wurde nicht eingeführt. Dafür ist Thüringen heute das Land mit dem zweitgrößten Niedriglohnsektor (30%).

Das Scheitern des Projekts Sozialdemokratie 2.0 lässt sich deutlich daran festmachen, dass eines der Ziele des Koalitionsvertrags der scheidenden rot-rot-grünen Regierung lautete: „Der Kampf gegen alte und neue Nazis, gegen Rassismus und Antisemitismus, muss entschlossen fortgesetzt werden“. Bei allem Bemühen und der Teilnahme an Demonstrationen: Am Ende der Legislatur wurde das Ziel, Nazis und Rechtspopulist*innen wirksam zu bekämpfen, verfehlt. Und leider trägt auch DIE LINKE mit ihrer wirkungslosen sozialdemokratischen Politik einen Teil der Verantwortung dafür. Wenn die Menschen das Gefühl haben, trotz einer linken Regierung Bürger*innen zweiter Klasse zu bleiben und DIE LINKE Teil des Establishments ist, hat es eine rechte Opposition eben leicht.

Die ehemalige Sozialdemokratie ist nicht aus reiner Boshaftigkeit zur neoliberalen Agenda-2010-Partei geworden, sondern weil sie sich den Sachzwängen des globalisierten Kapitalismus gebeugt hat. Dieser ist mittlerweile in einer tiefen Krise, die Sachzwänge verschärfen sich sogar noch weiter – ein Kurswechsel bei der LINKEN weg von der Sachzwanglogik ist deshalb dringend nötig.

Die Partei muss sich endlich trauen, den Kapitalismus nicht nur in Programmen in Frage zu stellen. Sie muss sich in den Stadtteilen und Arbeitsplätzen verankern, indem sie eine konstruktive Rolle bei jeder kleinen und großen Gegenwehr spielt. Zum Beispiel wurde der Mietendeckel in Berlin vor dem Hintergrund einer monatelangen Debatte über Enteignung von Immobilienkonzernen als Zugeständnis an die Bewegung durchgesetzt. Wenn es auch in Bremen und Thüringen solche Verbesserungen geben soll, reicht es nicht, SPD und Grüne am Kabinettstisch mal darauf anzusprechen. Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren. Zu den Eckpunkten sollten gehören:  1. Nichtumsetzung der Schuldenbremse, 2. Bekämpfung der Niedriglöhne, 3. Stopp aller Abschiebungen, 4. Mietendeckel, Mietsenkung und Enteignung der Immobilienkonzerne, 5. Einführung eines Landesgesetzes zur bedarfsgerechten Personalbemessungen in den Krankenhäusern (Thüringen könnte hier Vorreiter werden!) 6. Bedarfsgerechter Haushalt, 7. Rückgängigmachen von Privatisierungen.

Wir gehen nicht davon aus, dass sich SPD und Grünen an einer Regierung mit einem solchen Programm beteiligen würden. Aber das wäre ein Brechen mit der Sachzwanglogik und würde die Frage nach einer gesellschaftlichen Alternative zum Kapitalismus konkret auf die Tagesordnung stellen.

akl - Antikapitalistische Linke

———————————————————————

Grafikquelle         :       Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

30 Jahre Mauerfall

Erstellt von DL-Redaktion am 2. November 2019

Geistiges Kleingärtnertum

Von Stefan Reinecke

Non Stefan ReineckeDie westdeutsche Linke träumte von Revolutionen. Doch als 1989 eine vor ihrer Haustür geschah, war sie überfordert.

Wir kennen die Bilderschleifen, die jeden 9. November aufs Neue gezeigt werden. Wahnsinn-Rufe, knatternde Trabis, Genscher und der Jubel in der Prager Botschaft. Auch Bilder können Floskeln werden, die mehr verstecken als erhellen. Im Herbst 1989, sagen diese Bilder, waren die Deutschen begeistert.

Alle Deutschen? Die Stimmung im Westen war viel schwankender. Im September waren aus der DDR schon Zehntausende in den Westen gekommen. Es fehlten Wohnungen und Jobs. Laut einer Umfrage meinte fast die Hälfte der Westbürger, das Boot sei jetzt leider voll und die Ostler sollten bitte in Plauen und Güstrow bleiben.

Ein paar Wochen nach dem Mauerfall ventilierte Oskar Lafontaine, ob DDR-Bürger weiterhin ein Anrecht auf Sozialleistungen haben sollten. Damit fördere man ja deren Abwanderung. Der SPD-Chef wollte, zumindest für eine Weile, zwei Staatsbürgerschaften. Lafontaine wollte die DDR genau in dem Moment faktisch anerkennen, in dem die SED politisch und die DDR wirtschaftlich kollabierte.

Er spekulierte auf das Gefühl der Westler, von den Habenichtsen aus dem Osten überrannt zu werden. In seinen Reden erschien die Einheit eher als unvermeidliches Übel. Die Grünen rangen sich widerwillig im Frühjahr 1990 – noch nach der SED/PDS – dazu durch, anzuerkennen, dass die Zweistaatlichkeit Geschichte war.

Keine Hürde für Europa

Die Erklärungen von Sozialdemokraten und Grünen bezeugen, 30 Jahre später gelesen, Realitätsblindheit. Warum diese Irrtümer? Der Historiker Timothy Garton Ash hat die Unfähigkeit der SPD im Herbst 1989 mit der erstarrten Ostpolitik erklärt.

Die SPD war demnach auf die SED-Führung und die Politik kleiner Verbesserungen fixiert und nahm die Bürgerbewegung nur als Störung wahr. Die späte Ostpolitik zeigt in der Tat Wahrnehmungsblockaden einer Politik, die auf Verständigung mit den Macht­eliten einer Diktatur verengt war. Allerdings waren die Grünen eng mit der Bürgerbewegung verdrahtet – und hatten ähnliche blinde Flecken.

Die westdeutsche Linke versagte 1989 komplett: moralisch, analytisch und politisch. Moralisch gab es keine Rechtfertigung dafür, dem DDR-Volk, das sich gerade befreit hatte, vorzuschreiben, in welchem Staat es zu leben hatte. Warum sollte Selbstbestimmung in Tibet und der Westsahara gelten, aber nicht zwischen Rostock und Görlitz? Zudem hatte die DDR laut Grundgesetz-Artikel 23 misslicherweise das Recht, der Bundesrepublik beizutreten.

Politisch hechelte die Linke dem Geschehen hinterher. Kohl setzte zügig die Währungsunion um. Dazu gab es angesichts des Abwanderungsstroms von Ost nach West keine realistische Alternative. Doch Lafontaine war überzeugt, dass die Währungsunion ein Fiasko würde und Kohl, der Nationalist, von seinen haltlosen Versprechungen eingeholt würde. Auch die atemlose Kritik, dass die deutsche Vereinigung die europäische zerstören würde, war falsch. Kohl setzte die Einheit zusammen mit Paris, London, Moskau und Washington ins Werk. Die deutsche Einheit war keine Hürde für Europa – im Gegenteil.

Gegen den Kapitalismus

Nach dem 9. November zeigte sich das geistige Kleingärtnertum der politischen Linken. Sie war fasziniert von Revolten gegen Autokraten – in dem Moment, in dem eine Revolution vor ihrer Haustür passierte, war sie schnell irgendwie beleidigt. Eine Epoche ging zu Ende. Die radikale Linke nahm übel, weil die Ossis genau das wollten, was sie ablehnte: Parlamentarismus und Kapitalismus. Viele Sozialdemokraten und Grüne klammerten sich an ihre eingravierte Überzeugung, dass es zwei deutsche Staaten geben müsse, und mäkelten, dass Kohl wieder alles falsch mache. Aber Kassandra gewinnt keine Wahlen.

Warum dieses Versagen? Es wurzelte nicht in der Nähe zum SED-Regime, sondern tiefer. Es gab in der Linken zwar eine kleine Strömung – um Rudi Dutschke, Tilman Fichter und Peter Brandt – die die Einheit als linkes Projekt verstanden. Doch das Gros hielt das für einen bizarren Spleen.

Die meisten Linken verstanden die Teilung irgendwie als gerechte Strafe für die NS-Verbrechen. Das war historisch Unsinn: Die innerdeutsche Grenze war, wie jedes Schulkind wissen konnte, Resultat des Kalten Krieges. Aber unser Gefühl sagte etwas ­anderes. Wir waren, manche insgeheim, manche ­offen, froh, dass die Mauer die fatale Geschichte des deutschen Nationalstaates beendet hatte.

Bundeshauptstadt Bonn 04.jpg

Ich will die neue Kanzlerin werden. Mein Hab und Gut habe ich mitgebracht.

Und gab es dafür nicht auch solide, vernünftige, moralische Motive? Der Historiker Hans Mommsen hatte 1981 eine historische Einordnung des bundesrepublikanischen Selbstgefühls skizziert. Wie in Österreich gebe es in der Bundesrepublik das Bewusstsein, etwas Eigenes geworden zu sein. Der Bismarck’sche Nationalstaat sei Geschichte und die Deutschen seien angesichts der Katastro­phen des 20. Jahrhunderts besser in mehreren Staaten aufgehoben.

Die westdeutsche Linke war postnational – und damit Avantgarde. Die Hälfte der unter Dreißigjährigen im Westen empfand die DDR 1987 als Ausland. In einem CDU-Programmentwurf von 1988 kam die Wiedervereinigung nicht mehr vor. Hatte nicht auch Helmut Kohl 1981 festgestellt, dass „die verlorene Einheit im Sinne eines alten Nationalstaates nicht mehr wiederherstellbar ist“?

Quelle          :        TAZ         >>>>>        weiterlesen

———————————————————————

Grafikquelle          :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

——————————

2.) von Oben    —           DL / privat  – CC BY-SA 3.0

———————–

Unten         —        Die Bundesumweltministerin Angela Merkel am Stresemannufer hinter dem Plenarsaal der ehemaligen Bundeshauptstadt Bonn beantwortet einem Fernsehteam deren Fragen. Im Hintergrund ist das Abgeordnetenhochhaus Langer Eugen zu sehen. Fotografische Impressionen von Andreas Bohnenstengel während der Parlamentarischen Woche im Juni 1995 in: Der Dreizehnte Deutsche Bundestag. Innenansichten unseres Parlaments. ISBN 3-87576-357-2

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Sexismuskritik -+- Wedding:

Erstellt von DL-Redaktion am 1. November 2019

Das „viertcoolste“ Stadtviertel der Welt

File:Strassenschild luederitzstr berlin.JPG

Ist es nicht eine alte Tradition der Politiker – Innen, ehemalige Mörder und Verbrechen durch  Benennung von öffentlichen Plätzen und Straßen im Gedächnis  einzuzementieren.  Motto wir sind heute soooo viel besser !!

Quelle      :         Untergrund-blättle CH.

Von    lcm

Vor gut einem halben Jahr, es war die Nacht zum 8. März, zogen wir durch die menschenleeren Strassen im Wedding, um uns zur Feier des Tages einen Teil des öffentlichen Raums anzueignen.

Wir sind eine Gruppe organisierter Frauen aus dem Wedding, die anlässlich des Frauenstreiks verschiedene Aktionen in ihrem Kiez durchgeführt haben. Eine davon die Umbenennung von Strassennamen.

Es gibt knapp 10.000 Strassen in Berlin. 90 % der nach Personen benannten Strassen tragen männliche Namen. In anderen Städten sieht das Verhältnis genauso aus. Keiner dieser Namen ist zufällig gewählt, die Strassenbenennung ist eine Würdigung und ein unübersehbares Gedenken an diese Person. Gedacht wird allerdings fast ausschliesslich Männern, darunter auch so besondere Schätze wie Axel Holst, ein SS-Sturmführer oder Adolf Lüderitz, ein Kolonialherr. Gleichzeitig werden Frauen in der Geschichte und im öffentlichen Raum systematisch unsichtbar gemacht, obwohl es zahlreiche tatsächlich verdienstvolle Frauen gibt.

Anlässlich des Frauenstreiks in Berlin haben wir mehrere Strassen, die jeweils einen Mann würdigen, umbenannt. Wahlweise in Elise-Hampel-Strasse, Stephanie-Hüllenhagen-Weg oder auch Luise-Kraushaar-Allee. Sie alle waren NS-Widerstandskämpferinnen, die zum Teil auch im Wedding gelebt haben. An jedes Strassenschild befestigten wir ausserdem einen Steckbrief zur Person und der Erklärung, warum diese Strasse nun einen Frauennamen trägt. Die Müllerstrasse, die so etwas wie die Hauptstrasse im Wedding ist, benannten wir ausserdem in „Müllerinnenstrasse“ um.

Mit der einsetzenden Morgendämmerung fielen wir zufrieden in unsere Betten. Die Aktion war geglückt. Das böse Erwachen kam dann einige Monate später in Form eines Grossflächenplakats, prominent platziert auf dem Mittelstreifen der Müllerstrasse. Auf ca. 2×3 Metern war da ein Foto der von uns umbenannten „Müllerinnenstrasse“ zu sehen. Unsere Kritik war plötzlich Teil einer Kampagne der StandortGemeinschaft Müllerstrasse e.V., gefördert vom Bundesministerium des Innern, für Bau und Heimat sowie der Berliner Senatsverwaltung für Stadtentwicklung und Wohnen. Kannste dir nicht ausdenken.

Nun ist es sicherlich kein neues Phänomen, dass Systemkritik verwertbar und warenförmig gemacht wird. Auffällig ist aber, dass man sich derzeit besonders gern mit feministischen Attitüden schmückt. Sexismuskritik sells. Da werden im Sweathsop produzierte Shirts mit frechen feministischen Sprüchen verkauft, einer der bekanntesten Hersteller für Rasierer ruft zur „Selflove-Challenge“ auf, weil Frauen sich doch so mögen sollen wie sie sind (nur bitte ohne Haare unter den Achseln!) und „Problemkieze“ bekommen mit gegenderten Strassenschildern ein hippes Image, um sie attraktiver für Investor*innen zu machen. Feminismus wird zur erfolgreichen Marketingstrategie.

Im Wedding taucht das Plakat ausserdem zu einem Zeitpunkt auf, an dem der Gentrifizierungsprozess so richtig an Fahrt gewinnt. Das internationale „Time Out Magazine“ erklärte jüngst den Wedding zum „viertcoolsten“ Stadtviertel der Welt und beschreibt den Kiez wie folgt: „This neighbourhood in north-west Berlin feels warm and inviting, with street markets and sprawling public parks frequented by young families and long-time residents alike. Striking Weimar-era architecture contrasts with the harsh lines of former factories – a hangover from Wedding’s history as a working-class district in West Berlin“. Dazu ein Titelbild, das ausschliesslich weisse, adrett gekleidete Menschen zeigt, die gemütlich im Nordhafenpark sitzen. Man könnte lachen, wenn es nicht so traurig wäre.

Vor ein paar Tagen hat dann noch das Projekt Mietenwatch seine Studie veröffentlicht, bei der 80.000 Wohnungsangebote in 477 Kiezen in Berlin ausgewertet wurden. Das Ergebnis? Es gibt kaum noch bezahlbaren Wohnraum. Bezahlbar bzw. als „leistbar“ gelten Wohnungen, deren Gesamtmiete 30 % des Netto-Haushaltseinkommens nicht übersteigt. Für Haushalte mit niedrigem Einkommen sind Mieten aber bereits in dieser Höhe mit erheblichen Lebensqualitätseinschränkungen verbunden. Und damit hat Berlin gleich noch einen weiteren Weltlistenplatz belegt: Laut des „Global Residential Cities Index“ sind die Immobilienpreise in Berlin zwischen 2016 und 2017 um 20,5 Prozent gestiegen. Damit liegt die Stadt beim Preisansteig von Immobilien weltweit auf Platz eins. Glückwunsch.

File:Berlin Gesundbrunnen mit Stephanuskirche von Humboldthöhe.jpg

Die Studie von Mietenwatch zeigt ausserdem, dass der Verdrängungsdruck im Wedding am höchsten ist. Ob Humboldthain, Reinickendorfer Strasse, Leopoldplatz oder Soldiner Strasse – für Vermieter*innen ist es hier besonders lukrativ Altmieter*innen loszuwerden und die Wohnung danach teurer weiterzuvermieten. Ja, der Wedding kommt. Was lange Zeit ein Running Gag war, scheint nun bittere Realität zu werden. Die meisten von uns haben das bereits am eigenen Leib zu spüren bekommen und nervenzehrende Auseinandersetzungen mit der eigenen Hausverwaltung hinter sich oder stecken mitten drin.

Doch auch wenn all diese Dinge eine enormes Frustrationspotential bieten, wir werden weder die kapitalistische Ausschlachtung feministischer Kämpfe noch die Verdrängung aus unseren Kiezen akzeptieren. Gemeinsam kämpfen wir gegen den Ausverkauf der Stadt und unserer Kieze. Ob in Berlin oder anderswo: Der Aufbau von Gegenmacht hat gerade erst begonnen.

# Die Autorin Ella Papaver lebt in Berlin-Wedding und ist organisiert in der Kiezkommune Wedding

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————–

Grafikquellen          :

Oben            —          Straßenschild der Lüderitzstraße in Berlin-Wedding (Afrikanisches Viertel), benannt nach Adolf Lüderitz (1834-1886

Author Chrischerf  /    Source      –      Own work
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

————————–

Unten            —         Panorama from the Humboldthain

Author Andreas Praefcke    /      Source     :     Own work
This file is licensed under the Creative Commons Attribution 3.0 Unported license.

Abgelegt unter Berlin, Kriegspolitik, Mensch, Regierung | Keine Kommentare »

Sozis, vereint euch wieder!

Erstellt von DL-Redaktion am 1. November 2019

Sozialdemokratisierung der Linkspartei

2019-10-27 Wahlabend Thüringen by Sandro Halank–53.jpg

Von Jan Feddersen

In Thüringen mag auf dem Label der Sieger:innen „Linkspartei“ stehen – gewonnen hat Sozialdemokratie pur. Zeit für eine Wiederannäherung.

Wir als Publikum schauen zu, manche gar mit gewissen Anteilen an Schadenfreude, wie die Union sich allmählich zu zerlegen beginnt – weil ihr Chef in Thüringen, Mike Mohring, an das Naheliegende laut zu denken wagte: Gespräche mit der Linkspartei.

Mohrings Wunsch zu erfüllen könnte so einfach sein, denn die Linkspartei ist ja nur noch mit historischem Blick eine in der SED-Nachfolge. Blickt man also einfach auf das Faktische, nicht auf das für die Union (und nicht nur für sie) Fürchterliche: Die Linkspartei, sagen Letztere, sei Mauerbau, Schießbefehl, die Erb:innenschar der Margot und Erich Honeckers und Erich Mielkes sowieso.

Die Fakten zur Kenntnis genommen, also die kommunale Praxis in Thüringen mit Bodo Ramelow als Ministerpräsident, und nötigenfalls auch das Programmatische, dann handelt es sich bei der Gräuelpropaganda wider die Linkspartei um verzweifelte Augenwischerei. Thüringens Linkspartei mit der ultraklugen Susanne Hennig-Wellsow an der Spitze ist nichts als eine sozialdemokratische, mainstreamig-mittige Partei, wie es sie im besten Sinne in der alten Bundesrepublik einst auch mal gab – als SPD.

Eine Partei ohne volxpädagogische Allüren, ohne eitlen Schein, das Große und Ganze verändern zu können, dafür eine Organisation der Kümmer:innen, der Pragmatiker:innen, der Fortschrittsgläubigen in jeder kleinen Verbesserung des Alltags, und sei es die Verdichtung der Taktzeiten im öffentlichen Nahverkehr, der Rentenberatung, der Inklusion über Plattformen für Rollstuhlfahrende an Tramhaltestellen.

Die SPD, eine Partei der Büroleiter

Eine Partei nicht der Hipster, sondern eine, die besorgt ist um die konkrete Besserung der Lebenschancen von jenen, die es nicht so dicke im Portemonnaie haben; und eine, die auf eine kluge Wirtschaftspolitik, auf Kommunikation mit Unternehmen und Betrieben nicht verzichtet, also den Kapitalismus schlechthin bejaht – und ihn zu formen versucht.

Dass die real existierende SPD es nicht schafft, dieses Image auszufüllen, dass sie gar, mit einem Wort des Politikwissenschaftlers Franz Walter gesagt, vor allem eine Partei der Büroleiter sei, wurde in Thüringen ebenfalls offenkundig: Wolfgang Tiefensee, nun wirklich kein Unsympath, holte nur etwas mehr als acht Prozent. Die SPD ist ein Schiff, das gerade sehr schön und unnötig vor sich hin sinkt.

Die Sozialdemokratie, die sich auch so nennt, hat aktuell und auf absehbare Zeit einen politischen Appeal an Attraktivität wie eine ehemalige Textillinie, die vollkommen aus der Mode geraten ist, weil sie weder gut aussieht noch in Zukunft wieder up to date wird: nur noch museumsfähig.

Erfurt cathedral and severi church.jpg

Die Rechten freut dies natürlich, die Konservativen der Union haben Mitleid, vielleicht auch, weil ihr ähnliche Überflüssigkeit droht – zerrieben nämlich zwischen Rechten auf der einen und den immer schon linksbürgerlichen Grünen auf der anderen Seite.

Verzagt und hochmütig zugleich

Es mag ja eine Binsenweisheit sein, aber sie sei betont: Es braucht eine große linke Partei, und zwar nicht für ihre Mitglieder, die ihre linke Identität pflegen wollen, sondern als Organisation, die in den politischen Praxen Rechten, Konservativen und Liberalen (wie auch Grünen) Repräsentationsmacht entgegensetzen kann.

Quelle       :          TAZ          >>>>>           weiterlesen

————————————————————-

Grafikquellen        :

Oben           —         Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

Abgelegt unter L. Thüringen, P. DIE LINKE, P.SPD, Regierungs - Werte | Keine Kommentare »

Zukunft der Linkspartei

Erstellt von DL-Redaktion am 31. Oktober 2019

Caren Lay tritt an

2014-09-12 - Caren Lay MdB - 8936.jpg

Aus Berlin Martin Reeh

Die wohnungspolitische Sprecherin der Linken will Sahra Wagenknecht als Ko-Fraktionschefin nachfolgen. Am 12. November wird die neue Spitze gewählt.

Mit Caren Lay hat eine erste Bewerberin ihre Kandidatur für die Nachfolge von Sahra Wagenknecht als Fraktionsvorsitzende öffentlich angemeldet. Die 46-jährige ist derzeit Vize-Fraktionschefin und wohnungspolitische Sprecherin der Fraktion. Der Fraktionsvorstand wird am 12. November neu gewählt.

„Wir brauchen ein starkes Zentrum und strömungsübergreifende Zusammenarbeit“, sagte Lay am Mittwoch gegenüber den Medien in Berlin. „Erwerbslose und Beschäftigte können sich keine zerstrittene Linke leisten.“ Sie stehe für eine „Kultur der Anerkennung“ und der „Wertschätzung“ der Arbeit der 69 Abgeordneten. Wagenknecht stand fraktionsintern in der Kritik, weil sie zwar zahlreiche öffentliche Auftritte absolviert, die eigentliche Fraktionsarbeit aber vernachlässigt hatte.

Lay wurde im rheinland-pfälzischen Neuwied geboren, studierte in Marburg, Frankfurt am Main und Berlin. 2000 ging sie als Mitarbeiterin zur PDS-Fraktion nach Sachsen, war kurzzeitig Redenschreiberin für die grüne Bundesministerin Renate Künast, ehe sie 2004 als PDS-Abgeordnete wieder nach Sachsen zog.

Von 2010 bis 2012 arbeitete sie als Bundesgeschäftsführerin, ein Jahr hatte sie ein Mandat im Bundestag angetreten. Seitdem hat sie sich in der Mietenpolitik einen Namen gemacht und das Thema sowohl in ihrer Partei auf die Tagesordnung gesetzt als auch Verbindung mit Basisgruppen geschaffen.

Caren Lay fährt Trecker (6406525507) (2).jpg

Lay könnte den inoffiziellen Anforderungen ihrer Fraktion an eine Ost-West-Quotierung genügen, auch wenn sie nicht im Osten aufgewachsen ist. Die Noch-Fraktionsvorsitzende Wagenknecht war den umgekehrten Weg gegangen: Sie wuchs im Osten auf, ging in den Westen und kandidierte für den Landesverband NRW.

Ob ihre Wahl die persönlich wie politisch zerstrittene Fraktion einen könnte, ist schwieriger zu beantworten. „Es gibt bisher eine positive Resonanz auf meine Kandidatur, insbesondere aus der Mitte der Fraktion“, sagte Lay, die als Vertraute von Parteichefin Katja Kipping gilt.

Was wird mit den Wagenknechtianern?

Quelle        :          TAZ          >>>>>          weiterlesen

————————————————————————-

Grafikquellen       :

Oben         —      Personality rights warningAlthough this work is freely licensed or in the public domain, the person(s) shown may have rights that legally restrict certain re-uses unless those depicted consent to such uses. In these cases, a model release or other evidence of consent could protect you from infringement claims. Though not obliged to do so, the uploader may be able to help you to obtain such evidence. See our general disclaimer for more information.

—————————-

Unten           —              Caren Lay im Trecker.

Abgelegt unter Berlin, Deutschland, Opposition, P. DIE LINKE | 1 Kommentar »

Sind wir alle Bodo?

Erstellt von DL-Redaktion am 31. Oktober 2019

Zum Ausgang der Wahl in Thüringen

Quelle     :         Scharf   —   Links

Kommentar  von systemcrash

Die Wahlergebnisse von Thüringen sind schon in mehrfacher Hinsicht ein Hammer! Ich bin kein Wahlanalyst und werde daher nur auf die Aspekte eingehen, die mir politisch am interessantesten erscheinen.

1.) Leider muss ich mit der AfD beginnen: 23,4% sind ein Wert, der einfach nicht mehr ignorierbar ist. Und das mit Björn Hocke als ausgewiesener Vertreter des rechten, völkischen Flügels. Wenn sich die AfD auf dieser Höhe der Stimmen stabilisieren kann (was keineswegs sicher ist) dann wird über kurz oder lang die ‚Koalitionsfrage‘ gestellt werden (müssen), weil anders dann Regierungsbildungen von den Stimmenverteilungen her nicht mehr möglich sind.

2.) Die 8,2% für die SPD sind redlich verdient für diese Partei. Ob sich bei diesem Ergebnis auch der GroKo-Faktor mit auswirkt, kann ich nicht sagen (ist aber zu vermuten). Das gleiche gilt für die 21,8% für die CDU: ob sich hier mehr die Landespolitik ausgewirkt hat oder die Bundespolitik dürfte nur schwer zu ermitteln sein. Insgesamt scheint es mir aber nicht falsch zu sein, die Thüringen-Wahl als ‚Klatsche‘ für die Groko zu bezeichnen, auch wenn Ursachen und Wirkungen vlt. etwas differenzierter zu analysieren wären.

3.) Kommen wir zur ‚Bodo-Partei‘. Gestern postete die LINKE auf einer ihrer facebook-seiten: „heute sind wir alle Bodo“. Dabei bleibt unklar, ob damit die gesamte Bevölkerung (von Thüringen) gemeint ist oder die gesamte LINKSPARTEI. Aber egal, wie es gemeint ist, der Spruch wird in keiner Bedeutung wirklich besser!

Natürlich sind die 31% für die LINKE ein starker Erfolg, und von daher ist die innerparteiliche Freude darüber auch bis zu einem gewissen Grad gerechtfertigt (zumal vorher schwere Mißerfolge bei Wahlen eingefahren wurden). Aber ab hier muss man abrupt mit einer Auflistung der Wermutstropfen beginnen:

a) Der Erfolg der AfD ist sehr ernstes Warnsignal, über das auch der Erfolg der LINKEn nicht hinwegtäuschen kann. Thies Gleiss vom ‚linken Flügel‘ der PDL schreibt in einem facebook-Kommentar:

„Es gibt ja auf LINKE-Führungsebene vor Schließung der Wahllokale immer ein besonders bescheuertes Schmankerl: Das Karl-Liebknecht-Amt (wer genau weiß ich nicht) verbreitet an die Spitzenfunktionäre der LINKEN sogenannte „Sprachregelungen“, wie die jeweils möglichen Wahlergebnisse kommentiert werden sollen. Das beginnt dann immer mit Danksagungen an Wähler*innen und Wahlkämpfer*innen und endet mit verschiedenen Varianten, den Ausgang der Wahlen speziell für die LINKE positiv darzustellen. Bisher habe ich dieses Ritual mit kopfschüttelndem Schweigen begleitet. Aber heute will ich mich ausdrücklich und lautstark gegen eine dieser vorgeschlagenen Sprachregelungen zur Wehr setzen.
Ginge es nach diesen Vorgaben soll nämlich nicht „von uns aus auf das Ergebnis der AfD“ eingegangen werden. Dazu ein dickes und unmissverständliches Nein!“

b) Bodo Ramelow hat einen stark personenbezogenen Wahlkampf geführt, der voll auf den Landesvater-Bonus gesetzt hat und programmatische Polarisierungen quasi neutralisiert (um nicht zu sagen: eliminiert) hat. Der Spruch „Ihr könnt mich gleich mit der Stimme für drei Parteien wählen“ ist dafür symptomatisch. Dass er mit Plakaten geworben hat, die nur sein Konterfei zeigten ohne den Schriftzug ‚die LINKE‘ ist dann natürlich konsequent. Dass diese Art ‚Wahlkampf‘ aber entpolitisierend ist und wirkt, obgleich das Interesse der Wähler stark war, diese Überlegungen spielen wohl in der LINKE eher eine untergeordnete Rolle (wenn überhaupt). Dass man aber auf diese Weise (zumindest langfristig) der AfD dazu verhilft, sich als ‚einzige Opposition‘ zu gerieren, darüber wäre es aber schon wert zu reflektieren.

Im Blog der Tagesschau heisst es heute in einem Kommentar:

[Bodo Ramelow] „hat trotz seiner Partei die Landtagswahl gewonnen – nicht wegen ihr.“

Besser könnte ich es auch nicht sagen. 😉

Der oben zitierte Kommentar von Thies Gleiss ist überschrieben mit: „ERFOLGREICHE UMGRUPPIERUNG SOZIALDEMOKRATISCHER WÄHLER*INNEN“. Nun, der Ausdruck ‚Umgruppierung‘ klingt ein bisschen bombastisch (mit Umgruppierungen sind eigentlich im innerlinken Diskurs Spaltungs- und Fusionsprozesse von linken Gruppen  [in der Regel eher ‚kleiner‘ Organisationen] gemeint). In diesem Zusammenhang geht es aber ’nur‘ um die ‚Stimmen-Umverteilungen‘ oder wie es so schön in den Wahlberichterstattungen heisst ‚Wählerwanderungen‘.

Dass der Wahlkampf von Ramelow ’sozialdemokratisch‘ war (bestenfalls!), da könnte ich ja noch mitgehen. (Wobei die Landesvater-Attitüde [„Ich kenne fast jede Milchkanne„] schon auch einen stark populistischen Zug an sich hat). Ob aber alle Stimmen von SPD- und Grünen-Anhängern, die jetzt Ramelow gewählt haben, als ‚reformistisch‘ zu werten sind, da würde ich aber ein ganz dickes Fragezeichen setzen wollen!

Wenn es also eine ‚Umgruppierung‘ gab, dann die, dass sich die ‚Mitte‘ diesmal (und da dürfte Thüringen tatsächlich ein Ausnahme-Einzelfall sein) in der LINKEn gefunden hat; und das hätte ohne die dramatis personae in Gestalt von Bodo Ramelow nicht stattfinden können. Wenn also die PDL schreibt: „wir sind alle Bodo“ dann heisst das eigentlich ‚wir sind ein (legitimer) Teil der politischen Mitte‘. Natürlich würden das nicht alle PDL-Mitglieder auch so sagen (jedenfalls nicht der ‚linke Flügel‘), aber zumindest die Parteiführung lanciert diesen politischen Kurs. Und in Hinblick auf das immer noch angestrebte R2G-Projekt macht das auch Sinn.

Resümee

Offensichtlich hat der ‚Bodo-Faktor‘ die Koordinaten (scheinbar) nach ‚links‘ verschoben, während die AfD NOCH die Schmuddelkinder sind. Sollten die Wahlergebnisse für die AfD aber so bleiben, wie sie sind, wird sich das nicht lange halten (‚Koalitionsfrage‘). Das Gedränge in der ‚Mitte‘ wird dann unübersehbar … und die politischen Inhalte so beliebig, dass von dem Kampf um Interessen (worum es eigentlich in der Politik geht) nur noch eine technokratische Machbarkeit übrigbleibt. Und selbst bei einer gesteigerten Politisierung der Öffentlichkeit bleibt der wahre Sieger bei Wahlen in systemischer Hinsicht das TINA-Prinzip (es gibt keine Alternativen). Dieses stand aber weder in Thüringen noch sonst wann je relevant zur Debatte.
Dass aber der Schoß des Faschismus aus der ‚Mitte‘ selbst mitverursacht fruchtbar wird und bleibt, – diese Erkenntnis bleibt gerne verdrängt.

„Wer aber vom Kapitalismus nicht reden will, sollte auch vom Faschismus schweigen.“ (Max Horkheimer)

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

———————————————————————

Grafikquelle      :           Scharf-Links     –    Bildmontage: HF

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen | Keine Kommentare »

Stadtgespräch aus Dessau

Erstellt von DL-Redaktion am 30. Oktober 2019

Brüche und Entzündungen

https://upload.wikimedia.org/wikipedia/commons/e/e1/Oury_Jalloh.jpg

Von Christian Jakob

Neue Erkenntnisse im Fall Oury Jalloh. Ein forensisches Gutachten belegt: Der 2005 in einer Dessauer Polizeizelle verbrannte Oury Jalloh wurde vor seinem Tod misshandelt.

Der 2005 in einer Dessauer Polizeizelle verbrannte Oury Jalloh wurde vor seinem Tod schwer misshandelt. Dabei wurden ihm unter anderem Schädeldach, Nasenbein, Nasenscheidewand und eine Rippe gebrochen. Das ergibt ein neues forensisches Gutachten des Rechtsmediziners und Radiologie-Professors Boris Bodelle von der Universitätsklinik Frankfurt, das die taz einsehen konnte. Das Gutachten hatte die Initiative Gedenken an Oury Jalloh (IGOJ) in Auftrag gegeben.

Jalloh war zur Mittagszeit des 7. Januar 2005 in einer Gewahrsamszelle verbrannt. Am Morgen, gegen 9.30 Uhr, war er zuvor von dem Dessauer Polizeiarzt Andreas Blodau untersucht worden. Der hatte keine Verletzungen bei Jalloh dokumentiert. Entsprechend müssen die Verletzungen, die jetzt das forensische Gutachten attestiert, zwischen der Untersuchung durch Blodau und dem Ausbruch des Feuers um 12.30 Uhr entstanden sein – so sieht es die IGOJ in ihrer Erklärung.

Laut dem Frankfurter Gutachten zeigen Entzündungen, dass Jalloh zum Zeitpunkt der Verletzungen noch gelebt haben muss, die Brüche ihm also nicht etwa während der Löscharbeiten oder beim Transport in die Leichenhalle zugefügt sein können. Es sei davon auszugehen, dass die Veränderungen „vor dem Todeseintritt entstanden sind“, heißt es im Gutachten.

Bislang war lediglich ein Bruch im Bereich des Nasenbeins Jallohs verbrieft gewesen – auch dies nur durch ein privat von der IGOJ finanziertes Gutachten. Das hatte der inzwischen emeritierte Rechtsmedizin-Professor Hansjürgen Bratzke aus Frankfurt 2005 verfasst. Doch Bratzke hatte offengelassen, ob der Bruch des Nasenbeins vor dem Tod entstanden ist – und die anderen Verletzungen gar nicht thematisiert. Auch der inzwischen ebenfalls emeritierte Rechtsmedizin-Professor Manfred Kleiber aus Halle war mit dem Fall befasst, hatte die jetzt bekannt gewordenen Verletzungen aber nicht benannt. So waren sie während der mehrjährigen Gerichtsverfahren gegen Polizeibeamte des Reviers nie offiziell festgestellt worden.

Vieles spricht nun für das Motiv Vertuschung

Die neuen Untersuchungsergebnisse sind deshalb von besonderer Bedeutung, weil sie eine mögliche Antwort auf die Frage geben, warum Jalloh in seiner Zelle mit Brandbeschleuniger angezündet worden sein könnte. Diesen Tathergang hatte die anhaltische Justiz lange Zeit zurückgewiesen. Stattdessen wurde offiziell behauptet, dass Jalloh die Matratze am Boden der Gewahrsamszelle, auf den er mit Händen und Füßen gefesselt war, selbst angezündet hatte.

Die IGOJ hatte schon sehr früh Belege dafür gesammelt, dass dies nicht der Fall gewesen sein kann. Viele weitere Indizien für eine Tötung waren im Laufe zweier Prozesse zutage getreten. Im April 2017 schloss sich schließlich der Dessauer Staatsanwalt Folker Bittmann dieser Auffassung an.

Quelle          :           TAZ          >>>>>         weiterlesen  

Weitere Berichte über diesen brisanten Behördenfall :

Eine vernichtende Aussage über die Unfähigkeit des Staates

05. 01. 2018 Der abgewiesene Zeuge

13. 11. 2012   Der Fall Oury Jalloh

10. 01. 2012   Die Fratze des Staates

09. 01.2011    Schweigen von Beamten

09. 12. 2008   Polizei Rassismus in Dessau

9. 12. 2008  Skandal-Urteil in Dessau

—————————————————————————————————————————-

Grafikquellen       :

Oben          —        

attribution share alike This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
Source Own work
Transferred from de.wikipedia to Commons by Sebastian Wallroth using CommonsHelper.(Original text: Eigene Aufnahme)
Author Marek Peters http://www.marek-peters.com/

———————————-

Unten       —             http://www.umbruch-bildar…

Lizenz des Artikels und aller eingebetteten Medien:
Creative Commons by-sa: Weitergabe unter gleichen Bedingungen

Abgelegt unter Innere Sicherheit, Positionen, Regierungs - Werte, Sachsen-Anhalt | Keine Kommentare »

Wahlausgang in Thüringen

Erstellt von DL-Redaktion am 30. Oktober 2019

Erfolgreiche Umgruppierung sozialdemokratischer Wähler*innen

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–103.jpg

Zum Ausgang der Landtagswahlen in Thüringen 2019

Quelle      :     AKL

von Thies Gleiss

Es gibt auf der LINKE-Führungsebene vor Schließung der Wahllokale immer ein besonders bescheuertes Schmankerl: Das Karl-Liebknecht-Haus (wer genau, ist nicht bekannt) verbreitet an die Spitzenfunktionäre der LINKEN sogenannte „Sprachregelungen“, wie die jeweils möglichen Wahlergebnisse kommentiert werden sollen. Das beginnt dann immer mit Danksagungen an Wähler*innen und Wahlkämpfer*innen und endet mit verschiedenen Varianten, den Ausgang der Wahlen speziell für die LINKE positiv darzustellen. Bisher tat mensch gut daran, dieses Ritual mit kopfschüttelndem Schweigen zu begleiten. Aber heute es erforderlich, sich ausdrücklich und lautstark gegen eine dieser vorgeschlagenen Sprachregelungen zur Wehr zu setzen.
Ginge es nach diesen Vorgaben soll nämlich nicht „von uns aus auf das Ergebnis der AfD eingegangen“ werden.

Dazu ein dickes und unmissverständliches Nein!

Das Ergebnis für die AfD ist das traurige Spitzenereignis an diesem Wahlabend. Es ist keine Protestwahl von „besorgten“ Bürger*innen, sondern ein brandgefährlicher Zuspruch für eine prä-faschistische Partei mit Massenanhang. Mit jeder Faser ihrer politischen Praxis muss sich die LINKE diesem braunen Spuk entgegenstellen.

Wir wollen uns dennoch mit der LINKEN und mit Bodo Ramelow über das tolle Wahlergebnis freuen und Danke an alle Wähler*innen und Unterstützer*innen sagen.

Politisch sind die Ergebnisse dieses Wahlabends relativ eindeutig zu bewerten:

– Die Parteien der kleinen Koalition in Berlin haben ein weiteres Mal ihre verdiente Klatsche erhalten. Ihr Ergebnis ist das Ergebnis ihrer Politik. 30 Jahre nach der Verkündung der „blühenden Landschaften in Ostdeutschland“ durch die damalige Kohl-Regierung komplettierte die Thüringen-Wahl auch einen immer noch vorhandenen speziellen Ost-Protest gegen die Berliner Regierungsparteien, nach den Wahlen in Brandenburg und Sachsen.

– Die LINKE in Thüringen hat einen extrem personenbezogenen Regierungs-Erhaltungs-Wahlkampf geführt, der sich um linke Programmatik noch nicht einmal dann groß geschert hat, wenn direkt nachgefragt wurde – am Abend in den Wahlstudios konnte das noch anzuhören und anzuschauen sein.
Dieser Wahlkampf war höchstens sozialdemokratisch und Bodo Ramelow und sein „Teambodo“ waren darin unbestritten sehr erfolgreich. Dazu kann mensch gratulieren, aber mehr als eine Umgruppierung unter den sozialdemokratischen Wähler*innen ist nicht herausgekommen. Die unsinnige Wahlkampfrede von Bodo Ramelow „Ihr könnt mich mit der Stimme gleich für drei Parteien wählen“, wurde von den Wähler*innen dann doch mit etwas mehr Vernunft und der Stimme nur für die LINKE beantwortet.
Der Erfolg der LINKEN ist dennoch sehr erfreulich, weil er neue Optionen eröffnet, jetzt mit wirklich linker Politik zu beginnen – sei es in einer Minderheitsregierung oder als harte Opposition. Dazu bedarf es allerdings einer deutlich anderen Aufstellung der LINKEN und eine schärfere Profilierung der Partei gegenüber der Regierung.

– Auch diese Wahl (gefühlt die hundertste) hat gezeigt, es gibt kein „Rot-Rot-Grünes-Lager“, in dem drei Parteien unterschiedliche politische Bereiche abdecken und als politische Einheitsfront eine moderne Klassenpolitik im linken Sinne durchführen. Es kommt höchstens zu Umverteilungen zwischen diesen drei ansonsten getrennten Parteien. Gewinne gibt es nicht gemeinsam, sondern gegeneinander.

– Auch im bürgerlichen Lager gibt es mehr verfestigte (und sich gegenseitig radikalisierende) Umverteilungen, bei denen die AfD aktuell auf der Erfolgsschiene ist und der CDU sehr bald eine Debatte ins Haus schickt, doch mit der AfD koalieren zu wollen.

– Die SPD sollte langsam daran denken, die letzte Zigarette zu rauchen und sich abzumelden. Viel Glück den neuen Vorsitzenden, denen dieser Schrotthaufen überlassen wird. Parallel zu den Wahlen in Thüringen wurde der alte Hartz-IV-Stratege und Schwarze-Null-Kassierer Olaf Scholz als männlicher Part im neuen Vorsitzendenduo mit dem besten Vorwahl-Ergebnis belohnt. Die Berliner SPD, Koalitionspartnerin der LINKEN, hat beschlossen, das Volksbegehren zur Enteigung der Immobilienkonzerne nicht zu unterstützen. Was soll dazu noch gesagt werden?

– Die öffentliche Meinung ist am Wahlabend erwartungsgemäß ganz aus dem Häuschen. Sie übertreibt in einer Art Flucht nach vorn die durchaus richtige Beobachtung, dass Bodo Ramelow ja gar kein richtiger LINKER ist und nur deshalb die Wahl gewonnen hätte. Das Interesse daran ist überdeutlich: Die LINKE soll weiter domestiziert, ein Keil zwischen ihren Prominenten und der Gesamtpartei getrieben und die Regierung einer Allparteien-Koalition möglich gemacht werden.

Ich warne eindringlich davor, über irgendwelche Koalitionen mit der CDU auch nur nachzudenken. Zum Kampf gegen Rechts und für die Zukunft der LINKEN generell ist eine starke, eigenständige Partei DIE LINKE das einzig angemessene Mittel. Daran sollte gearbeitet werden.

Für eine Minderheitsregierung der LINKEN

– Es spricht viel dafür, dass die 31-Prozent-Partei DIE LINKE jetzt eine Minderheitsregierung anstrebt. Es sollte aber eine LINKE-Regierung sein. Die Bündnispartner*innen von SPD und GRÜNE sind eindeutig abgewählt worden und sollten nicht künstlich aufgepäppelt werden. Das Mandat zum Regieren geht an LINKE, an niemanden sonst.

Es sollte auch kein formalisiertes Duldungsverfahren (mit Vertrag, schriftlichen Zusagen etc.) angestrebt werden (wie es die PDS vor Jahren in Sachsen-Anhalt als Duldungsjuniorpartnerin für die SPD gemacht hat), sondern eine Politik im Sinne des Programms der LINKEN begonnen werden.

Eine Minderheitsregierung hat den schönen Vorteil, dass erstens das parlamentarische Geschehen sehr aufgewertet wird, weil reale Entscheidungen im Parlament (und nicht nur in der Regierung und den Verwaltungen) fallen, und besonders zweitens die Inhalte der Regierungspartei im Vordergrund stehen. Das tun sie aber nur, wenn das wichtigste Kriterium für eine Minderheitsregierung beachtet wird: Man muss wissen, wann Schluss ist. Im Gegensatz zu einer Regierungsbeteiligung in Form einer Koalition, bei der sehr schnell die Verteidigung der Regierung(sfähigkeit) das einzige Ziel wird, bleiben es bei einer Minderheitsregierung die Inhalte. Wenn keine Mehrheiten für politische Projekte gefunden werden, oder diese Projekte nicht mehr ausreichen, eine fortschrittliche Entwicklung für die Menschen zu erreichen, dann muss es halt Neuwahlen geben – zu denen die LINKE dann aber sehr gelassen und selbstbewusst antreten könnte.

Köln, 29. Oktober 2019, Thies Gleiss

akl - Antikapitalistische Linke

———————————————————————-

Grafikquelle        :           Bundesparteitag Die Linke 2018 in Leipzig

Abgelegt unter Berlin, Kultur, L. Thüringen, P. DIE LINKE | Keine Kommentare »

Späte Nach – Geburt

Erstellt von DL-Redaktion am 29. Oktober 2019

Wasser hier, Stroh-Rum da

Kristina Schröder 2013-01-16.jpg

Von Jürn Kruse

Kristina Schröder, Bundesministerin a. D., hat sich in ihrer letzten Welt-Kolumne den Fridays for Future und dem Thema Verzicht gewidmet: „Fundamentaler Fehler von #FridaysForFuture ist Glaube, wir könnten ökologische Probleme durch #Verzicht lösen. Der Mensch wird aber nicht bereit sein, auf individuelle Mobilität oder aufs Fliegen zu verzichten. Nur technologische Lösungen funktionieren“, pries sie ihren Text bei Twitter an. Zur Sicherheit: Sic! Klar, Fridays for Future doof zu finden, ist ein Distinktionsmerkmal, um im Kolumnist*innen-Abklingbecken mitschwimmen zu dürfen. Aber mir gehen diese Narrative, die Schröder und andere permanent verbreiten, zunehmend auf den Keks:

1.) Tut doch alle nicht so, als sei Verzicht zugunsten der Umwelt durch Fridays for Future in die Welt gekommen. Müll zu vermeiden, Wasser zu sparen, lieber Rad zu fahren – das stand in meiner Kindheit schon in jedem Yps-Heft und in jeder Micky Maus. Nur fanden die Erwachsenen zwar Öko-Kinder irgendwie niedlich, haben ihnen dann aber doch einen Lebensstil vorgelebt, der den Kleinen diesen Umweltscheiß schnell wieder austrieb. Also erst Wasser gepredigt, dann Stroh-Rum gesoffen.

Greta Thunberg 4.jpg

2.) Und heute wird dann den Kindern vorgeworfen, dass sie ja genauso seien wie die Erwachsenen. Natürlich darf bei Schröder an dieser Stelle der Hinweis auf die „bizarre Tour von Greta über den Atlantik zum UN-Klimagipfel“ nicht fehlen, inklusive der Rückreise der Skipper. Im Flugzeug! Das erinnert mich an die Lehrerin, die irgendwelche plastikvermeidenden Sechstklässler fragte, ob sie auch aufs Smartphone verzichten würden. Da waren die baff, erzählte die Lehrerin stolz. Glückwunsch, du hast Elfjährige aufs Kreuz gelegt. Dabei waren es nicht die Kinder, die diese iPhone-Easyjet-Welt erfunden haben. Wir haben sie dort hineingeboren – und jetzt, da sie dieses Leben infrage stellen, halten Erwachsene den Jugendlichen vor, dass sie auch nicht viel besser seien. Wieder: Wasser hier, Stroh-Rum da.

Quelle           :            TAZ             >>>>>           weiterlesen

———————————————————————

Grafikquellen            :

Oben         —        Kristina Schröder, Bundesministerin für Familie, Senioren, Frauen und Jugend, aufgenommen am 16.01.2013.

————————

Unten            —           In August 2018, outside the Swedish parliament building, Greta Thunberg started a school strike for the climate. Her sign reads, “Skolstrejk för klimatet,” meaning, “school strike for climate”.

Abgelegt unter Hessen, International, P.CDU / CSU, Umwelt | Keine Kommentare »

Der Cum-Ex-Prozess

Erstellt von DL-Redaktion am 29. Oktober 2019

Der Kronzeuge packt aus

File:Hn-mattheuer-mann-mit-maske-1983.jpg

Von , und

Dieser Mann weiß fast alles über den größten Steuerraub der deutschen Geschichte. Denn er gehörte zum inneren Zirkel der Täter. Nun sagt er im Bonner Cum-Ex-Prozess aus.

Im Frühjahr 2016 kommt es in einem Besprechungsraum des Flughafens Zürich zu einer Begegnung, die für die strafrechtliche Aufarbeitung des größten Steuerraubs in der deutschen Geschichte wegweisend ist. Dort treffen sich Männer, die die Geschäfte zulasten der deutschen Staatskasse perfektioniert haben. Gemeinsam haben sie über Jahre hinweg Cum-Ex-Deals eingefädelt. Doch jetzt will einer von ihnen auspacken. Er will zum Kronzeugen der Staatsanwaltschaft werden und alles über die unlauteren Geschäfte erzählen, die sie gemacht haben.

Aufgebracht reden die anderen Männer auf ihn ein. Für sie ist die Staatsanwaltschaft der Feind. Es sei verrückt, mit ihr zu kooperieren. Die Phalanx müsse stehen. Rund anderthalb Stunden geht das so. Dann unterbricht der Anwalt des Aussteigers die aufgeregte Debatte: „Wissen Sie, wir haben das alles gehört. Aber wir machen alles genau anders.“ Der Bruch ist vollzogen. Bald darauf empfängt die Oberstaatsanwältin und Cum-Ex-Anklägerin Anne Brorhilker ihren wichtigsten Belastungszeugen zum ersten Mal in einem unscheinbaren Vernehmungsraum im Landeskriminalamt Düsseldorf.

Der Mann, der von dieser Szene berichtet, soll an diesem Dienstag im ersten Cum-Ex-Strafprozess vor dem Landgericht Bonn als Zeuge aussagen. Dreieinhalb Jahre nach dem Treffen in Zürich dürfte er Dutzende Personen und Banken schwer belasten, sofern er seine Aussagen vor der Staatsanwaltschaft im Gericht wiederholt. Unter anderem äußerte er sich zu den Hamburger Privatbanken M.M.Warburg und Varengold, zur Schweizer Privatbank Sarasin, zur australischen Investmentbank Macquarie und zu verschiedenen Depotbanken. Außerdem zur Kapitalverwaltungsgesellschaft Ballance, die in dem Prozess eine wichtige Rolle spielt.

Vor einem Jahr hat der Zeuge seine Rolle im Cum-Ex-Skandal in einem Gespräch ausführlich beschrieben, das er mit einem Reporterteam vom ARD-Magazin Panorama, der ZEIT, ZEIT ONLINE und Correctiv unter dem Namen Benjamin Frey geführt hat. Er sagte damals: „Das ist organisierte Kriminalität in Nadelstreifen.“ Seine Geschäftspartner und er hätten sich gefühlt, als hätten sie Fort Knox geknackt. „Warum? Weil der Staat die Quelle des Geldes war und diese Quelle, die konnte nicht versiegen.“

Von den Männern, die bei jenem denkwürdigen Treffen in Zürich dabei waren, muss sich im Bonner Prozess allerdings keiner verantworten. Angeklagt sind dort zwei britische Aktienhändler. Sie sollen zwischen 2006 und 2011 insgesamt 447,5 Millionen Euro aus der deutschen Steuerkasse geraubt haben. Aber sie haben, so sagt es der Zeuge, eng mit seinen Geschäftspartnern zusammengearbeitet, unter anderem über ihre Firma Ballance.

Außerdem hat das Landgericht fünf Banken an dem Prozess beteiligt, darunter die Hamburger Warburg-Gruppe, die der Zeuge vor der Staatsanwaltschaft belastet hat. Das Gericht nutzt damit den neu gefassten Paragraf 73 des Strafgesetzbuchs. Wenn Finanzinstitute eine Tat nicht unmittelbar begangen, sich aber mutmaßlich daran beteiligt und daraus Profite erzielt haben, könnten demnach nach einer Verurteilung der Täter Vermögen der Institute eingezogen werden, um den angerichteten Schaden auszugleichen.

Das Bonner Verfahren ist ein Musterprozess. Noch nie ist jemand strafrechtlich dafür belangt worden, dass er sich an Cum-Ex-Deals beteiligt hat. Sollten die beiden Aktienhändler verurteilt werden, wäre eine Grundlage dafür geschaffen, viele weitere Beschuldigte vor Gericht zu bringen. Staatsanwaltschaften in Frankfurt und München ermitteln ebenso wie die Staatsanwaltschaft Köln, die die beiden Aktienhändler vor Gericht gebracht hat.

Quelle          :           Zeit-online            >>>>>          weiterlesen

———————————————————————

Grafikquellen          :

Oben          —        Mann mit Maske von Wolfgang Mattheuer (1983), Skulptur am Gesundbrunnen, Heilbronn

Author p.schmelzle

I, the copyright holder of this work, release this work into the public domain. This applies worldwide. In some countries this may not be legally possible; if so:

I grant anyone the right to use this work for any purpose, without any conditions, unless such conditions are required by law.

————————–

Unten          —           Hauptsitz der M.M. Warburg & CO in der Ferdinandstraße 75 in Hamburg

Abgelegt unter Finanzpolitik, Justiz-Kommentare, Kultur, Nordrhein-Westfalen | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 29. Oktober 2019

Je weniger Zweifel, desto schlechter

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ariane Lemme

Beim Streit um den Mietendeckel gehts um das bessere System. Das wäre ok, gingen dabei nicht alle Zweifel am eigenen Richtigsein flöten.

Die Städte sind kaputt. Das hab ich oft gedacht, als in dieser Woche die Fetzen flogen wegen des Mietendeckels. Digitale Fetzen natürlich, denn wo begegnen Menschen sich schon noch, um zu streiten, außer auf Twitter? Keine Sorge, ich will hier nichts gegen das Internet sagen, ich bin bekennender Fan seit 1999, oder wann immer das war, als ich rausfand, dass man da prima von den Eltern unbelauscht mit der Welt draußen kommunizieren konnte. Man kann im Netz natürlich auch viel Vertrautes lesen, Filterbubbles sei Dank. Das kann angenehm sein, aber auch bizarr langweilig werden, wenn die Blasen zu feinporigem Schaum werden: je dichter, desto schlechter die Sicht.

In den Städten ist es ähnlich, je mehr Menschen hinziehen, desto feiner sortieren sich die Grüppchen der Gleichen. Dabei ist das Dach überm Kopf so ziemlich das letzte Haptische, was der Mensch noch braucht. Der meiste andere Kram, inklusive menschlicher Wärme, fände sich theoretisch digital. Warum also der ganze Fuzz um bezahlbaren Wohnraum in den Innenstädten? Ist es nicht eigentlich wurscht, wenn ein paar Superreiche da unter sich wohnen und der Rest von uns aus ihren Butzen in Britz und Blankenfelde am – ohnehin digitalen – öffentlichen Leben teilnimmt?

Es ist nicht wurscht, klar. Wohnraum ist halt mehr als das Dach über Kopf, es ist auch das, was um die eigene Butze so drumherum ist. Die Stadt ist da schon immer noch das Ideal. Weil sie Aufregung, Abenteuer und Amüsement verheißt und ab und an auch liefert. Warum strömen die Menschen denn in Scharen in die Metropolen, wenn nicht, um den immer selben Nasen in ihrem oberhessischen oder ostanatolischen oder nordkatalanischen Dorf zu entfliehen und mal was anderes zu sehen, zu hören, zu riechen? Ja, ja, der billigen Mieten wegen – die es schon lange in keiner Metropole mehr gibt. Der Jobs wegen – als ob sich die meisten unserer Bullshit-Jobs im 21. Jahrhundert nicht prima von einer Strandhütte in Bali aus erledigen lassen würden. Auch diese Kolumne braucht kein Büro.

Datei:Kudamm Karree View from LietzenburgerStr.jpg

In Wahrheit ist es die Lust am Unterschied, denke ich. Städte sind Orte, wo Menschen ihn feiern. Theoretisch. Allzu viel davon will dann doch kaum einer, scheint es mir. Während die einen unter sich bleiben, weil sie die Einzigen sind, die sich bestimmte Gegenden leisten können, bleiben die anderen zumindest ideell gern unter sich. Wenn man sich schon so viel Mühe macht, das richtige, das gute Leben zu leben, soll bitte keiner mit einem anderen Konzept vom guten Leben stören. (Bevor es jetzt wieder zu Missverständnissen kommt: Mit Unterschiede feiern meine ich nicht, mit Rechten zu reden oder Menschenverachtung gleichmütig hinzunehmen.) Aber was gerade um den Mietendeckel wütet, ist ein kalter Krieg im urbanen Biotop. Entweder du bist für Eigentum oder für Enteignung. Individualismus gegen Kollektivierung, Kapitalismus gegen Kommunismus. Drunter wird gerade nicht geschossen.

Quelle      :         TAZ            >>>>>         weiterlesen

——————————————————————

Grafikquellen         :

Oben    —    Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Urheber A.Savin (Wikimedia Commons · WikiPhotoSpace)

Copyleft: Dieses Kunstwerk ist frei, es darf weitergegeben und/oder modifiziert werden entsprechend den Bedingungen der Lizenz „Freie Kunst“.

Der vollständige Text der Lizenz steht auf der „Copyleft Attitude“-Seite sowie auf anderen Webseiten.

Diese Datei ist unter den Creative-Commons-Lizenzen „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“, „2.5 generisch“, „2.0 generisch“ und „1.0 generisch“ lizenziert.

Abgelegt unter Berlin, Friedenspolitik, Mensch, Sozialpolitik | Keine Kommentare »

R-R-G ohne Mehrheit

Erstellt von DL-Redaktion am 28. Oktober 2019

Warum die Linkspartei eine Minderheitsregierung anstrebt

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Koalition oder Tolerierung? Irgendwie muss die Linkspartei in Thüringen mit der CDU zusammenarbeiten. Strategen sehen Vorteile für die Minderheitsregierung.

Über Minderheitsregierungen spricht Bodo Ramelow schon länger positiv. Auch wenn er im Wahlkampf stets für Rot-Rot-Grün kämpfte, das Thema war für ihn – anders als die in Deutschland vorherrschende Meinung – „kein Schreckgespenst“. Im Deutschlandfunk-Interview sagte Ramelow im September, in nordischen Ländern sei eine solche Konstellation „ganz normal“.

Es sei zwar „anstrengend, mit wechselnden Mehrheiten zu regieren“, erklärte der Linken-Politiker einige Wochen zuvor dem Redaktionsnetzwerk Deutschland. Aber der damit verbundene „sanfte Zwang zum Kompromiss“ könne auch bereichernd wirken. „Ein Blick über die Landesgrenzen, etwa nach Dänemark, ist da hilfreich.“

Die Volksparteien verlören an Anziehung, der Abstand zwischen den Parteien werde geringer. „Die Minderheitsregierung wird auch bei uns früher oder später kommen, da ist es allemal besser, sich schon jetzt auf neue Regierungsformate einzustellen und für eine höhere gesellschaftliche Akzeptanz zu werben.“

Nun wird es womöglich ernst. Es scheint, als ob Thüringen nach der ersten linksgeführten Landesregierung nun ein weiteres demokratisches Experiment erleben könnte.

Die Mehrheit für Ramelows Linksbündnis aus Linken, SPD und Grünen ist seit Sonntag dahin. Und die Diskussionen in der Linken wie auch bei SPD und Grünen haben begonnen. Auch wenn die Linken-Landesvorsitzende Susanne Hennig-Wellsow der Form halber auf die bevorstehenden Beratungen der Parteigremien am Montagabend verweist und sich zu dem Projekt zunächst nicht äußern will.

In der der Analyse der Linken-nahen Rosa-Luxemburg-Stiftung zum Wahlausgang in Thüringen aber wird eine klare Empfehlung ausgesprochen. Autor Horst Kahrs, früher Leiter der Strategieabteilung im Karl-Liebknecht-Haus, der Linken-Parteizentrale, schreibt: „Mit der Wahl in Thüringen wird endgültig klar, dass Kenia-Koalitionen keine ausreichende Antwort auf die Umbrüche im Parteiensystem sind und über neue Konstellationen nachgedacht werden muss.“

Nach schwieriger Regierungsbildung – den Regierungsauftrag sieht er klar bei Ramelow – stehe eine „Konstellation bevor, die es so oder so noch nicht gegeben hat“, heißt es in dem sogenannten „Wahlnachtbericht“, der traditionell auch Grundlage für die Diskussion in den Parteigremien ist.

Vorteile gegenüber dunkelrot-schwarzer Koalition

Die Präferenz des Soziologen Kahrs ist klar. Eine Minderheitsregierung hat aus seiner Sicht klare Vorteile gegenüber einem formalen dunkelrot-schwarzen Regierungsbündnis: „In der Auseinandersetzung mit der AfD wären Minderheitsregierungen gegenüber lagerübergreifenden Mehrheitsregierungen das probatere Mittel: Sie würden die Unterschiede zwischen den Parteien links von der AfD erkennbarer machen und die demokratische Streitkultur beleben können.“

2017-08-30 Georg Maier Vereidigung by Olaf Kosinsky-7.jpg

Nur mit den AfD-Stimmen könnte eine solche Regierung gestürzt werden. Das könnte das Experiment stabilisieren. Zentraler Prüfstein einer Regierung sei immer die Verabschiedung eines Haushaltes, „hier könnte sich dann der demokratische Konsens gegen die AfD manifestieren“.
———————————————————————
Grafikquellen         :

Oben     —        Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

Abgelegt unter L. Thüringen, Medien, P. DIE LINKE, Überregional | 1 Kommentar »

DIE * WOCHE

Erstellt von DL-Redaktion am 28. Oktober 2019

Wie geht es uns, Herr Küppersbusch?

https://upload.wikimedia.org/wikipedia/commons/1/1b/Die-Woche.png?uselang=de

Kolumne von Friedrich Küppersbusch

Thüringen, Dessau, Washington.  Jens Spahn hilft bei Grippe. Mike Mohring macht nicht die Ypsilanti, der Facebookchef wird gegrillt und die Borussenfans haben Spaß jenseits des Derbys.

taz: Herr Küppersbusch, was war schlecht vergangene Woche?

Friedrich Küppersbusch: Kabinettsmitglieder treten mit Anregungen für Kampfeinsätze hervor.

Und was wird besser in dieser?

Jemand weckt Merkel.

Thüringens CDU-Chef, Mike Mohring, erklärte noch vor der Wahl, Björn Höcke von der AfD sei ein Nazi, mit dem er nicht zusammenarbeiten würde. Wie steht’s mit der Mindesthaltbarkeitsdauer solcher Aussagen?

Von Höcke ist Läuterung nicht zu erwarten. Und Mohring sänke zum Ypsilanti der CDU, wenn er sein Nein zu Koalitionen mit Linken oder AfD nicht hielte. Damit will er die CDU als Partei der Mitte positionieren, was ausweislich der verzwergten SPD in Thüringen teils gelingt. Teils isses schade, weil uns das Experiment Linke-CDU entgeht. Einen demokratischeren Sozialisten als Ramelow wird auch die CDU so schnell nicht finden.

Die Ermittlungen um den Tod von Oury Jalloh 2005 in einer Dessauer Polizeizelle sind wohl endgültig eingestellt. Soll man die Toten also ruhen lassen?

„Wenn neue Beweise auftauchen“ könne das Verfahren jederzeit wieder aufgenommen werden – wobei es sich bisher dadurch auszeichnet, dass alte Beweise abtauchen. Akten verschwanden, aussagebereite Polizisten wurden nicht vernommen. Zwei weitere Todesfälle im selben Polizeirevier, einer in derselben Zelle, wurden amtlich schubladenbestattet. Der Satz „nach behördlicher Auffassung verbrannte sich Jalloh ohne weitere Hilfsmittel auf der Matratze, an die er gefesselt war“ im Radio klingt wie eine Live-Schalte in ein Orwell-Universum. Das Oberlandesgericht Naumburg hat die Chance vertan, den Rückhalt für den Rechtsstaat zu stärken.

Alexandria Ocasio-Cortez bringt Facebook-Chef Mark Zuckerberg bei einer Kongressanhörung mächtig ins Schwitzen. Wird die Demokratin die Übernahme der Weltherrschaft durch den Plattformkapitalismus aufhalten?

„AOC“ wird erst mal alle Präsidentschaftsbewerber der Demokraten alt aussehen lassen – nachdem sie Zuckerberg gekonnt durch die 5-Minuten-Terrine zog. Sie selbst tritt nicht gegen Trump an, weil „ich das große Geld nicht mit mehr Geld herausfordern kann“. In den 360 Sekunden, die der US-Kongress ihr ließ, entrang sie Zuckerberg Statements wie „Ich weiß nicht, wann Cambridge Analytica Face­book-Daten zu missbrauchen begann“.

Auch wisse er nicht, ob Wahlkämpfer Fake News und Nutzer Lügen posten könnten. Voriges Jahr onkelte Zuckerberg 70 Minuten durchs Europaparlament, davon gingen für Selfies, gelahrte Co-Referate, Goethe-Zitate und Pathos gefühlte 71 Minuten drauf. Hinweis: Die politischen Gremien weltweit sind kleiner als die Unternehmen, die sie zu kontrollieren trachten. Vielen Amerikanern mag AOCs Furiosum ein Grillspaß zwischendurch gewesen sein; Wirkmacht entfaltete so etwas vor den Vereinten Nationen.

Die frühere „Seawatch“-Kapitänin Carola Rackete stellt in der kommenden Woche ihr Buch „Handeln statt hoffen: Aufruf an die letzte Generation“ vor. Ist das apokalyptisch oder apokryph?

Quelle            :         TAZ         >>>>>            weiterlesen

—————————————————————–

Grafikquelle       :        Bearbeitung durch User:Denis_Apel – Lizenz “Creative Commons“ „Namensnennung – Weitergabe unter gleichen Bedingungen“

Urheber Unbekanntwikidata:Q4233718

Abgelegt unter Feuilleton, International, L. Thüringen, Medien | Keine Kommentare »

Thueringen ist angerichtet

Erstellt von DL-Redaktion am 26. Oktober 2019

Landtagswahlen in Thueringen

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Von Anne Fromm

Am Sonntag wird in Thüringen gewählt. Unsere Autorin stammt aus Erfurt. Sie liebt die Klöße ihrer Oma, die hübschen Städte, den Wald. Und fragt sich, warum sowohl Bodo Ramelow als auch Björn Höcke hier so erfolgreich sind.

enn meine Oma ihre berühmten Klöße macht, sagt sie immer dazu: „Wir in Thüringen sagen, der Kloß muss schwimmen.“ Sie meint damit, dass man zum Kloß viel Soße braucht. Meine Oma hat das schon Hamburgern erklärt, Hessen, Franzosen und Koreanern. Sie ist eine sehr gute Köchin und eine stolze Thüringerin. Fragt man sie, was so besonders ist an Thüringen, spult sie ab: Goethe, Schiller, Luther, Bauhaus. Und ihre Klöße.

Ich liebe die Klöße meiner Oma. Aber ich glaube, wir Thüringer reden zu gern über Klöße und zu wenig über die braune Soße.

Wenn am Sonntag in Thüringen gewählt wird, dürften die Ergebnisse auf den ersten Blick ähnlich ausfallen wie in Sachsen und in Brandenburg. Stark, wahrscheinlich am stärksten wird die Partei des regierenden Ministerpräsidenten. Stark, vermutlich am zweit- oder drittstärksten wird die AfD.

Auf den zweiten Blick aber ist in Thüringen einiges anders.

Die Partei des Ministerpräsidenten ist die Linke, die in den anderen beiden Ländern abstürzte. In Thüringen werden ihr um die 30 Prozent vorausgesagt. Sie könnte erstmalig stärkste Kraft bei einer Landtagswahl werden. Bei der letzten Wahl waren die Thüringer Avantgarde: Sie wählten die erste rot-rot-grüne Landesregierung.

Nun könnte genau das zum Problem werden. Denn was in Sachsen und Brandenburg gerade so zu gelingen scheint, eine Regierung ohne, oder besser: gegen die AfD zu bilden, könnte in Thüringen schwierig werden. Wenn es für Rot-Rot-Grün nicht reicht, reicht es womöglich für keine Koalition. Denn die CDU will nicht mit der Linken koalieren.

Die Wochen nach der Wahl könnten also ziemlich ungemütlich werden. Dabei sind die Thüringer, ich auch, eher harmoniebedürftige Leute. Das Brandenburgisch-Schroffe oder das Sächsisch-Plauderhafte gehören nicht nach Thüringen. Kritik, Widerspruch lässt man lieber.

Man wähnt sich selbst gern in der Mitte – der Gesellschaft und des Landes. „Das grüne Herz Deutschlands“ nennt sich Thüringen, wobei es für ein Herz, das das Land am Leben halten soll, ziemlich klein ist: 2,1 Millionen Einwohner, drittkleinster Flächenstaat.

Datei:Goldlauter-Blick.jpg

Was Brandenburg seine Alleen sind und Mecklenburg sein Ostseestrand ist, das ist Thüringen sein Wald. Im Thüringer Wald steht die Wartburg (Luther!). Die Orte hier heißen Finsterbergen, Schnepfental, Schwarzbach, Einsiedel, Oberwind. Sie können sich vorstellen, wie es dort aussieht. Ein Wald wie im Märchenbuch.

Die bedeutendsten Städte sind wie auf einer Perlenkette entlang der A4 aufgefädelt: Eisenach, Gotha, Erfurt, Weimar, Jena. Fachwerk, hübsch, ein Schlösschen hier, eine Burgruine da – Thüringen ist hier lieblich, fast kitschig. Wer im Sommer mit einem Eis unter der Krämerbrücke in Erfurt sitzt – der einzig bebauten Brücke nördlich der Alpen –, das Flüsschen Gera vorbeiplätschern und sich die Sonne ins Gesicht scheinen lässt, der fühlt sich wie in einer ZDF-Vorabendserie. Wer zu Ostern durch den Ilmpark in Weimar spaziert, jenen, der Goethe zu seinem „Vom Eise befreit sind Strom und Bäche“ inspirierte, der wird beim besten Willen nicht verstehen, warum so viele Thüringer so frustriert und voller Wut sind, dass sie die AfD wählen. Zwischen 20 und 24 Prozent werden ihr vorausgesagt. Nur ist die AfD in Thüringen nicht irgendeine. Es ist die von Björn Höcke.

Den Thüringern geht es gut, mate­riell gesehen. Die Wirtschaft wächst moderat, das Lohnniveau steigt, die Pro-Kopf-Verschuldung sinkt. Die Arbeitslosigkeit ist geringer als im Rest des Ostens.

Was die Thüringer aber eint mit ihren ostdeutschen Nachbarn: Viele fühlen sich abgehängt. Knapp 60 Prozent der Thüringer leben in Gemeinden mit weniger als 20.000 Einwohnern. Es sind die Orte, wo die Busse nicht mehr regelmäßig fahren, das Internet schwach ist, es keinen Bäcker und keinen Hausarzt mehr gibt.

Nur: Langsames Internet allein macht niemanden zum Rassisten.

Ich bin 1986 geboren, die 90er Jahre waren meine Kindheit. Es war eine schöne Kindheit, nur die braune Soße, die war eklig. Meine Sozialkundelehrerin erzählte einmal, nach der Wende, da saßen die netten Jungs von gestern in Springerstiefeln und Bomberjacke vor ihr. „Eine neue Mode“, habe sie gedacht, „das trägt man wohl jetzt so.“ Dass sich der gut versteckte Faschismus der DDR-Zeit nun umso heftiger entlud, erkannten damals die wenigsten. So konnten sich jene Jungs und Mädchen in Springerstiefeln ausbreiten. Sich in Jena eine Garage mieten, Sprengstoff basteln, ein Haus beziehen, das zum „Braunen Haus“ wurde und zum Nest von NSU und Thüringer Heimatschutz.

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -96.jpg

Jeder fünfte Thüringer, so die jährliche Umfrage des Thüringen-Monitors, ist rechtsextrem eingestellt. Nicht rechts, rechtsextrem. Im Landtagswahlkampf war das kaum Thema. Dabei gebe es viel zu besprechen: Angriffe auf Flüchtlingsheime, Polizisten, die lieber Nazis protegieren, als die Pressefreiheit hochzuhalten, Thüringen als beliebter Ort für Rechtsrockkonzerte und rechte Kampfsportturniere.

Quelle       :          TAZ         >>>>>           weiterlesen

——————————————————————–

Grafikquellen      :

Oben           —         Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

 

———————————-

2.) von Oben     —          Der Große Beerberg (983 m) und im Vordergrund Suhl-Goldlauter

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 Deutschland“ lizenziert.
Flag of Germany.svg
Namensnennung: Hejkal at de.wikipedia

——————————–
Unten            —        

Landtagswahl Thüringen am 14. September 2014

Abgelegt unter L. Thüringen, P. DIE LINKE, Regierung, Wirtschaftpolitik | Keine Kommentare »

Berliner Mietendeckel

Erstellt von DL-Redaktion am 25. Oktober 2019

Ersten Erfolg der Bewegung in Rückenwind für Enteignungskampagne verwandeln 

File:Potsdamer Platz, Berlin, April 2016.JPG

Quelle      :     AKL

Von     Lucy Redler, Berlin

Nach monatelangem Ringen und Druck der Mieter*innenbewegung und einer Gegenkampagne der Bauwirtschaft, der Genossenschaften, CDU, FDP, AfD und Teilen der SPD hat sich die rot-rot-grüne Regierung auf einen Entwurf zum Mietendeckel geeinigt. Der Beschluss des Senats geht nun ans Parlament und es bleibt abzuwarten, ob die SPD oder die rechte Opposition noch versuchen, einzelne Punkte zu verwässern.

Die drei wesentlichen Elemente des neuen Mietendeckels sind:

  • Mietenstopp: Die Mieten aller Mietwohnungen auf dem freien Markt, die vor 2014 gebaut wurden, werden rückwirkend zum 18. Juni 2019 für fünf Jahre eingefroren. Das betrifft 1,5 Millionen Haushalte.
  • Obergrenzen: Bei Wiedervermietung darf die Wohnung nicht teurer vermietet werden als gegenüber dem/der Vormieter*in (Ausnahme: Mieten unter fünf Euro netto kalt, diese können auf fünf Euro erhöht werden). Sind die bisherigen Mieten höher als die Obergrenzen-Tabellenwerte, die dem Gesetz beigefügt sind, gilt die Obergrenze, derzufolge die Kaltmieten 6,45 und 9,80 pro Quadratmeter je nach Baujahr und Ausstattung nicht überschreiten dürfen (ausgenommen sind Ausstattungsaufschläge.)
  • Mietsenkung: Bei bestehenden Mietverträgen gibt es es einen Anspruch auf Mietsenkung, wenn die Miete zwanzig Prozent über den Grenzwerten liegt (dabei gelten je nach Lage der Wohnung Auf- und Abschläge).

Der Senat rechnet mit 300.000 Anspruchsberechtigten. Wie viele von ihnen am Ende wirklich einen Antrag auf Absenkung stellen ist offen. Nicht wenige Mieter*innen dürften Angst haben, es sich mit ihrer/ihrem Vermieter*in zu verderben, denn die Regelungen gelten zunächst nur fünf Jahre und es ist offen, ob Teile des Gesetzes vom Gericht kassiert werden (weitere Fakten zum Entwurf).

Wie dicht ist der Deckel?

Eine wirkliche Bewertung der Tiefe des Eingriffs in das Eigentum der Immobilienkonzerne ist erst möglich, wenn klar ist, wie viele Menschen materiell von der Absenkung profitieren und wie geschickt die Konzerne Umgehungsstrategien finden. Nicht nachvollziehbar ist zudem, warum Mietsenkungen erst beim Überschreiten der Obergrenzen um zwanzig Prozent greifen und damit Bestandsmieten anders bewertet werden als Neuvertragsmieten. Zudem sind Modernisierungen von einem Euro pro Quadratmeter weiterhin möglich.

Unbestreitbar ist das Ergebnis aber ein wichtiger Erfolg der Mieter*innenbewegung, den es ohne die Proteste und den politischen Druck durch die Enteignungsdebatte nicht gegeben hätte. Diese hat auch dazu geführt, dass die SPD sich nicht mit ihrem Vorhaben durchsetzen konnte, Mietsenkungen zu verhindern. Wahr ist aber auch, dass das jetzige Gesetz deutlich hinter den ersten Entwurf zurück fällt.

Trotzdem wird die Einführung dieses Mietendeckels eine wichtige Signalwirkung auf Aktive bundesweit haben. Die Einführung sollte als Steilvorlage genutzt werden, für schärfere Gesetze zu Mietenstopp und Mietsenkungen in anderen Bundesländern und auf Bundesebene zu kämpfen. Auch in Berlin muss es zukünftig Auseinandersetzungen über eine Schärfung des Gesetzes geben.

Flag of Die Linke

Für die Berliner*innen ist das Gesetz nun vor allem eine Atempause, es löst die grundlegenden Probleme auf dem von privaten Konzernen dominierten Wohnungsmarkt jedoch nicht. Deshalb kommt es jetzt auch darauf an, die Kampagne für Enteignung der Immobilienkonzerne ohne Atempause weiter voranzutreiben und für massiven bezahlbaren Neubau durch die landeseigenen Wohnungsbaugesellschaften zu kämpfen.

Rückenwind

Ursprünglich hatte die SPD den Mietendeckel als Idee aufgebracht, um weitergehenden Forderungen der Initiative „Deutsche Wohnen & Co enteignen“ und der LINKEN nach Enteignungen von Immobilienkonzernen den Wind aus den Segeln zu nehmen. Im Gegenteil zu dieser Absicht spricht nun einiges dafür, dass die Initiative Rückenwind bekommen könnte. Denn der Mietendeckel hat gezeigt: Kämpfen lohnt sich.Erst deckeln, dann enteignen: Das muss jetzt die praktische Kampagne-Politik der LINKEN bestimmen und auch zur Kampagne der Gewerkschaften werden. DIE LINKE muss alles dafür tun, dass das juristische Verfahren zur ersten Stufe des Volksentscheids „Deutsche Wohnen & Co enteignen“ so schnell wie möglich abgeschlossen wird, um in die zweite Stufe der Unterschriftensammlung und der Kampagne einzutreten. Diese kann zum Rahmen werden, um die Organisierung von Mieter*innen qualitativ zu erhöhen und politisch ein Beispiel zu setzen, dass Enteignungen breiten Rückhalt in der Bevölkerung haben und zur Nachahmung in anderen Bereichen empfohlen werden. Denn es geht um nicht weniger, als die kapitalistischen Machtverhältnisse grundlegend zu ändern.

Dieser Artikel erschien unter www.sozialismus.info zuerst.

akl - Antikapitalistische Linke

————————————————————————

Grafikquellen       :

Oben      —      Potsdamer Platz, Berlin, April 2016

Author Another Believer       /       Source   :    Own Work
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

—————————-

Unten           —       Flag of Die Linke

Public Domain

Abgelegt unter Allgemein, APO, Berlin, Opposition, Überregional | Keine Kommentare »

Polizeigewalt in Köln

Erstellt von DL-Redaktion am 25. Oktober 2019

 Opfer-Täter-Umkehr wie aus dem Bilderbuch

File:Police brutality at Nigerian Embassy protest.jpg

Von Katja Thorwarth

Ein Mann erlebt Polizeigewalt, steht aber als Angeklagter vor Gericht. Obwohl er mehrfach freigesprochen wird, lässt die Staatsanwaltschaft nicht locker. Die Kolumne zum Thema.

Auf den Bildern, die der Mann 2016 auf Facebook postete, sieht man ihm die Misshandlungen an. Das Gesicht und der Kopf sind geschwollen, die Haut mit Blutergüssen übersät, die Arme und Beine malträtiert. Der Mann hatte sieben Stunden in Kölner Polizeigewahrsam verbracht.

An diesem Tag stand die Domstadt ganz im Zeichen des Regenbogens. Die CSD-Parade gegen Diskriminierung sexueller Minderheiten war in vollem Gange, als der Mann in eine Rangelei in einem Schnellrestaurant verwickelt wurde, die vor dem Eintreffen der Polizei bereits ein Ende fand. Den Ort hatte er sich noch geweigert zu verlassen, vielmehr soll er erschöpft auf einem Stuhl gesessen haben.

Opfer von Polizeigewalt: Wie das Protokoll eines Häftlings aus einem russischen Knast

Doch irgendetwas hatte die Beamten wohl getriggert, als der Mann mit einem Schlag ins Gesicht gegen die Wand geschleudert wurde. Er blieb reglos liegen, um mit einem „Schmerzreiz“ wieder in den Bewusstseinszustand überführt zu werden.

Damit sollte ein Martyrium seinen Anfang nehmen, das verschiedene Medien seit drei Jahren aufbereiten, und das sich liest wie das Protokoll eines Häftlings aus einem russischen Knast. Die Staatsdiener, dem Schutz des Individuums verpflichtet, legten ihm Handschellen an, traten und schlugen ihn, ehe sie ihn in ein Polizeiauto verfrachteten und in Unterhose und T-Shirt wegsperrten. Und mit klatschnasser Kleidung aus dem Hinterausgang entließen. „Das ist ein Bild, was voller Scham ist. Ja, voller Schmerz und Gewalt“, wird der Mann zitiert.

Polizeigewalt: Opfer-Täter-Umkehr wieaus dem Bilderbuch

Was hatte er sich zuschulden kommen lassen? „Das brauchst du doch, du dumme Schwuchtel“, soll die Aussage eines Polizisten laut Urteil des Landgerichts Köln gewesen sein, womit die Frage womöglich beantwortet ist. Denn wer sich das Geschehene vergegenwärtigt, könnte zu dem Schluss kommen, dass es sich hier um Homophobie in Uniform handelt, die in kollektivem Sadismus ihre Ausprägung fand. Und die als krimineller Akt zur Anklage gebracht gehört. Das ist bis heute nicht geschehen, im Gegenteil findet sich eine Opfer-Täter-Umkehr aus dem Bilderbuch.

20170707-IMG 9435.jpg

Bislang wurde der Fall zweimal vor Gericht verhandelt, und zweimal war das Opfer der Angeklagte. Die Beamten hatten wegen Widerstands gegen Vollstreckungsbeamte und Beleidigung Strafantrag gestellt, doch die Aussagen des Mannes wurden zweimal bestätigt, er zweimal vom Gericht freigesprochen – und jedes Mal, zuletzt 2019, ging die Staatsanwaltschaft in Berufung. Interessant an dieser Stelle ist, dass 2018 nur zwei Prozent mutmaßlich rechtswidrige Polizeigewalt von der Staatsanwaltschaft zur Anklage gebracht wurden. In diesem Fall scheint es jedoch so, als wolle die Staatsanwaltschaft das Opfer zum Täter umklagen.

Quelle          :       FR           >>>>>          weiterlesen

——————————————————————-

Grafikquellen          :

Oben          —              Police brutalize protester at rally against „embassy hearings“ in front of Nigerian Embassy, Berlin

Source http://asylstrikeberlin.files.wordpress.com/2012/10/polizeigewalt.jpg
Author Berlin Refugee Strike
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

————————–

Unten       —       Ein schwarzer Block der Staatsgewalt rückt aus      —G20 summit policetroops

Abgelegt unter Köln, Kriegspolitik, Kultur, Nordrhein-Westfalen | Keine Kommentare »

Karliczeks Batteriezentrum

Erstellt von DL-Redaktion am 25. Oktober 2019

Ein Forschungsinstitut für Münster

Recke CDU Politischer Aschermittwoch 2014 Anja Karliczek Markus Pieper Karl Josef Laumann 01.jpg

Hoch auf den gebräunten Podest

Von Manfred Ronzheimer

Es wurde eine Kommission gegründet, um den besten Standort für das Institut zu finden. Dann entschied das Forschungsministerium ganz anders. Den Zuschlag bekam die Heimatregion der Ministerin.

Bundesforschungsminis­te­rin Anja Karliczek musste an diesem Mittwoch zum zweiten Mal im Forschungsausschuss des Deutschen Bundestags antreten, um Auskunft in der sogenannten Batterieaffäre zu geben. Seit drei Monaten wird der Politikerin vorgehalten, dass ihr Bundesministerium für Bildung und Forschung (BMBF) in der Standortentscheidung über die Errichtung einer Forschungsfabrik für Batteriezellen die NRW-Stadt Münster bevorzugt hatte, unmittelbar neben dem Wahlkreis der CDU-Bundestagsabgeordneten Karliczek. Zuletzt standen sogar Rücktrittsforderungen im Raum, sogar von der CDU-Kultusministerin Susanne Eisenmann aus dem unterlegenen Baden-Württemberg, ein ungewöhnlicher Vorgang – „friendly fire“.

Die Batterieaffäre hat in den letzten Wochen die Kommunikationsfähigkeit des deutschen Forschungsministeriums – mit 18 Milliarden Euro immerhin der viertgrößte Einzelplan im Haushalt der Bundesregierung – bis an die Grenzen belastet. Hintergrundgespräche und Briefings in Folge, eine außerplanmäßige Anhörung des Ausschusses in der Sommerpause, durchgestochene Dokumente aus den Beratungen – auf den Ministeriumsneubau am Rande der Spree rollte offenbar ein Polit-Tsunami zu.

Oder doch nur ein Sturm im Wasserglas? Am Dienstag dieser Woche trifft die Ministerin im Morgengrauen mit zwei Journalisten der Süddeutschen Zeitung zusammen, um Fehler einzugestehen, was sie tags darauf auch im Parlamentsausschuss wiederholen wird. Aber die Schuldeingeständnisse sind eher banal. So hätte die „Gründungskommission“ der Zellenfabrik aus ihrer Sicht einen weniger missverständliche Namen tragen müssen.

Tatsächlich aber ist die fragwürdige Vergabepraxis für die Forschungsfabrik nur die innere Puppe einer Art russischer Matroschka, die tiefer reichende Defizite der deutschen Innovations- und Industriepolitik in größeren Zusammenhängen symbolisiert. Puppe 2: Die innovative Fehlentwicklung der deutschen Automobilwirtschaft, die jedes Jahr Abermilliarden an Forschungsgeldern in die Fortentwicklung auslaufender Verbrennungstechnologien investiert und den Epochenübergang zur Elektromobilität verschlafen hat, zum Schaden des gesamten deutschen Volkswirtschaft.

Puppe 3: Der widerstandslose Abbau der Elektrochemie – einst ein Paradefeld deutscher Grundlagenforschung – in den Hochschulen der 80er und 90er Jahre, mit dem Nebeneffekt, dass der einst führende Batteriehersteller Varta in diesen Jahren zerlegt wird. Ausstieg aus einem Zukunftsfeld, auch durch Fehleinschätzungen der damaligen Wissenschaftspolitik. Der diesjährige Chemie-Nobelpreis 2019 für die Lithium-Ionen-Batterie geht logischerweise an keinen deutschen Forscher.

Ein internationales Wettrennen

Nun muss sich Deutschland sputen, um im internationalen Wettrennen um die Stromspeicher von morgen nicht abgehängt zu werden. Batterien unterschiedlicher Bauart werden nicht nur für die Elektromobilität auf der Straße oder die mobile Kommunikationstechnik, sondern vor allem als Puffer für die erneuerbaren Energien benötigt. In den letzten Jahren hat das BMBF rund 500 Millionen Euro in den Aufbau neuer Strukturen für die Batterieforschung investiert. Am stärksten profitiert hat davon der Standort Ulm in Baden-Württemberg.

Im vorigen Jahr reiften im BMBF die Pläne zum Aufbau einer Forschungsfabrik für neue Verfahren zur Produktion von Batteriezellen, die mit 500 Millionen Euro aus dem Forschungsetat finanziert wird. Als Träger wurde die Fraunhofer-Gesellschaft ausgewählt. Vorbild ist die vor einigen Jahren installierte „Forschungsfabrik Mikroelektronik“, die von Fraunhofer zusammen mit der Leibniz-Gemeinschaft realisiert wurde.

Das BMBF-Vorhaben läuft parallel zum Aufbau einer konventionellen Fabrik zur Produktion von Batteriezellen, die das Bundeswirtschaftsministerium (BMWi) aus seinem Etat mit einer Milliarde Euro bezuschusst. Den Antrag eines europäischen Industriekonsortiums hat Wirtschaftsminister Peter Altmaier am 9. Oktober bei der EU-Kommission in Brüssel zur Genehmigung für ein sogenanntes IPCEI (Important Project of Common European Interest) eingereicht. Hauptziel ist es hier, die Abhängigkeit der europäischen Autoindustrie von asiatischen Antriebsbatterien zu verringern.

Anja Karliczek 04.jpg

An dem Interessensbekundungsverfahren des BMWi hatten sich mehr als 30 Unternehmen aus der gesamten Wertschöpfungskette „mit Vorschlägen hoher Qualität beworben“, teilte das Altmaier-Ministerium mit. „Sie kommen aus den Bereichen Rohstoffe und Exploration, Materialgewinnung und Recycling, Kathoden-, Anodenfertigung und mechanische Komponenten, Batteriezellproduktion, -integration und -anwendung.“ Die Standort-Entscheidung soll in den nächsten Wochen getroffen werden.

Datenvernetzte Fabriken

In der Forschungsfabrik des BMBF sollen dagegen neue Wege beschritten werden. Anfang des Jahres 2019 wurde auf einer Veranstaltung des Batterieforums das BMBF-„Dachkonzept Forschungsfabrik Batterie“ vorgestellt, das den „Aufbau und Betrieb einer weltweit einzigartigen Pipeline für Batterieinnovationen“ umriss. Dabei geht es vor allem um die drei Teilbereiche „ Materialkonzepte“, „Zellkonzepte“ – wie sie auch schon in der Forschungsproduktionsanlage am ZSW in Ulm „validiert“ wurden sowie um „Produktionskonzepte“, bei denen die deutschen Stärken im Bereich von „Industrie 4.0“, der datenvernetzten Fabrik, ausgespielt werden sollen.

Quelle       :          TAZ         >>>>>           weiterlesen

——————————————————————-

Grafikquellen        :

Oben      —          The 13th Political Ash Wednesday (Politischer Aschermittwoch) of the CDU-Kreisverband Steinfurt in Recke, Kreis Steinfurt, North Rhine-Westphalia, Germany. Among the CDU politicians on the podium were (from left to right) the member of the Bundestag Anja Karliczek, the member of the European Parliament Dr. Markus Pieper and Secretary of State of Germany Karl-Josef Laumann.

Abgelegt unter Bildung, Nordrhein-Westfalen, P.CDU / CSU, Regierung | Keine Kommentare »

Köln-Kurden machten mobil

Erstellt von DL-Redaktion am 24. Oktober 2019

Der Krieg auf der Domplatte

Fichier:Düsseldorf, Rosenmontag 2016, politische Karnevalswagen (06).jpg

Aus Berlin und Köln Dinah Riese, Anett Selleund, Christian Werthschulte

Adnan organisiert in Köln Proteste gegen den türkischen Einmarsch. Bekir Yılmaz in Berlin kann dagegen verstehen, dass die Türkei keinen PKK-nahen Staat tolerieren will. Der eine ist Kurde, der andere Türke. Landet der Konflikt an der syrischen Grenze jetzt mitten in Deutschland?

Aus dem Hauptbahnhof von Köln strömen an diesem wie an jedem Abend die Pendler*innen hinaus. Aber statt des Dom-Panoramas erwartet sie heute etwas anderes: gelb-grün-rote Fahnen der kurdischen Miliz YPG. Seit über einer Woche versammeln sich hier kurdische Gruppen, um gegen den Einmarsch der Türkei in Nordsyrien zu demonstrieren. „Operation Friedensquelle“ nennt die Türkei das, was sie tut; als „nicht im Einklang mit dem Völkerrecht“ bezeichnet es Bundesaußenminister Heiko Maas (SPD). Am Mittag gab es in Köln eine Mahnwache, jetzt am frühen Abend eine Demonstration. Heute sind etwa einhundert Menschen gekommen. „Man muss einen Tag als Kurde leben, um die Kurden zu verstehen“, sagt Adnan, der die Versammlung angemeldet hat. Sein Nachname soll nicht in der Presse veröffentlicht werden.

Adnan arbeitet als Sozialarbeiter in Köln, seine Familie kommt aus einem Dorf in der Nähe von Kobani auf der nördlichen Seite der türkisch-syrischen Grenze. „Ich schaue jede freie Minute aufs Handy“, sagt er. Er liest Nachrichtenportale, wartet auf E-Mails seiner Verteiler und telefoniert mit Freund*innen, die südlich der Grenze auf syrischem Territorium gewohnt haben. Sie sind mittlerweile in die 100 Kilometer entfernte Stadt Raqqa geflohen. „Ich fühle mich so hilflos“, erzählt er. „Wir sind bestürzt, dass wir alleingelassen werden.“ Aber die Solidarität der Bevölkerung mit der Mahnwache sei groß. Einen Tag später, am Samstag, demonstrieren in Köln 10.000 Menschen. An einem der Startpunkte flucht eine Frau im Vorbeigehen im rheinisch-türkischen Akzent: „Diese Scheißkurden. Sollen die doch woanders demonstrieren.“ Niemand beachtet sie.

Es ist kein neues Phänomen, dass sich Konflikte in und um die Türkei auch in Deutschland niederschlagen, sei es die türkische Militäroffensive gegen die syrische Stadt Afrin im Januar 2018 unter dem Namen „Operation Olivenzweig“ – ebenfalls ein Friedenssymbol – oder der Putschversuch in der Türkei 2016; oder seien es die verschiedenen Militärputsche in der Türkei, etwa 1971 oder 1980, in deren Folge viele Kurd*innen vor Verfolgung aus der Türkei fliehen mussten – zum Beispiel nach Deutschland.

Türkischstämmige Menschen bilden laut Mi­krozensus 2018 die größte Minderheit in Deutschland: 13,3 Prozent der „Menschen mit Migrationshintergrund“ hierzulande haben diesen, weil sie selbst oder mindestens ein Elternteil die türkische Staatsbürgerschaft hat oder hatte. Das sind rund 2,8 Millionen Menschen. Darunter sind auch viele Kur­d*innen. Wie viele von ihnen in Deutschland leben, lässt sich nicht so leicht beziffern. Schätzungen gehen von 600.000 bis anderthalb Millionen aus, sie oder ihre Familien stammen vor allem aus der Türkei, aus Syrien, dem Irak oder dem Iran.

Beiderseits wird provoziert. Bei spontanen, nicht angemeldeten Aktionen gegen kurdische Versammlungen und Demonstrationen seien nach Einschätzung des nordrhein-westfälischen Verfassungsschutzes „Anhänger der rechtsextremistischen Grauen Wölfe“ unter den Teilnehmenden gewesen, erklärt das Innenministerium des Landes. Diese, „aber auch nationalistische regierungstreue Türken“ hätten bei diesen Aktionen den Wolfsgruß gezeigt, um ihr Gegenüber zu provozieren. Kurd*innen wiederum reagierten „auf dieses Zeichen hoch emotional.“

Anfang dieser Woche kommt es in Herne zu einer Schlägerei zwischen Türken und Kurden, wie die örtliche Polizei berichtet, beteiligt sind 50 bis 60 Personen. Schon in der Vorwoche wurde in der Stadt im Ruhrgebiet der Wolfsgruß gezeigt, wo­raufhin kurdische Demonstrant*innen erst einen türkischen Kiosk und dann ein Café angriffen. Eine kurdische Demonstration in Mönchengladbach wurde „verbal attackiert“, so das NRW-Innenministerium, bevor es zu körperlichen Auseinandersetzungen kam. In Dortmund wurden türkische Fahnen sowohl gezeigt als auch verbrannt, Letzteres hat der Versammlungsleiter rasch unterbunden. In Lüdenscheid wurde ein türkischstämmiger Mann mit einem Messer schwer verletzt, in Bottrop wurden aus einer Gruppe von etwa 200 Menschen heraus Pflastersteine auf eine kurdische Versammlung geworfen. Immer wieder seien auch Parolen der auch in Deutschland verbotenen Kurden-Partei PKK gerufen oder entsprechende Symbole gezeigt worden.

So hätte der „Schwarze Block des Staat“ aussehen können.

Es sei eine Situation „kurz vor der Explosion“, man sitze „auf einem Pulverfass“ – so ist seit Tagen zu lesen. Unsicher fühle er sich in Köln im Moment nicht, widerspricht Adnan, auch wenn er bestimmte Ecken meidet, wo sich ultranationalistische Türken treffen: „Das hat man nichts zu suchen.“

Im Bundesinnenministerium gibt man Entwarnung. Im Zusammenhang mit der türkischen Militäroffensive würden bereits seit geraumer Zeit „Mobilisierungsaktivitäten kurdischer und deutscher linker Organisationen verzeichnet“, sagt ein Sprecher des Ministeriums auf Nachfrage. Vereinzelte gewaltsame Auseinandersetzungen seien „nicht auszuschließen“. Eine „Verschärfung der ­Gefährdungslage“ sei derzeit aber „nicht erkennbar“.

Quelle       :         TAZ              >>>>>            weiterlesen

—————————————————————–

Grafikquellen          :

Oben        —        So sah es einmal in Düsseldorf aus. /Düsseldorf, Rosenmontag 2016, politische Karnevalswagen.

Cette œuvre a été placée dans le domaine public par son auteur, Kürschner. Ceci s’applique dans le monde entier.

—————————

Unten     —          Bereitschaftspolizei officers during a demonstration

Abgelegt unter Feuilleton, Köln, Medien, Überregional | Keine Kommentare »

Wahlen in Thueringen

Erstellt von DL-Redaktion am 24. Oktober 2019

Allen Untergangs-Prognosen getrotzt

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -110.jpg

Von Michael Bartsch

Nach fünf Jahren klopft sich Rot-Rot-Grün in Thüringen auf die Schulter. Die drei Koalitionspartner würden am liebsten zusammen weitermachen.

Es ist der Blick auf die Opposition, der in Thüringen zeigt, wie rund es für die Regierung eigentlich läuft. Mike Mohring wirke ziemlich bemüht, Angriffsflächen bei Rot-Rot-Grün zu entdecken, schilderte ein Radiohörer bei MDR Aktuell seinen Eindruck vom CDU-Spitzenkandidaten in Thüringen. In der Tat musste Mohring beim CDU-Wahlkampfauftakt am 3.Oktober das Geschäft der AfD betreiben und ein apokalyptisches Bild von Thüringer Zuständen zeichnen, um Wirkung zu erzielen. Ausgerechnet am Tag der Einheit denunzierte er überdies seinen Kontrahenten Bodo Ramelow von der Linken als „Gewerkschaftsfunktionär aus dem Westen“.

Die gesenkten Hörner der Union wirken wie ein Beleg für die überwiegend erfolgreiche Arbeit der ersten linksgeführten Koalition eines Bundeslandes. Die CDU-Kritik am Lehrer- und Polizistenmangel oder an schwacher Kommunalfinanzierung gleicht einem Eigentor. Linke, SPD und Grüne haben die rigide Sparpolitik und den Personalabbau der CDU-geführten Vorgängerregierungen gestoppt. Statt der im Koalitionsvertrag vorgesehenen 2.500 sind 3.900 Lehrer neu eingestellt worden, was freilich immer noch keine vollständige Unterrichtsversorgung sichert. Tausend Erzieherinnen mehr verbessern die Kita-Betreuung. Und das Volumen des Finanzausgleiches zwischen Land und Kommunen ist von 1,8 auf 2,1 Milliarden gewachsen.

Im November 2014 – kurz nach dem guten Ergebnis der Linken unter Bodo Ramelow – mobilisierte die CDU-Mittelstandsvereinigung viertausend Menschen, die auf dem Erfurter Domplatz mit Kerzen in der Hand den Untergang ihres geliebten Thüringen verhindern wollten. Hundert Tage nach seiner Wahl zum Ministerpräsidenten konterte Ramelow solche Ängste in seiner gewohnt trockenen Art: „Es gibt immer noch Bananen!“ Es gibt 2019 sogar den chinesischen Großinvestor CATL, der pünktlich zum Landtagswahltermin eine 1,8 Milliarden Euro teure Batteriefabrik ans Erfurter Autobahnkreuz baut.

Im Landtagsgebäude trifft man die ziemlich aufgeräumte Landes- und Fraktionsvorsitzende der Linken Susanne Hennig-Wellsow. Sie blickt sichtlich zufrieden auf eine mit den schlimmsten Orakeln begonnene Legislaturperiode zurück. „Wir haben keine einzige Abstimmung verloren!“ Dabei war Rot-Rot-Grün nur mit einer knappen Ein-Stimmen-Mehrheit gestartet.

An der Uneinigkeit der Oppositionsparteien CDU und AfD scheiterte im Dezember 2017 der Versuch, Ministerpräsident Bodo Ramelow (Linke) zu einer Vertrauensabstimmung zu zwingen. Die CDU wollte damals Differenzen in der Koalition über die größtenteils gestoppte Gebietsreform ausnutzen. Vor allem eine Reduzierung der 17 Landkreise bei nur 2,1 Millionen Einwohnern galt als das zentrale Vorhaben der Koalition. „Die Kreisgebietsreform ist das einzige wirklich gescheiterte Projekt“, räumt der SPD-Fraktionsvorsitzende Matthias Hey ein und verweist auf die Widerstände in den Regionen. In der Tat sind es nicht nur CDU-Politiker, die die historisch gewachsene Kleinstaaterei des Thüringer Flickenteppichs für einen „Segen“ halten. „Die Gebietsreform nicht um jeden Preis durchzuziehen hat dazu geführt, dass sie auf kommunaler Ebene freiwillig stattfindet“, dreht die Linken-Chefin hingegen die halbe Niederlage ins Positive.

Quelle        :      TAZ          >>>>>           weiterlesen

Im Labor wird’s spannend

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Kommentar von Georg Löwisch zur Bedeutung der Wahl in Thüringen

Mitten in Deutschland wird am Sonntag gewählt. Aber die Republik redet lieber darüber, dass die Bayern nur knapp gegen Piräus gewonnen haben. Oder da­rüber, ob AKK was Dummes oder was Kluges wagt (und ob sie dem Außenminister rechtzeitig Bescheid gesimst hat). Während im Sommer vor den Wahlen in Brandenburg und Sachsen ein medialer Countdown lief, ist von Thüringen kaum die Rede.

Das hat Gründe. Thüringen hat mit 2,1 Mil­lio­nen Einwohnern nur ungefähr halb so viele wie Sachsen. Und nach dem Grusel über die starken AfD-Ergebnisse vom 1. September wird in Dresden und Potsdam ziemlich geräuscharm über Kenia-Koalitionen verhandelt. Ein wenig ist die rot-rot-grüne Regierung in Erfurt an der geringen Aufmerksamkeit sogar selbst schuld: Sie legte den Wahltermin extra nicht auf denselben Sonntag wie die anderen, sondern lässt so spät wie möglich wählen. Das Kalkül: Nach dem AfD-Schocker in Brandenburg und Sachsen profitieren wir von der Gegenmobilisierung. Jetzt wirkt es aber so, als wollten viele das Land, wo Björn Höcke seine völkischen Träume propagiert, am liebsten wegschweigen.

Quelle          :          TAZ            >>>>>           weiterlesen

—————————————————————-

Grafikquellen       :

Oben      —          Landtagswahl Thüringen am 14. September 2014

  • CC BY-SA 3.0 de
  • File:2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -110.jpg
  • Created: 2014-09-14 19:10:36

—————————–

Unten         —          Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

Abgelegt unter L. Thüringen, P. DIE LINKE, P.CDU / CSU, P.Die Grünen, Überregional | Keine Kommentare »

Armut und Reichtum

Erstellt von DL-Redaktion am 23. Oktober 2019

Zieht doch nach Duisburg!

Sofienstraße - Karl-Morian-Straße, Duisburg-Neumühl, etwa 1976.jpg

von Utta Seidenspinner

Mit einem Mietendeckel will der rot-rot-grüne Berliner Senat die Hauptstädter entlasten: So sollen Vermieter nicht mehr als 30 Prozent des Haushaltseinkommens verlangen dürfen. Das aber geht am Problem vorbei, argumentiert die Journalistin Utta Seidenspinner. Wer Mieter schützen will, muss grundsätzlichere Lösungen finden.

„Ja, das möchste: / Eine Villa im Grünen mit großer Terrasse, / vorn die Ostsee, hinten die Friedrichstraße; / mit schöner Aussicht, ländlich-mondän, / vom Badezimmer ist die Zugspitze zu sehn – / aber abends zum Kino hast dus nicht weit. / Das Ganze schlicht, voller Bescheidenheit.“ So beschrieb Kurt Tucholsky 1927 das Berliner Ideal.

Frappierend aktuell, möchte man sagen. Alles wollen und auf nichts verzichten, so lautet derzeit die Devise der Berliner Politik: Mehr Wohnungen in der Hauptstadt der viertgrößten Wirtschaftsmacht der Welt fordern, aber bitte zum Preis von Görlitz. Erst in den 2000er Jahren die kommunalen Wohnungen verhökern, so das Stadtsäckel füllen und dann den Investoren die Schuld an der verfehlten Wohnungspolitik in die Schuhe schieben.

Warum so erbost? Weil hier mit der linken Bausenatorin Karin Lompscher eine Berliner Ballungsraum-Politikerin mit hilfloser Polemik auf jene Leute losgeht, die in den vergangenen Jahren überhaupt Wohnungen gebaut und saniert haben und es weiterhin tun sollen. Investoren aber können auch ausweichen. Und wer baut dann? Das notorisch klamme Berlin wohl kaum.

Der Job eines Investors hingegen ist es grundsätzlich, Geld zu verdienen. Wo er dieses Geld anlegt, ist seine Wahl. In Aktien, Rentenpapieren oder Immobilien. In Asien, USA oder Europa. Sein Kompass sind Kriterien wie Risiko, Aufwand, Zeithorizont und Rendite. Berlin hat soeben bei mindestens zwei der Kriterien – Risiko und Rendite – Alarm ausgelöst. Bei Mietern und damit bei den Wählern mag das gut ankommen. Mittel- und langfristig ist es aber kontraproduktiv, Investoren zu verschrecken.

Bewährt hat es sich in einer sozialen Marktwirtschaft vielmehr, Anreize zu schaffen, um Wünschenswertes zu fördern und Unerwünschtes zu verringern. Es geht darum, durchdachte, behutsame Prozesse anzustoßen, die über den Ballungsraum-Tellerrand hinausweisen müssen. Denn in vielen Teilen Deutschlands besteht das Problem in Leerstand und mangelnder öffentlicher Versorgung. Dort wäre man glücklich über jeden Investor.

Ganz ohne politische Eingriffe funktioniert es hierzulande allerdings ebenso wenig: In Zeiten des Neoliberalismus Anfang dieses Jahrhunderts wurde entschieden, es sei das Beste, wenn sich der Staat aus allem heraushält. Aber das geht nicht, wenn er sich vorher rund einhundert Jahre lang in alles eingemischt und gezielt ein Volk von Mietern gefördert hat. Die Politik hat bei uns mehr als anderswo die Verantwortung, sich um das Wohnen zu kümmern, es galt in Deutschland nämlich schon seit der Weimarer Republik als gesellschaftliche Aufgabe. Und da Menschen nicht in ein Vakuum hineingeboren werden, ist es zu Recht ihre Erwartungshaltung, dass man sie vor dem freien Spiel der Kräfte schützt.

Was also wären sinnvolle Maßnahmen, um die Auswüchse in den Ballungsräumen zu puffern?

»In fast der Hälfte der Sozialwohnungen leben Menschen, die sich eigentlich mehr Miete leisten könnten.«

Der Bau von Sozialwohnungen gehört nicht unbedingt dazu. Mit ihnen hat man nicht nur gute Erfahrungen gemacht. So ziehen Menschen zwar arm ein, bleiben es aber vielleicht nicht. Dann kommt es zu einer sogenannten Fehlbelegung, deren Quote derzeit bei 42 Prozent liegt. In fast der Hälfte dieser Wohnungen leben also Menschen, die sich eigentlich mehr Miete leisten könnten – auf Kosten der Allgemeinheit, die diese Wohnungen finanziert hat.

Industrienahe Experten plädieren daher gerne für ein höheres Wohngeld, um damit gezielt Menschen zu fördern: Subjektförderung (Mensch) statt Objektförderung (Immobilie). Das Frühjahrsgutachten der Immobilienwirtschaft warnt sogar ausdrücklich vor großen Sozialwohnungsprogrammen: „Für besonders gefährlich halten wir Mengenvorgaben der Politik, wie z. B. in Berlin. Die kommunalen Wohnungsbaugesellschaften sind hier darauf verpflichtet worden, ihren Wohnungsbestand durch Neubau und insbesondere Bestandskäufe um gut 100 000 Wohnungen zu erhöhen. Nicht nur, dass dies angesichts der überhöhten Preise hochspekulative Investitionen sind, die sich als Fehlinvestition mit öffentlichen Geldern herausstellen können. Noch ärgerlicher ist es, dass eine solche Politik die Preisspirale weiterdreht und es den Rückgang der Preise für Wohnungen und Wohnungsbauprojekte verzögert, wenn das Land Berlin zum ‚Buyer of last Resort‘ wird.“ Harald Simons vom Forschungsinstitut Empirica gibt überdies zu bedenken, dass 50 bis 60 Prozent aller städtischen Haushalte einen Anspruch auf geförderte Wohnungen hätten: „Und von denen gewinnen dann 5000 ein Los und alle anderen gehen leer aus. Das ist auch ungerecht.“ Auch er empfiehlt, den Markt sich selbst zu überlassen und Einkommensschwache direkt mit Geld zu unterstützen.

Einen anderen Vorschlag macht der Deutsche Städtetag. Er plädiert für eine Abkehr von der bisherigen Praxis, öffentliche Flächen meistbietend zu verkaufen. Denn wenn Höchstpreise für die Grundstücke bezahlt werden, bleibt Bauträgern gar nichts anderes übrig, als Luxuswohnungen zu errichten, damit sich die Investition lohnt. Und laut Bundesinstitut für Bau-, Stadt- und Raumforschung sind diese Grundstückskosten derzeit das größte Problem: Bei einem neuen Haus verschlingen sie inzwischen bis zu 70 Prozent des Budgets, in den großen Städten – aufgrund der dichteren Bebauung – immerhin noch durchschnittlich 30 bis 50 Prozent.

Die Preise für Bauland sind in den vergangenen Jahren so enorm gestiegen, dass die Spekulation damit größeren Gewinn verspricht, als tatsächlich zu bauen. Das Land wird gehortet und liegt brach. Dieses „Landbanking“ wird finanziell sogar gefördert, denn der Staat besteuert unbebautes Land niedriger als bebautes. Die Forderungen nach einer Umkehr dieser Logik werden lauter, ausnahmsweise sogar von Industrie und Politik gleichermaßen.[1]

Hans-Jochen Vogel, ehemals SPD-Oberbürgermeister von München, hat „Sorge, dass wir die Dinge weitertreiben lassen und damit die soziale Kluft in unserem Lande noch weiter verbreitern“. Er rechnet vor, dass die Grundstückspreise in München seit 1950 um stolze 69 000 Prozent gestiegen sind. Damals kostete Bauland (erschlossen und baulich nutzbar) 6 Mark, rund 3 Euro, pro Quadratmeter heute sind es 2100 Euro. Das liegt vor allem an der gestiegenen Attraktivität der Stadt, der Lage, den Jobs, der funktionierenden Infrastruktur, der Versorgung mit Schulen und Universitäten. Nichts von alledem haben Grundstücksbesitzer erarbeitet, es ist ihnen in den Schoß gefallen.[2]

Auch bundesweit sind von 1962 bis 2015 die Baulandpreise um 1600 Prozent gestiegen, der normale Preisindex hingegen nur um 302 Prozent – eine Entwicklung, die bereits Anfang der 1970er Jahre abzusehen war. Der Münchner Stadtrat unter Oberbürgermeister Vogel forderte bereits im März 1972 vom Bund die Einführung einer Bodengewinnsteuer und die Abschöpfung der Planungsgewinne. Wenn Wertminderungen durch Planungsentscheidungen entschädigt werden müssten, dürften auch Wertsteigerungen nicht beim Eigentümer verbleiben. Selbst der damalige CSU-Chef Franz Josef Strauß sagte: „Die Grundstückspreise steigen in einem Maße, dass es nicht zu verantworten ist, diese Gewinne unversteuert in die Taschen weniger fließen zu lassen.“ Passiert ist dennoch nichts.

Duisburg, Zinkhüttensiedlung, 2012-11 CN-02.jpg

„Im Gegensatz zu damals gibt es heute aber noch nicht einmal eine öffentliche Diskussion darüber“, kritisiert Vogel in einem Gastbeitrag für die „Süddeutsche Zeitung“. Das Problem müsse ganz rasch zurück auf die politische Tagesordnung: „Grund und Boden ist keine beliebige Ware, sondern eine Grundvoraussetzung menschlicher Existenz. Er ist unvermehrbar und unverzichtbar, […] jeder braucht ihn in jedem Augenblick seines Lebens wie das Wasser oder die Luft.“[3]

Schon das Bundesverfassungsgericht beschloss vor über 50 Jahren, am 12. Januar 1967: „Die Tatsache, dass der Grund und Boden unvermehrbar und unentbehrlich ist, verbietet es, seine Nutzung dem unübersehbaren Spiel der Kräfte und dem Belieben des Einzelnen vollständig zu überlassen: eine gerechte Rechts- und Gesellschaftsordnung zwingt vielmehr dazu, die Interessen der Allgemeinheit in weit stärkerem Maße zur Geltung zu bringen als bei anderen Vermögensgütern.“ Und dann kommt ein aus heutiger Sicht revolutionär anmutender Satz: „Es liegt hierin die Absage an eine Eigentumsordnung, in der das Individualinteresse den unbedingten Vorrang vor den Interessen der Gemeinschaft hat.“[4] Und ausgerechnet in der Bayerischen Verfassung heißt es in Artikel 161, Absatz 2: „Steigerungen des Bodenwertes, die ohne besonderen Arbeits- oder Kapitalaufwand des Eigentümers entstehen, sind für die Allgemeinheit nutzbar zu machen.“ Das aber wurde bislang versäumt.

»Die Infrastruktur im ländlichen Raum wurde vernachlässigt oder radikal weggespart.«

Quelle        :          Blätter        >>>>>           weiterlesen

———————————————————————-

Grafikquellen      :

Oben       —          Ecke Sofienstraße / Karl-Morian-Straße in Duisburg-Neumühl. (Im Hintergrund sind Häuser auf der Lüneburger Straße zu sehen. Die auf dem Foto zu sehende Grünfläche war zu diesem Zeitpunkt noch unbebaut. Das Foto ist vor 1977 entstanden, vermutlich 1976.)

————————————

Unten         —        Duisburg (North Rhine-Westphalia, Germany) – borough Hamborn, district Obermarxloh – residential complex at square Zinkhüttenplatz

Abgelegt unter Nordrhein-Westfalen, P.CDU / CSU, Sozialpolitik, Umwelt | Keine Kommentare »

Höckes nativer Enkeltrick

Erstellt von DL-Redaktion am 23. Oktober 2019

Anständige Floskeln und unanständige Ideologie

Landesparteitag AfD Thüringen 2019 - Björn Höcke - 1.jpg

Ein Essay von Tubias Ginsburg

Während die Nachrichten über den Anschlag in Halle auf die Smartphones eintrudeln, hält Björn Höcke eine Wahlkampfrede auf einem Familienfest der AfD. Der jüdische Autor Tobias Ginsburg war dabei.

Als Björn Höcke endlich die Bühne betritt, ist der Terroranschlag von Halle bereits vorbei. Zwei Menschen sind tot. Eine Holztür hat das große Massaker verhindert.

Ich weiß nicht, ob die durchnässten Menschen im thüringischen Mühlhausen von dem Attentat wissen. Während ich alle zwei Minuten mein Handy zittrig aus der Tasche krame, mich dabei frage, warum ich Jom Kippur an so einem beschissenen Ort verbringe und nicht bei meiner Familie bin, stehen die Leute um mich herum ganz friedselig beisammen.

Es sind vor allem gutgelaunte Rentner und Kleinbürger, dazwischen ein paar fröhliche Neonazis, die das AfD-Familienfest besuchen. Geduldig wartet man hier auf Björn Höckes Auftritt, trinkt Bier und Glühwein, schunkelt sanft zu volkstümlicher Schlagermusik, vorgetragen von zwei dauergrinsenden Musikern in Trachten, und wann immer ein neuer Regenschauer herabschüttet, flüchtet man unter die Zelte. Und die grinsende Kapelle greift beherzt in die Schlagerkiste: „Tiefe Spuren in unsren Herzen, tausend Sünden im Gesicht / Die nächsten hundert Jahre, die liegen noch vor uns / Wir sind alle noch am Leben!“

Der jung ergraute Kerl knurrt genervt auf, als ich ihn nach dem Attentat in Halle frage. „Waren sicher wieder die Goldstücke“, sagt er und meint damit Geflüchtete.

„Aber eine Dönerbude wurde auch zusammengeschossen.“

Der graue Kerl zuckt mit den breiten Schultern: „Kennen wir doch schon alles.“

Es ist gar nicht so einfach Menschen mit Terroranschlägen noch zu beeindrucken. Sicherlich, in der Welt meines Smartphones, bevölkert von linksliberalen, antirassistischen und nicht zuletzt jüdischen Stimmen, da sitzt der Schock tief. Da erkennt man die Zäsur: Ein Nazi hat in Deutschland versucht, ein Blutbad in einer Synagoge anzurichten. Aber hier auf dem Mühlhäuser Untermarkt, gleich vor der schönen gotischen Kirche, da klingt das alles nur halb so schlimm.

„Wie viele Tote denn?“, fragt mich die alte Frau mit Bratwurst, als ich sie anspreche.

„Mindestens zwei.“

„Ah, ah ja“, sagt sie, nickt freundlich, und wir wissen beide nicht, wie wir das Gespräch noch fortsetzen können. Was kann man dieser Frau sagen? Was kann man sagen, was tun nach so einer Tat?

Gut, da sind zunächst die Floskeln. Wir müssen gegen rechts sein. Noch mehr! Und gegen jeden Antisemitismus! Wir stehen unteilbar! Wir sind mehr! Nie wieder! Keinen Millimeter nach rechts! Rassismus, pfui Spinne! Und so fort. Gefordert wird das von den Anständigen, gehört von anderen Anständigen. Die Unanständigen lesen derweil unanständige Texte, in denen abgefuckte AfD-Politiker den Mörder als unpolitischen Geisteskranken darstellen. Und dann sind da noch all jene, die einfach nur weiterhin auf Familienfesten in ihre Bratwurst beißen wollen. Die einen Scheiß auf gutgemeinte Floskeln geben. Sich nicht angesprochen fühlen.

Klar erfüllen die Floskeln trotzdem einen Zweck. Sie sind beruhigende, kollektive Mantras: Die offene, pluralistische Gesellschaft ist noch lange nicht verloren. Und es liegt in der Natur des Mantras, dass man es wiederholt – und in der Natur des Menschen, sich im Moment der Hilflosigkeit Mut zuzusprechen. Sicher, man kann auch zusätzlich noch ein konsequentes Vorgehen gegen die rechte Szene verlangen. Aber haben wir das nicht schon nach den NSU-Morden verlangt? Nach der Nordkreuz-Todesliste, nach Franco A., nach dem Mord an Walter Lübcke? Oder nach 1945? Es ist gar nicht so einfach, sich nach so einer Tat wieder Mut zu machen.

Höcke nun wiederum gelingt das Mutmachen ganz hervorragend. Er macht seinem begeistertem Publikum Mut im Kampf gegen das verlogene Establishment, gegen Zuwanderung und Multikulti. Mut, sich von Kollegen, Freunden, Enkelkindern als Rassist beschimpfen zu lassen. Mut, trotzdem die AfD zu wählen.

Und dann äußert er sich auch zu Halle. Das muss er auch. Es ist bereits 17 Uhr, es nieselt, einige Zuschauer haben sich in Deutschlandflaggen mit dem Schriftzug „Wir sind das Volk“ gehüllt, im Hintergrund kreischen die Trillerpfeifen der Gegendemonstration. Die Bluttat liegt Stunden zurück, und die Pressemitteilungen laufen heiß.

Datei:Skulptur Juedische Opfer des Faschismus (Foto 2008).jpg

Höcke setzt den Anschlag in eine Reihe mit anderen Gewalttaten, die allesamt von Nichtdeutschen begangen wurden: Mit dem Jungen, der in Frankfurt vor einen ICE gestoßen wurde, mit dem Syrer, der zwei Tage zuvor in Limburg mit einem Lastwagen mehrere Autos gerammt hatte. „Und heute hören wir von einem Terroranschlag auf eine jüdische Gemeinde in Halle, und wir fragen uns als AfD: Was ist in diesem Land los?“

Eine unappetitliche Aufzählung, eine heuchlerische Frage, erst recht aus dem Mund von Höcke: einem Faschisten, der seine geschichtsrevi­sio­nis­tischen und rassistischen Verbal­exzesse mit ritterhafter Mannhaftigkeit und dunkelbrauner Nostalgie performt. Aber dieser Höcke ist an diesem Tag nur bedingt anzutreffen. Wie schon am Vortag in Apolda steht vor mir ein taktierender Wahlkämpfer, ein schmalbrüstiger Kerl mit brav frisiertem Scheitel. Der, so scheint es, sich Mühe gibt nicht allzu laut zu werden. Der sich als unschuldiges Opfer des Establishments geriert. Zwar hebt für ein paar Sätze zum Crescendo an und goebbelt herum, aber gleich darauf entschuldigt er sich artig dafür: „Entschuldigen Sie, an dieser Stelle werde ich einfach immer so emotional.“

Quelle         :        TAZ          >>>>>         weiterlesen

——————————————————————-

Grafikquellen       :

Oben        —      Landesparteitag der AfD-Thüringen am 19. August 2019 in Arnstadt

———————-

Unten        —    Skulptur „Jüdische Opfer des Faschismus“ (1957) von Will Lammert in der Großen Hamburger Straße, Berlin. Sie steht vor dem Jüdischen Friedhof Berlin-Mitte.

Denkmalplakette Deutschland.svg
Dies ist ein Foto des Berliner Kulturdenkmals mit der Nummer

09035233

Urheber Jochen Teufel

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter L. Thüringen, Medien, P.AfD, Überregional | Keine Kommentare »

Scheiß auf die Kids?

Erstellt von DL-Redaktion am 20. Oktober 2019

Nein – Scheiß auf Merkel !

DBG 22355 (38432661520).jpg

Von Peter Unfried

Wie bekommt die gesellschaftliche Bewegung für Klimapolitik schnell eine Bundesregierung, die handelt?

eit dem großen Septemberstreik frage ich jeden, den ich treffe: Wie geht es weiter mit der von Fridays for Future (FFF) angestoßenen Bewegung für Klimapolitik, die sich auf breite Teile der Gesellschaft ausgedehnt hat? Hier mein Zwischenergebnis.

Die eine Möglichkeit: Demnächst kracht irgendwo irgendwas, die Mehrheits- und Mediengesellschaft beschäftigt sich damit, und FFF laufen freitags ins Leere.

Die zweite Möglichkeit: Die Politik des „Scheiß auf die Kids“ wird durchgewinkt. Die Mehrheitsgesellschaft arrangiert sich mit der Position der Bundesregierung, dass das absurde Missverhältnis zwischen ihrer mickrigen Klimapostwurfsendung und der krassen Problemstellung das letzte Wort ist. Union und SPD lenken sich unter Assistenz der Hauptstadtjournalisten mit schnarchigen Personalfragen (Scholz und AKK) und internen Intrigen (gegen Scholz und AKK) von den Problemstellungen der Wirklichkeit ab. So gehen die nächsten beiden Jahre verloren.

Die dritte Möglichkeit: FFF sind in die gesellschaftliche DNA eingedrungen. Ernsthafte Bekämpfung der Erderhitzung wird eine Grundbedingung für Regieren wie es die Bekämpfung der Arbeitslosigkeit war. Die nächste Bundesregierung wird auf der Grundlage eines Zukunftsplanes durch sozialökologische Wirtschaft und europäische Politik gewählt.

End of the FridaysForFuture demonstration Berlin 29-03-2019 05.jpg

Nachdem von politischen Idioten alles platt gemacht  wurde – helfen nur noch Kinder !

Jetzt ist die Frage: Wer will und kann eine Mehrheit dafür gewinnen? SPD, FDP und Linkspartei helfen dabei nicht. Erstens haben sie kaum noch Wähler. Zweitens haben sie (Achtung, Zusammenhang) die soziale und wirtschaftliche Dimension einer sozial­ökologischen Transformation bisher knallhart ignoriert. Die Union leider auch. Und manche dort scheinen zu hoffen, dass die Leute von der Sache ablassen, wenn man sie wieder mit den handelsüblichen Ängsten füttert. Immerhin hat die CDU aber eine Politikerin, die mit einem entsprechenden Wählerauftrag eine überzeugende Klimakanzlerin geben könnte. Angela Merkel.

Quelle        :       TAZ        >>>>>          weiterlesen

——————————————————————

Grafikquellen            :

Oben       —        DBG 22355 (38432661520)

———————————–

Unten        —        Abschlusskundgebung der FridaysForFuture Demonstration am 29. März 2019 in Berlin.

Abgelegt unter Berlin, Bildung, International, Kriegspolitik | Keine Kommentare »

Sie trainieren unser Ende!

Erstellt von DL-Redaktion am 19. Oktober 2019

Zur laufenden Atomkriegsübung in Büchel 

Quelle         :       Scharf  —  Links

Ein Beitrag von Kathrin Vogler

Seit Montag und bis heute trainieren US-Truppen gemeinsam mit der Bundeswehr in der jährlichen Militärübung „Steadfast Noon“ den Atomkrieg über Deutschland. Die Bundeswehr setzt dabei Tornados und Eurofighter ein. Trainiert werden die Einsatzbereitschaft und die Fähigkeit zur Zusammenarbeit zwischen den europäischen Militärs und der in Europa stationierten US-Air Force-Kräfte. Die beteiligten deutschen Standorte sind in diesem Jahr Büchel und Nörvenich. Auch in Nörvenich waren früher Atomwaffen stationiert. In Büchel lagern aktuell bis zu 20 Atombomben des Typs B61. Das Taktische Luftwaffengeschwader 33 der Bundeswehr soll im Atomkriegsfall die Bücheler Atombomben im Rahmen der Nuklearen Teilhabe ins Ziel bringen.

Kathrin Vogler, friedenspolitische Sprecherin der Fraktion Die Linke im Bundestag, dazu: „Es ist völlig wahnsinnig, was da gerade geschieht. Die USA übt mit der Bundeswehr sowie niederländischen, italienischen und polnischen Streitkräften, wie man einen Atomkrieg in Europa führt. Käme es dazu, würden Millionen Menschen sterben und kein Stein bliebe auf dem anderen. Es ist auch skandalös, dass die Bevölkerung nicht informiert wird. Wir wissen zum Beispiel nicht, ob die Bücheler Atombomben während der Übung über der Eifel herumgeflogen werden.

Kathrin Vogler 3.jpg

Ich habe Mitte September eine Kleine Anfrage zu Steadfast Noon  gestellt, die die Bundesregierung bis heute nicht beantwortet hat. Wie groß ist das Risiko, dass hier ein katastrophaler Unfall geschieht? Dass diese Atomkriegsübung eine politische und militärische Drohgebärde gegenüber Russland sein soll, macht alles noch schlimmer: Steadfast Noon markiert den Rückfall in den nuklear bestückten Kalten Krieg, der uns alle als Geiseln nimmt. Meine Antwort darauf: Wir müssen alle Atomwaffen abschaffen. Die Bundesregierung muss sofort den UN-Atomwaffenverbotsvertrag unterschreiben.“

Urheberrecht

Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquellen      :

Oben       —       Explosion von Upshot-Knothole Badger 1953 auf der Nevada Test Site

———————————

Unten      —        Kathrin Vogler. Foto: Niels Holger Schmidt

 

Abgelegt unter Bundestag, Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Hessen droht U-Ausschuss

Erstellt von DL-Redaktion am 18. Oktober 2019

Verbindungen des Lübcke-Mörders

Wolfhagen, KS - Bründersen v W.jpg

Von Konrad Litschko

Der Ex-Verfassungsschützer Andreas Temme soll mit dem mutmaßlichen Lübcke-Mörder „dienstlich befasst“ gewesen sein. Ein U-Ausschuss könnte folgen.

Hessen steuert auf einen neuen Untersuchungsausschuss zu – und zwar zum Mordfall Lübcke. Nachdem am Donnerstag Hessens Innenminister Peter Beuth (CDU) einräumte, dass es einen dienstlichen Bezug des früheren Verfassungsschützers Andreas Temme, der am Tatort des NSU-Mordes in Kassel war, mit dem mutmaßlichen Lübcke-Mörder Stephan Ernst gibt, stellte die Opposition einen U-Ausschuss in Aussicht.

Auf Nachfrage der SPD hatte Beuth im Innenausschuss erklärt, Temme – ein einst langjähriger V-Mann-Führer – sei mit Ernst „dienstlich befasst“ gewesen. Näheres wollte er dazu nicht sagen. Ein Sprecher des Verfassungsschutz teilte aber der taz mit, es gehe um zwei Vermerke in Ernsts Personenakte aus dem Jahr 2000, die Temme unterzeichnet habe. Ernst war damals in der Kasseler Neonazi-Szene aktiv und galt als gewalttätig. Dienstliche Treffen zwischen Ernst und Temme seien nicht bekannt, sagte der Sprecher. Auch eine Zusammenarbeit von Ernst mit dem Landesamt habe es „zu keiner Zeit“ gegeben, ebenso wenig sei dieser V-Mann gewesen.

Die Rolle von Andreas Temme ist bis heute dubios. Der Verfassungsschützer war am Tatort, als der NSU im April 2006 in Kassel Halit Yozgat in seinem Internetcafé erschoss. Nur zufällig sei er dort gewesen, von dem Mord habe er nichts mitbekommen, beteuert Temme bis heute. Er wurde 2007 schließlich versetzt – und arbeitete zuletzt im Regierungspräsidium, das der im Juni erschossene Walter Lübcke (CDU) leitete. Zu dieser Tat bekannte sich Stephan Ernst: Er habe Lübcke wegen dessen Kritik an Geflüchtetengegner auf einer Bürgerversammlung 2015 getötet. Später widerrief er sein Geständnis.

Nach dem jetzigen Hinweis auf Temme halte er „einen Untersuchungsausschuss zum Mord an Walter Lübcke für nahezu unausweichlich“, erklärte der SPD-Parlamentsgeschäftsführer Günter Rudolph. Auch der FDP-Innenpolitiker Stefan Müller nannte es „erstaunlich“, dass die Information erst auf Nachfrage ans Licht komme. „Diese Informationspolitik ist ein weiteres Mal aufs Schärfste zu kritisieren. Der Innenminister bettelt um einen Untersuchungsausschuss.“ Der Linken-Innenexperte Hermann Schaus sagte ebenso: „Der Innenminister, CDU und Grüne legen ein Verhalten an den Tag, dass einen neuen Untersuchungsausschuss nahezu unumgänglich macht.“

Frühzeitige Löschung der Akte

Innenminister Beuth appellierte dagegen, sich „an die Fakten zu halten, anstatt durch haltlose Thesen Verschwörungstheorien zu bedienen“. Dass sich Temme, beim Verfassungsschutz zuständig für den Bereich Rechtsextremismus, auch mit dem damaligen Szeneangehörigen Ernst befasst habe, sei „nicht überraschend“. Beuth warnte die Opposition, „Sachverhalte unnötig zu skandalisieren“.

Quelle       :          TAZ         >>>>>             weiterlesen

———————————————————–

Grafikquellen      :

Oben        —          Bründersen, Wolfhagen, von Westen

—————————————

Unten          —         Peter Beuth auf dem 29. Parteitag der CDU Deutschlands am 6. Dezember 2016 in Essen

  • CC BY-SA 3.0Hinweise zur Weiternutzung
  • File:2016-12-06 Peter Beuth CDU Parteitag by Olaf Kosinsky-8.jpg
  • Erstellt: 2016-12-06 17:57:26

Abgelegt unter Hessen, P.CDU / CSU, Regierung, Überregional | Keine Kommentare »

Berliner Stadtgespräch

Erstellt von DL-Redaktion am 17. Oktober 2019

Behörden und Rechtsextremismus

Hans-Georg Maaßen 02.jpg

Doppelt blinder Fleck

Unterzeichnete nicht gerade er als Verantwortlicher Fahnenschwenker seiner Behörde die dafür benötigten Papiere? Sah er nicht, dass der blinde Aasgeier ihm aus dem Hintergrund die braune Zunge entgegenstreckte ? Als ein langjähriges Mitglied einer politisch zweifelhaften Werteunion?

Von Tobias Schulze

Nach dem Anschlag von Halle ermittelten Journalisten schneller als die Behörden. Sind die hilflos oder ignorant, wenn es um rechten Terror geht?

Journalisten waren schneller als die Polizei, und dafür mussten sie sich noch nicht mal besonders beeilen: In der Sendung Frontal21 strahlte das ZDF am Dienstag ein Interview mit einem Letten aus, der bis vergangene Woche ein Internetforum mit rechtsextremen Inhalten betrieb. In diesem Forum war auch der Halle-Attentäter Stephan B. aktiv.

Der Täter hatte seine Tat dort angekündigt und auf den Livestream des Attentats verlinkt. Die Polizei, so der Lette, interessierte sich dennoch nicht sonderlich für das Forum. Ermittlungsbehörden hätten sich bis zum Zeitpunkt des Interview noch nicht bei ihm gemeldet. Das Forum, die Posts des Attentäters und alle dessen Daten habe er zwei Tage nach dem Anschlag selbst gelöscht.

Blöd gelaufen: Hätten die Ermittler rechtzeitig in Riga angerufen, hätten sie möglicherweise Spuren des Attentäters sichern können, die jetzt verloren sind. Gleichzeitig hätten sie dafür gesorgt, dass seine Posts nicht mehr öffentlich abrufbar sind – aus Respekt vor den Opfern und zum Schutz vor Nachahmern. Dass sie den Anruf unterlassen haben, ist kein Zufall. Die Boards und Foren der rechtsextremen Onlinesubkultur mit ihren Bildchen, Witzchen und Hassparolen sind für die Sicherheitsbehörden eben ein blinder Fleck. Genaugenommen: ein doppelter blinder Fleck.

File:MKBler - 393 - Synagogen-Mahnmal (Halle).jpg

Dass die Behörden die Gefahr rechtsextremer Gewalt unterschätzen, galt lange als linke Paranoia. Nach Halle scheint aber sogar bei den Verantwortlichen angekommen sein, dass an den Warnungen etwas dran war. Selbst das BKA fragt sich mittlerweile, warum es zwar hunderte islamistische Gefährder auf dem Schirm hat, aber nur ein paar Dutzend rechtsextreme.

Quelle         :        TAZ        >>>>>          weiterlesen

———————————————————-

Grafikquellen       :

Oben       —          Hans-Georg Maaßen, Präsident des Bundesamtes für Verfassungsschutz.

Abgelegt unter Feuilleton, Mensch, Religionen, Sachsen-Anhalt | Keine Kommentare »

Eine politsche Antwort :

Erstellt von DL-Redaktion am 17. Oktober 2019

Überwachung, geknackte Messenger: Die Forderungen nach dem Anschlag in Halle

Bildergebnis für Wikimedia Commons Bilder Bayerns Ministerpräsident Horst Seehofer

Der Minister für Heimat und Überwachung : „Hoch auf den braunen Wagen“

Quelle      :       Netzpolitik ORG.

Von    

Nach dem rechtsextremen Terroranschlag in Halle werden neue Überwachungsmaßnahmen diskutiert, darunter anlasslose Massenüberwachung oder erweiterte Eingriffsmöglichkeiten für Ermittlungsbehörden. Eine Übersicht der Forderungen – und einige mögliche Alternativen.

Die mörderische Tat von Halle war modern durchgeführt: Das erklärte Vorbild des Täters war unter anderem der Anschlag von Christchurch, die Schusswaffen hatte er sich mithilfe eines 3D-Druckers selbst gebaut und auch Anleitungen ins Netz gestellt. Er fand auf Plattformen Gleichgesinnte und streamte seine Tat auf Twitch.

Das eigentliche Problem ist, dass in Teilen unserer Gesellschaft Antisemitismus und Rassismus weiterhin einen Nährboden haben und zu wenig dagegen unternommen wird. Doch stattdessen erleben wir in den vergangenen Tagen Stellvertreterdebatten, in denen Sicherheitsbehörden und Innenpolitiker die Chance nutzen, ihre alten Forderungen nach mehr Überwachung und Kontrolle neu zu verpacken und als Wundermittel und vermeintlich neuen Lösungsansatz zu präsentieren. Wir haben für Euch zusammengetragen, welche Forderungen erhoben werden – und wie eine bessere Antwort aussehen könnte.

Vorhandene Mittel erweitern

Seit Jahren erhalten Ermittlungsbehörden stetig neue Befugnisse. Ob Staatstrojaner für das Bundeskriminalamt, erweiterte Videoüberwachung oder gleich ganze Bündel an Kompetenzen, etwa im Rahmen von Anti-Terror-Paketen, um nur einige Beispiele der letzten Zeit zu nennen: Reflexartig wird oft ein weiterer Ausbau der Befugnisse gefordert, anstatt die Wirksamkeit vorhandener Mittel zu evaluieren.

Zugleich haben die Regierungen, Polizeien und Geheimdienste in der jüngeren Vergangenheit die von rechts kommende Gefahr sträflich unterschätzt. Nach dem Mord am Unions-Politiker Walter Lübcke und dem Terroranschlag von Christchurch hat aber immerhin ein Umdenken eingesetzt: Das BKA soll über 400 neue Stellen und eine teils neue Struktur erhalten, um gezielt gegen rechtsextreme Umtriebe, auch im Internet, vorgehen zu können.

Nicht nur die Befugnisse, auch die Budgets der Sicherheitsbehörden sind in den letzten Jahren drastisch gewachsen. So hat sich der Etat des Verfassungsschutzes von 2015 bis heute beinahe verdoppelt – von 230 Millionen Euro auf 421 Millionen Euro. Das Bundeskriminalamt erhielt 2015 noch 430 Millionen Euro, während es in diesem Jahr bereits 792 Millionen sind.

Auch der BND erhielt 2015 noch 615 Millionen Euro, während im Haushalt für 2020 stattliche 967 Millionen Euro vorgesehen sind. Die Forderung nach erweiterten Kompetenzen stehen im Kontext einer Politik von immer umfangreicheren Überwachungsbefugnissen. Schon die Enthüllungen Edward Snowdens waren für die Bundesregierung eher eine Machbarkeitsstudie denn problematisch. Die Enthüllungen haben zu erheblichen Kompetenzerweiterungen der Geheimdienste geführt, unter anderem mit dem neuen BND-Gesetz.

Der Jurist Ulf Burmeyer und der Cybersicherheitsexperte Sven Herpig schließen sich in einem Gastbeitrag auf Zeit Online deshalb der Idee des Datenschutzbeauftragten Kelber nach einem Moratorium für Sicherheitsgesetze an. Bestehende Gesetze sollten demnach evaluiert werden und „wenn es nicht die fehlenden Befugnisse waren, braucht es auch keine neuen“.

All dies hält jedoch Politiker nicht davon ab, nach Anschlägen wie dem von Halle mit neuen Vorschlägen an die Öffentlichkeit zu preschen. Wir haben die wichtigsten Wortmeldungen der letzten Tage zusammengetragen und bewertet.

Vorratsdatenspeicherung

Öffentlich fordert derzeit nur die Union die Wiedereinführung der derzeit auf Eis liegenden Vorratsdatenspeicherung (VDS). So sei das „Instrument der sogenannten Vorratsdatenspeicherung und -nutzung“ von „größter Bedeutung“, heißt es in einem am Montag veröffentlichten Beschluss des Bundesvorstandes der CDU. Auf die anfallenden Daten sollen laut CDU sowohl Polizei als auch der Verfassungsschutz zugreifen können. Im darauffolgenden Satz öffnet die Union die Tür zur massenhaften Auswertung dieser Daten, um mit Palantir-artiger Software auf Verbrecherjagd gehen zu können: „Ebenso gehören die Einführung und stetige Weiterentwicklung neuer Software zur Analyse und Auswertung von ‚Big data‘ dazu“, fordert die Union.

Der Vorsitzende des Parlamentarischen Kontrollgremiums des Bundestages, Armin Schuster (CDU), pocht ebenfalls auf die Speicherung von Verkehrsdaten, stellte aber gegenüber dem rbb Inforadio ferner in den Raum: „Wir werden nicht umhin kommen, eine ganz andere Funktion von Cyberpolizei beim Bundeskriminalamt oder Verfassungsschutz Gefahren erforschend zu etablieren. Die Abwägung zwischen Freiheit und Sicherheit […] wollen wir schon lange führen. Ich gehe davon aus, dass wir da jetzt weiterkommen.“

Was die Union also in Summe zu fordern scheint ist eine anlasslose und massenhafte Speicherung aller Verkehrsdaten, die bei Netzbetreibern, Plattformen und sonstigen Online-Anbietern anfallen. Diese Daten sollen letztlich in einer zentralen Datenbank zusammenfließen und automatisiert ausgewertet werden.

So weit will derzeit niemand sonst gehen. In puncto VDS hält sich der Koalitionspartner SPD bedeckt und bleibt bei der Position, die von Gerichten gekippte anlasslose Massenüberwachung nicht wieder einführen zu wollen. „Natürlich kramen Seehofer und die CDU/CSU die VDS wieder aus der Mottenkiste, und wenn der Anlass noch so unpassend ist“, schrieb die SPD-Bundestagsabgeordnete Saskia Esken auf Twitter und verwies auf die einschlägigen Urteile des Bundesverfassungsgerichts und des Europäischen Gerichtshofes, die einer Wiedereinführung im Wege stehen.

Staatstrojaner für den Verfassungsschutz

Mehr Aussicht auf Erfolg dürfte eine rasche(re) Verabschiedung der geplanten Novelle der Inlandsgeheimdienst-Gesetzgebung haben. Das Bundesinnenministerium von Horst Seehofer (CSU) hatte im Frühjahr einen Gesetzentwurf vorgelegt, der dem Verfassungsschutz neue Instrumente zur Verfügung stellen soll. Dazu gehören unter anderem die Online-Durchsuchung und die Quellen-Telekommunikationsüberwachung (Quellen-TKÜ). Beides benötigt den Einsatz von Staatstrojanern und bewusst offengelassene Sicherheitslücken, um in die Rechner oder Smartphones von Verdächtigten einzubrechen. Die SPD hat den Gesetzentwurf stark kritisiert, seitdem liegt er im SPD-geführten Bundesjustizministerium.

Schon vor dem Anschlag hat die CDU in einem Papier zum Rechtsextremismus die Verabschiedung des vorliegenden Gesetzentwurfes gefordert. Nach dem Anschlag erhöht sie den Druck auf den Koalitionspartner. Im montäglichen CDU-Papier bekräftigt die Union, abzielend auf Polizei und Verfassungsschutz: „Wir brauchen adäquate Möglichkeiten für Ermittlungen der Behörden im Darknet, bei der Überwachung von Messenger-Diensten, der Speicherung und Analyse relevanter Daten sowie bei Online-Durchsuchungen“.

Auch in der Bundespressekonferenz hieß es seitens des Innenministeriums: „Das Bundesamt für Verfassungsschutz und die Bundespolizei müssen die Quellen-TKÜ durchführen können, damit Terroristen, Extremisten und Kriminelle nicht verdeckt kommunizieren können“. Selbiges gelte für die Online-Durchsuchung.

Der erneute Druck scheint Wirkung zu zeigen: Laut FAZ soll die SPD-Bundesjustizministerin Christine Lambrecht inzwischen „Gesprächsbereitschaft“ signalisiert haben. Dabei müsse aber auf die Verhältnismäßigkeit der Maßnahmen geachtet werden, sagt sie im Interview mit der Welt. Sie beruft sich auf den Koalitionsvertrag und will demgemäß eine „maßvolle Kompetenzerweiterung – bei gleichzeitigem Ausbau der parlamentarischen Kontrolle“.

Der Präsident des thüringischen Verfassungsschutzes, Stephan Kramer, plädiert im Interview mit der Zeit ebenfalls für Online-Durchsuchungen und Quellen-TKÜ für seine Behörde. Er sagt aber auch: „Selbst wenn uns Programme auf der Suche nach Schlüsselbegriffen unterstützen, müssen Menschen die Erkenntnisse noch analog bewerten und versuchen, die Urheber zu identifizieren.“ Einen Überwachungsstaat wolle man nicht.

Verschlüsselung umgehen oder aufheben?

Auch Ende-zu-Ende-verschlüsselte Messenger-Dienste sind in der Folge des Anschlags in den Fokus geraten. Die Idee, Verschlüsselung aufzubrechen oder zu umgehen, wird nicht zum ersten Mal diskutiert.

Die entscheidende Frage lautet, wie das konkret umgesetzt werden soll. Viele Optionen lässt der Stand der Technik nicht: Entweder werden Diensteanbieter dazu verpflichtet, Hintertüren in ihre Produkte einzubauen. Da sich dieser Ansatz, trotz immer wiederkehrender Anläufe der Politik, technisch nicht sicher umsetzen lässt, hat sich in den vergangenen Jahren die sogenannte Quellen-Telekommunikationsüberwachung etabliert. Hierbei brechen Ermittler in die Rechner oder Smartphones der Verdächtigten ein, um mit Hilfe von Staatstrojanern die Kommunikationsinhalte abzugreifen, bevor sie verschlüsselt werden.

Das Bundeskriminalamt darf Staatstrojaner zur gezielten Überwachung von Verdächtigten schon seit geraumer Zeit einsetzen – zunächst, um gegen schwere Verbrechen wie internationalen Terrorismus vorzugehen, seit Anfang 2018 auch gegen kleinere Delikte. Der Verfassungsschutz könnte dieses Instrument ebenfalls erhalten, sollte die SPD umfallen und sich den Wünschen des CSU-Bundesinnenministers fügen.

Damit sollte die Debatte, so würde man meinen, wenn schon nicht beendet, so doch zumindest eingegrenzt sein. Trotzdem geht alles drunter und drüber – auch bei Politikern, die es eigentlich besser wissen müssten. So sagte etwa der netzpolitische Sprecher der SPD, Jens Zimmermann, dass er „eine anlasslose Überwachung der Kommunikation in Messengerdiensten“ für „höchst problematisch“ halte – was allerdings, unserem Kenntnisstand nach, niemand ausdrücklich gefordert hat. (Wir wissen offen gesagt auch gar nicht, was Zimmermann eigentlich genau meint. Der diesbezügliche Handelsblatt-Artikel hilft dahingehend auch nicht weiter.).

Zwar ließ Bundesinnenminister Horst Seehofer im vergangenen Mai einen Versuchsballon steigen, um Zugriff auf Ende-zu-Ende-verschlüsselte Inhalte von Messenger-Diensten wie WhatsApp oder Signal zu erhalten. Um diesen Vorschlag ist es jedoch eigentümlich still geworden, ausdrücklich aufgewärmt hat ihn im Zusammenhang mit dem Anschlag von Halle bislang niemand. In diese Richtung weist aber die Verlautbarung der Bundesregierung, sich der aktuellen Forderung der USA, Großbritannien und Australien anzuschließen, dass Facebook seinen Messenger künftig nicht Ende-zu-Ende verschlüsselt.

Um die zahlreichen Aussagen von Koalitionspolitikern zusammenzufassen: Im Grunde fordern sie alle, dem Verfassungsschutz die gleichen Befugnisse zu geben, wie sie das BKA bereits hat, nämlich den Einsatz von Quellen-TKÜ (und Online-Durchsuchung).

Das soll nicht bedeuten, dass Hintertüren grundsätzlich vom Tisch sind – die Forderung taucht seit Jahrzehnten regelmäßig auf, und es ist zu erwarten, dass dies bis auf Weiteres so bleibt. Entsprechend zeitlos bleiben die Warnungen, die zuletzt öffentlich geäußert wurden, etwa vom Bundesdatenschutzbeauftragte Ulrich Kelber. Dieser hält ein Einbauen von Hintertüren in verschlüsselte Kommunikation für einen tiefen Eingriff in die „Grundrechte auch von Menschen, die sich überwiegend überhaupt nichts haben zuschulden kommen lassen“. Zudem würden solche Hintertüren so sie denn geschaffen würden, „im Zweifel nicht nur von Sicherheitsbehörden genutzt werden, sie könnten auch ein Einfallstor für Kriminelle sein. Damit würde die Kommunikation insgesamt unsicherer“, sagte Kelber der Welt.

Auch der Digitalverband Bitkom und der Bundesverband Digitale Wirtschaft warnen vor einer Schwächung verschlüsselter Kommunikation.

Änderungen am Netzwerkdurchsetzungsgesetz

Beim Netzwerkdurchsetzungsgesetz (NetzDG) sind sich die Koalitionspartner einig: Es soll zumindest um eine Anzeigepflicht erweitert werden. Laut Bundesjustizministerin Lambrecht sollen Plattformen „verpflichtet werden, ihnen gemeldete Aufrufe zu Mord oder Volksverhetzung an die Ermittlungsbehörden weiterzuleiten“, sagte sie der Welt.

Ähnlich heißt es im CDU-Papier, dass Betreiber „bei strafrechtlich relevanten Fällen proaktiv an die Strafverfolgungsbehörden“ herantreten müssten. Zudem sollten in „besonders schweren Fällen von Verleumdung, Beleidigung oder Bedrohung im Netz“ die Ermittlungen der Strafverfolgungsbehörden „auch ohne Anzeige eingeleitet werden können“. Für diese Fälle prüfe die Union die Einordnung als Verbrechenstatbestand, ferner müsse der Strafrahmen und Deliktscharakter für Verleumdung oder Beleidigung im Netz dringend angepasst werden. In der Bundespressekonferenz sagte ein Sprecher des Innenministeriums: „Internetprovider sollen strafbare Inhalte, insbesondere solche, die unter Hasskriminalität fallen, an das Bundeskriminalamt melden müssen. Das Bundeskriminalamt muss im Einzelfall auch die zugehörigen IP-Adressen erhalten“.

Der innenpolitische Sprecher der CDU/CSU-Bundestagsfraktion, Mathias Middelberg, will Online-Plattformen dazu zu verpflichten, Hass-Postings und Informationenen zu ihren Urhebern als mögliche Beweismittel zu speichern. Der SPD-Innenpolitiker Uli Grötsch verlangt eine verpflichtende Weiterleitung strafbarer Inhalte an die Sicherheitsbehörden.

In einem ausführlichen Interview mit dem Deutschlandfunk bezeichnete der CDU-Politiker Patrick Sensburg die Anzeigepflicht als „Selbstverständlichkeit“ und will die Online-Anbieter haftbar machen, wenn sie ihrer „Verantwortung“ nicht nachkommen sollten. Zudem brachte Sensburg Netzsperren ins Spiel, sollten Anbieter nicht mitspielen: „Und wenn eine Plattform das überhaupt nicht leistet – und da rede ich jetzt nicht von 4chan und 8chan; da ist eine große Community dahinter; aber es gibt andere Plattformen –, dann kann man sie auch dementsprechend blockieren“.

Die Opposition übt Kritik an diesen Plänen. Der innenpolitische Sprecher der FDP, Konstantin Kuhle, fordert, es dabei zu belassen, dass erst nach Anzeige ermittelt wird. Opfer sollten aber bessere Auskunftsrechte bekommen. Auf Twitter stellt er sich gegen vorschnelle Vorschläge und mahnt an „Datenschutz, Privatsphäre und IT-Sicherheit nicht als Schwächen“ zu begreifen.

Mögliche Verschärfungen des NetzDG müssen vor dem Kontext struktureller Schwierigkeiten mit dem Gesetz betrachtet werden. Das Gesetz verpflichtet Provider zu einseitiger Regulierung, da es zu laxe Durchsetzung von Maßnahmen gegen „illegale Inhalte“ sanktioniert, aber zu wenig Schutzmaßnahmen für die Meinungsfreiheit enthält. Das führt nach Berichten schonmal dazu, dass rechte Gruppen die Meldemöglichkeiten nach dem NetzDG im großen Stil zu Kampagnen gegen ihre Gegner nutzen.

Gamer:innen-Szene im Visier

Innenminister Seehofer forderte am vergangenen Wochenende, die Gamer:innen-Szene stärker zu überwachen. „Man muss genau hinschauen, ob es noch ein Computerspiel ist, eine Simulation oder eine verdeckte Planung für einen Anschlag. Deshalb müssen wir die Gamer-Szene stärker in den Blick nehmen“, sagte der dem ZDF. Zwar wandelte er die Forderung später leicht ab, doch die Kritik an seinem Vorschlag war immens.

Niger Army 322nd Parachute Regiment.jpg

Im Interview mit uns sprach sich Miro Dittrich vom Projekt De:hate bei der Amadeu-Antonio-Stiftung klar gegen diesen Vorschlag. Die Aussage Seehofers sei „die Reduktion eines komplexen Themas“. Es gebe rechtsradikale Gamer:innen, aber niemand werde rechtsradikal, weil er/sie Gamer:in sei. Seine Forderung: „Wir müssen über rechtsradikale Ideologien sprechen und die verschiedenen Orte, an denen sie stattfinden.“

Auch Irene Mihalic, die innenpolitische Sprecherin der Grünen plädiert für den Ausbau der „Analysefähigkeiten unserer Sicherheitsbehörden“ und das Aufdecken von Strukturen der rechten Szene, statt auf die Schnelle neue Gesetze auf den Weg zu bringen.

Die Extremismusforscherin Julia Ebner empfiehlt nach dem Anschlag ebenfalls, rechte Strukturen in den Blick zu nehmen. „Was uns fehlt, wären zum Beispiel Online-Interventionsprogramme. Offline gibt es Programme zur Deradikalisierung von Anhängern. Online findet das noch kaum statt“, sagt sie im Interview mit der Süddeutschen Zeitung.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.

—————————————————————

Grafikquellen     :

Oben      —        Bayerns Ministerpräsident Horst Seehofer CC-BY-NC-ND 2.0/lars 2007

—————————

Unten     —          Gamer:innen-Szene – –  Maradi, Niger. Nigerien army soldiers from the 322nd Parachute Regiment practice field tactics during combat training facilitated by U.S. Army Soldiers during exercise Flintlock 2007. The multi-national exercise, which is part of the U.S. State Department’s Trans-Sahara Counterterrorism Partnership, is an ongoing and long standing military-to-military relationship between Niger and the U.S. that provides an interactive exchange of military, linguistic and intercultural skills for both.

Abgelegt unter Deutschland, Innere Sicherheit, Kriegspolitik, Sachsen-Anhalt | Keine Kommentare »

Imperiale Gedankenspiele

Erstellt von DL-Redaktion am 16. Oktober 2019

Miserabler Aussenpolitiker, der ich bin

Quelle       :        untergrund-blättle  CH.

Von Eckhard Mieder

Ich hatte mich, das war zu Zeiten der DDR, entschieden, das Maul zu halten. Ich meine: das Maul zu halten, wenn es an Stamm-, Stuben- oder anderen Tischen außenpolitisch hoch- und herging.

Wenn räsoniert, schwadroniert, spekuliert wurde, als wären wir zwischen Wüsten, Metropolen, Parlamenten, Horizonten etc. heimisch. Ich weiß nicht, wie es an schweizerischen, spanischen, marokkanischen, chinesischen Quassel-Tischen zugeht -, mir kam es stets sehr, sehr deutsch vor, über die Welt Bescheid zu wissen und zu palavern.

Ich fand es ungehörig – plötzlich? irgendwann? weiß nicht mehr! -, über andere Völker, Regionen, Nationen und sowas zu urteilen. Ich hielt diese Unterhaltungen, in denen jeder alles über die fernen Orte, Konflikte, Ungereimtheiten dieser Welt wusste und seine Meinung knautschte, bis die Flasche leer war, nicht mehr aus. Ich kapierte da vieles nicht; ich kapiere bis heute den Lauf der Welt nicht; oder wissen Sie, was grad in Bali, Mali oder mit irgendeinem Ali gleich nebenan usw. geschieht? Oder doch.

Oder doch. Wenn ich die Welt als das Einfache nehme, das sie mir ist. Es gibt auf ihr massenhaft Menschen, die ihr Leben menschenhaft leben wollen. Und es gibt – relativ massenhaft – Menschen, die ihr Leben für menschenhafter halten als das der anderen. Es gibt also Politik und Leben. Es gibt Menschen und Menschen. So. Sortiert nach Sorten oder Ambitionen gibt es Menschen, die leben, Familien gründen, friedlich ihrer Wege ziehen oder einfach nur bleiben wollen. Und es gibt Menschen, die anders drauf sind. Imperialer. Süchtiger. Kriegerischer. (Haben die nicht auch Familie und die Freude auf einen Feierabend bei einem Glas Merlot/Riesling oder den Tagesbeginn mit einer Schüssel Müsli?)

Diese zweite Sorte Mensch (ich vereinfache gewiss, das mischt sich ja, wie sich alles mischt, gestern lief mir ein Regenwurm mit dem Gesicht amerikanischen Präsidenten, dessen Namen mir nicht einfiel, über den Weg; oder war es das Gesicht eines arabischen Präsidenten, dessen Namen mir ebenfalls entfallen war?) -, die zweite Sorte Mensch macht Politik. Im Namen der anderen Sorte Mensch, soweit es sich um eine Demokratie handelt. Und die mag Krieg. Die mag es, auf der Welt die Karten zu mischen. Die mag es, um des Profits willen – das sage ich so hin, obwohl ich keine Ahnung habe – mal da einzumarschieren, mal dort jemanden wegzuputschen, mal gleich wieder ein paar Flugzeuge oder bewaffnete Schiffe auf die Reise zu schicken … Ehrlich? Ist das so? Doch, so ist das, und ich finde das zum Kotzen.

Ich erinnere mich daran, wie es 1968 war. Als die Sowjets (darf man sagen; „Sowjets“ steht, glaube ich, nicht auf der List der Unwörter) in Prag einmarschierten. Da war ein Geschrei in der Welt, und jeder Schrei war ein Ruf nach Freiheit, Selbstbestimmung, Mündigkeit u. ä. Dann war das vorbei, so um 1990 rum. Plötzlich gab es – Freiheit, Selbstbestimmung, Mündigkeit u. ä. Und es gab Invasionen – plötzlich? irgendwie? weiß nicht mehr -, die … ja was? Die anders waren? Welche Schweinerei ist anders als – eine andere Schweinerei?

Welches Schlachtfest ist heiterer – als ein anderes Schlachtfest? Welches Massaker ist akzeptabler – als ein anderes Massaker? Jugoslawien, Irak, Libyen, Jemen, Syrien, irgendwie auch die Ukraine, irgendwie auch Venezuela – was, zum Teufel, geht auf dieser Welt vor? Was unterscheidet eine einstige Sauerei von einer Sauerei heute? Wieso haben wir uns daran gewöhnt, dass die zweite Sorte Mensch Schwein sein darf, und die erste Sorte Mensch leidet wie immer? Wäre ich blutrünstig, würde ich wünschen: Über den wirklichen Schweinen schwebe das Damokles-Schlachte-Beil. Mal sehen, was passiert.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquelle         :      Porträt

Abgelegt unter Bücher, Medien, Sachsen-Anhalt, Überregional | Keine Kommentare »

Reaktionen auf Anschlag

Erstellt von DL-Redaktion am 16. Oktober 2019

Aktionismus auf Anschlag in Halle? Ja, aber richtig

File:MKBler - 393 - Synagogen-Mahnmal (Halle).jpg

Beginnt die Gamer-Szene nicht in den Schützenvereinen, beim Militär oder der Polizei, wo die Zielgenauigkeit auf Scheiben trainiert wird ? Statt dessen wird den Bürger – Innen einmal mehr eine Fiktion von Theoretikern an die Wand gemalt welche die Unfähigkeit der Erfinder zur Realität offenlegt. Vom Computer aus ist noch nie ein Mensch oder Tier tot umgefallen.

Kommentar von Konrad Litschko

Nach dem Anschlag von Halle fordert die Politik viel. Nötig ist aber vor allem immer noch ein Mentalitätswandel der Behörden.

Gamer-Szene ins Visier! Messenger überwachen! Vorratsdaten speichern! Die politischen Forderungen nach dem Anschlag von Halle schießen ins Kraut. Es muss etwas getan werden, das ist richtig. Aber längst nicht alle Forderungen haben noch mit der Tat zu tun.

Klar ist: Die Sicherheitsbehörden haben ein Problem. Sie hatten den Täter von Halle, Stephan B., nicht auf dem Schirm. Weil er in einer rechtsextremen Onlinesubkultur agierte, in der zwar Hass auf Juden, Migranten, Frauen und Linke befeuert wird, in die aber die Behörden bis heute kaum Einblick haben. Und dies, obwohl bereits 2016 in München ein 18-Jähriger, der sich genau in dieser Szene bewegte, neun Migranten erschoss.

Mit Halle fällt Polizei und Verfassungsschutz diese Blindstelle auf die Füße. Zugegeben: Die Community ist ein verworrenes Geflecht aus teils zynisch-ironischen Postings, in immer neuen Foren und Unterforen. Dies alles jederzeit im Blick haben zu können, ist utopisch.

Und wenn Horst Seehofer hier pauschal von „Gamern“ spricht, geht das sicher fehl und schürt einen Generalverdacht. Dennoch ist es überfällig, auf die rechtsextremen Auswucherungen dieser Szene zu schauen, die immer weiter Terrornachahmer anfeuert und nun teils auch Stephan B. feiert.

Expertise statt neuer Instrumente

Der Verfassungsschutz aber will mehr: Er will auch verschlüsselte Nachrichten knacken und Onlinedurchsuchungen durchführen. Bei Stephan B. hätte dies indes nichts geholfen – den hätte man überhaupt erst mal auf dem Schirm haben müssen.

USMC-17987.jpg

Auch ein verschärftes Ahnden von Hasspostings wäre hier gescheitert: B. bewegte sich offenbar auf Imageboards, auf denen anonym gepostet wird. Und auch ein Verbot der Identitären, ebenfalls nun diskutiert, hätte nicht geholfen: Zwar teilte auch B. den Wahn eines „Großen Austauschs“, dieser aber findet sich längst breit gestreut im Netz – und B.s direkte Bezugsszene war wohl eine andere. Dennoch ist es wichtig, nun klare Signale zu setzen, dass auch Hass im Internet nicht mehr ungesühnt bleibt.

Quelle         :        TAZ          >>>>>        weiterlesen

————————————————————————-

Grafikquellen        :

Oben            —            Auf dem Jerusalemer Platz in Halle an der Saale befindet sich das Synagogen-Mahnmal. Von der 1870 gebauten Synagoge konnte nur das Portal, welches nun das Mahnmal darstellt, erhalten werden, während das sonstige Gebäude in der Reichspogromnacht von den Nationalsozialisten zerstört wurde.

MKBler (CC BY-SA 4.0)

—————————————–

Unten      —         Marines instruct Saudi Arabia Marines on close-quarters markmanship at one of the ranges here in Ras Al Ghar. Marines from Company B, BLT 1/4, 11th MEU (SOC) conducted Nautical Union, a bilateral training exercise with the Saudi Arabia Marines, June 2-8.

Abgelegt unter Innere Sicherheit, P.CDU / CSU, Religionen, Sachsen-Anhalt | Keine Kommentare »

Angriff auf die Synagoge

Erstellt von DL-Redaktion am 15. Oktober 2019

Halle: der alltägliche faschistische Wahnsinn

File:MKBler - 393 - Synagogen-Mahnmal (Halle).jpg

Quelle       :       untergrund-blättle   CH.

Von    Theresa Bauer / lcm

Der faschistische, antisemitische, rassistische und patriarchale Anschlag auf eine Synagoge und einen Dönerladen in Halle kommt nicht aus dem Nichts. Über den den alltäglichen Wahnsinn in der Stadt in Sachsen-Anhalt, den Terror und die hallensischen Verhältnisse.

Was am Mittwoch geschah ist schrecklich. Ein Tag, an dem nicht nur die faschistischen Schergen von Erdogan Kurdistan bombadierten, sondern auch ein gewisser Stefan durch die kleine Saalestadt Halle rannte und „Juden und Kanaken“ umbringen wollte. Wenn das nicht klappen würde, es keine Moschee gäbe oder die Synagoge gut bewacht sei, dann müssten halt Linke oder Frauen dran glauben, oder einfach Irgendwer. So kam es dann auch. Es wurden keine Jüd*innen oder „Kanaken“ umgebracht, auch keine „Antifas“, sondern Kevin S., ein 20-jähriger Fußballfan, der das Pech hatte in einem Dönerladen zu sein und Jana L., eine 40-jährige Autogrammsammlerin, die in der Nähe der Synagoge zur Tramhaltestelle wollte.

Beide waren zufällig an den besagten Orten und wurden traurigerweise zu den Opfern. Und dann kommen Seehofer und Stahlknecht, ihres Zeichens Innenminister, um vor der Kamera tief betroffen zu sein – eine offene Provokation. Seehofer und Stahlknecht, die beide aktiv den rassistischen und faschistischen Diskurs vorantreiben, den Nährboden für all jene düngen, für die faschistische und faschistoide Gewalt mehr als nur eine Fantasie ist.

Halle zählt etwa 230.000 Einwohner*innen, 30.000 davon sind Studis und der Innenstadtkern wirkt auf den ersten Blick auch eher beschaulich, als bedrohlich. Wären da nicht all diese Dinge, die immer wieder passieren, all diese Fascholäden, die sich zum Teil mitten in der Innenstadt befinden, das Haus der Identitären, Sven Liebig, der damals Blood and Honour und Combat 18 in Deutschland mitgründete. All die Faschos, die sich in den 90er Jahren organisierten, wie zum Beispiel Thomas Richter, besser bekannt als V-Mann Corelli aus dem NSU-Komplex, Beate Zschäpe, die in Halle zum Arzt ging und kurz vor Ihrer Verhaftung nach Halle kam – warum weiß keiner.

Wären da nicht all die rassistischen Übergriffe, die rechte Staatsanwaltschaft, die immer wieder Faschos freispricht oder mit milden Strafen politische Statements setzt, die antisemitischen Verschwörungsheinis, die HFC-Hooligans, der Alltagsrassismus, den man als weiß gelesene Person gerne mal übersieht, die Burschenschaftshäuser, die Naziaufmärsche, der Übergriff vom 1. Mai letzten Jahres, wo Faschos mit Autos vermeintlich linke gejagt haben und mit Eisenstangen auf eine Wandergruppe eindroschen.

Wäre da nicht die AFD, die gerne mal 23 Prozent der Wahlstimmen bekommt, wäre da nicht der alte Opa, der einen volllabert von den blöden Ausländern, wären da nicht Schüsse auf den Dönerladen in Halle Ost letzten März gewesen, wäre da nicht Halgida und die Proteste gegen Asylunterkünfte, wären da nicht die antifeministischen Übergriffe, die „Lesben-Fotze“ Rufe in der Tram, wären da nicht die Prepper und ganzen Altfaschos, die sich mehr und auch weniger ins Private zurückgezogen haben, wäre da nicht der sachsen-anhaltische Innenminister Stahlknecht, der an rassistischer Stimmungsmache und Jargon kaum noch Nebenbuhler findet, wäre da nicht Horst Seehofer, wären da nicht die Medien, die den rechten Diskurs aktiv fördern, wie die Mitteldeutsche Zeitung, DubistHalle und Sven Liebigs Verschwörungsblatt.

Wäre da nicht die Polizei, die einen Fascho schützt während er neben einer Trauerkundgebung für die Opfer seine rechten Parolen schreit und gegen linke Gewalt wettert. Ja, wäre da nicht die deutsche Realität, wäre da nicht der Mittwoch gewesen, die jüdische Gemeinde gefangen in der Synagoge, der Dönerladen. Ja, wäre all die Scheiße nicht.

Es gibt sie aber, all diese Scheiße, und es gibt sie schon lange oder besser gesagt schon immer. Und es wurde auch schon immer darauf aufmerksam gemacht, es gibt schon lange Antifagruppen und es gibt schon lange den Kampf gegen diesen Wahnsinn. Nur wurde dieser Kampf bis jetzt immer belächelt, in Halle und überall und faschistische Strukturen totgeschwiegen oder einfach kleingeredet. Die letzten Jahre haben die Notwendigkeit einer antifaschistischen Organisierung überall in Deutschland, Europa und der Welt so deutlich gemacht, dass Passivität fast schon Unterstützung dieser ganzen Scheiße ist.

Und dann ist es immer noch „nur“ Halle. In Halle gibt es alternative Räume, eine migrantische Community, eine Synagoge, Menschen die sich engagieren. Das gibt es an vielen anderen Orten nicht. Nicht umsonst kommen viele Menschen, die eigentlich ihrer Auflagen wegen in den kleineren Orten außenrum leben müssten, wie etwa Naumbrug, Wittenberg, Eisleben usw. nach Halle, weil es hier erträglicher ist. Bei allen politischen Streitigkeiten wird die Phrase “Antifa ist Landarbeit“ und “Alle zusammen gegen den Faschismus” immer wichtiger. Halle ist ein Moment in einer langen Reihe an Ereignissen, überall.

Macht euer Maul auf, organisiert euch und an die anderen: All diejenigen, die diesen faschistischen Diskurs aktiv und passiv befeuern, – und das geht vom Messermann-Sprech zu der Forderung, Asylunterkünfte in Herkunftsländern einzurichten, von den Ankerzentren, zu den CDU Wählenden – all die, die sagen, es ist ja gar nicht so schlimm, die nicht auf die Idee kommen, mal eine jüdische Person oder eine person of color zu fragen, wie es sich hier so anfühlt zu leben: Fuck you!

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquelle    :         Auf dem Jerusalemer Platz in Halle an der Saale befindet sich das Synagogen-Mahnmal. Von der 1870 gebauten Synagoge konnte nur das Portal, welches nun das Mahnmal darstellt, erhalten werden, während das sonstige Gebäude in der Reichspogromnacht von den Nationalsozialisten zerstört wurde.

MKBler (CC BY-SA 4.0)

Abgelegt unter Kriminelles, Mensch, Religionen, Sachsen-Anhalt | Keine Kommentare »

Schrumpfen in Schönheit

Erstellt von DL-Redaktion am 13. Oktober 2019

Die Grünen wollen CO2-Emissionen teurer machen.

Extinction Rebellion Berlin 2019-10-09 05 Climate Camp.jpg

Von Ulrike Herrmann

Die Grünen wollen CO2-Emissionen teurer machen. Das wird wenig bringen. Vorbild könnte die britische Kriegswirtschaft ab 1940 sein.

Was für ein ungewohntes Bild: Neben dem Berliner Kanzleramt stehen Zelte. Schon seit Tagen campiert dort „Extinc­tion Re­bel­lion“. Die Aktivist*innen wollen erreichen, dass Deutsch­land ab 2025 kein CO2 mehr ausstößt, das die Atmosphäre ständig weiter aufheizt. Die Klimarebellen haben recht, und trotzdem bleibt Unbehagen zurück. Denn sie skizzieren keinen Weg, auf dem sich diese Nullemission erreichen ließe. Es würde nämlich nicht einmal ausreichen, wenn alle Deutschen Vegetarier würden, ganz auf Flüge verzichteten und keine Autos mehr besäßen. Die Bundesrepublik würde selbst dann immer noch zu viel CO2 ausstoßen.

Die Klimarebellen sind allerdings nicht allein mit ihrer Ratlosigkeit, sobald es konkret wird. Die klaffende Lücke zwischen Ist und Muss zeigt sich auch bei dem klimapolitischen Leitantrag, den die Grünen jetzt veröffentlicht haben. Das Papier ist radikaler als alles, was bisher von deutschen Parteien zu hören war – und bleibt dennoch eine Luftbuchung, weil es die entscheidenden Fragen meidet.

Die Grünen beginnen mit einer einfachen Rechnung, die vom Weltklimarat IPCC stammt: Deutschland darf ab 2020 nur noch 6.600 Millionen Tonnen CO2 ausstoßen, wenn verhindert werden soll, dass die Erdtemperatur um mehr als 2 Grad steigt. Diese Menge ist schnell verbraucht: Wenn wir ungebremst weiterleben wie bisher, haben wir das erlaubte CO2 bereits in neun Jahren in die Luft geblasen. Die Zeit wird also extrem knapp.

Die Grünen fordern daher, dass ab sofort flächendeckend ein CO2-Preis von 40 Euro pro Tonne gelten soll. 2021 soll er schon bei 60 Euro liegen und danach weiter steigen. Dieses Konzept ist zweifellos besser als die Groko-Beschlüsse, die ab 2021 nur 10 Euro vorsehen – was den Dieselpreis um ganze 3 Cent erhöhen würde. Ein SUV-Fahrer würde das gar nicht merken.

Doch auch der grüne Plan hat einen Haken: Die Einnahmen aus der CO2-Steuer verschwinden ja nicht. Das Geld wird nicht in einen tiefen Brunnen geworfen und vergammelt dort, sondern es bleibt im System. Die Bürger*innen müssten zwar tiefer ins Portemonnaie greifen, wenn sie Energie verbrauchen – aber ihr Geld landet dann beim Staat, der es wieder ausgeben und damit für neue Nachfrage und neue CO2-Emissionen sorgen würde. Es würde eine „Kreislaufwirtschaft“ entstehen, die mit einer ökologischen Postwachstumsökonomie fast nichts zu tun hat.

Der zentrale Denkfehler fällt zunächst gar nicht auf, weil das grüne Konzept sehr fair wäre: Es soll ein „Energiegeld“ für alle geben. Der Staat würde seine CO2-Einnahmen wieder an die Bürger*innen auszahlen – als eine Art Kopfpauschale. Jeder würde dieselbe Summe bekommen. Vor allem die Ärmeren hätten hinterher mehr Geld als vorher, denn sie verbrauchen besonders wenig Energie, würden aber genauso viel Energiegeld erhalten wie alle anderen.

Es ist längst überfällig, die Armen stärker zu unterstützen. Aber es ist auch abwegig, diese soziale Verbesserung als ökologische Revolution zu preisen. Denn zuvor einkommensschwache Menschen würden die Zusatzeinnahmen nutzen, um sich langgehegte Wünsche zu erfüllen. Sie würden auch mal in Urlaub fahren, auch ins Restaurant gehen, sich auch neue Kleider gönnen. Dieser Zusatzkonsum wäre nur verständlich und gerecht, aber kein Umweltschutzprogramm.

Die Grünen verwechseln also Betriebs- und Volkswirtschaft: Ein höherer CO2-Preis hätte zwar „Lenkungswirkung“ – aber nur beim einzelnen Produkt. Die Gesamtwirtschaft würde weiter in die Klimakatastrophe gesteuert. Autokäufer*innen würden Spritfresser zwar meiden und effiziente Fahrzeuge kaufen. Zunächst würden sie also Energie sparen – ihr Geld dann aber anderweitig ausgeben. Etwa für eine zusätzliche Flugreise nach Mallorca. Nach dem Motto: „Man gönnt sich ja sonst nichts.“

Flüge würden natürlich auch teurer, wenn der CO2-Preis steigt, aber die Bürger*innen hätten ja noch das Energiegeld, das sie verprassen könnten. In der Summe würden also vielleicht etwas weniger Klimagase emittiert, aber das Ziel ist bekanntlich ambitionierter: Schon in wenigen Jahren sollen wir gar kein CO2 mehr ausstoßen.

Die Grünen tappen in eine altbekannte Falle, die „Bumerangeffekt“ heißt: Dieses Paradox wurde bereits 1865 von dem britischen Ökonomen William Stanley Jevons beschrieben – und ist eine der wenigen Voraussagen über den Kapitalismus, die sich als richtig herausgestellt haben. Wer Energie oder Rohstoffe „spart“ und mit weniger Materialeinsatz die gleiche Gütermenge herstellt, der steigert in Wahrheit die Produktivität und ermöglicht damit wieder neues Wachstum.

Extinction Rebellion Berlin 2019-10-08 Stern blockade 4.jpg

In der Umweltpolitik hat es daher wenig Sinn, nur auf „Preise“ und „Marktmechanismen“ zu setzen. Man muss Ordnungspolitik betreiben, also Vorschriften und Verbote erlassen. Das wissen auch die Grünen. Sie fordern unter anderen ein Tempolimit von 130 auf der Autobahn und wollen Ölheizungen sofort untersagen. Diese Vorschläge klingen mutig, doch würden sie nicht einmal annähernd dazu führen, das Ziel der Nullemission bis zum Jahr 2025 zu erreichen

Quelle      :      TAZ           >>>>>          weiterlesen

—————————————————————–

Grafikquellen          :

Oben        —       Extinction Rebellion Berlin Climate Camp 2019-10-09

————————————-

Unten        :        Extinction Rebellion Berlin 2019-10-08 Stern blockade

Abgelegt unter APO, Berlin, International, Wirtschaftpolitik | Keine Kommentare »

Falsche Kritik verbreiten?

Erstellt von DL-Redaktion am 13. Oktober 2019

Deutsche Wohnen enteignen? Saugerne!

Quelle        :        untergrund-blättle   CH.

Von  Gruppen gegen Kapital und Nation

Falsche Kritik verbreiten? Bloss nicht! Steigende Mieten sind seit langen nicht nur in Berlin Thema; hier aber besonders stark.

Das Ausgangsniveau der Mieten war um 2004 relativ niedrig, so dass der Anstieg hinterher besonders drastisch war. Hatten zunächst die vielen Lebenskünstler*innen in Berlin ein hartes Problem, mussten sich zunehmend auch Lehrer*innen, Durchschnitts-Lohnarbeiter*innen und Durchschnitts-Rentner*innen die Frage stellen, ob man umziehen muss, weil man sich die Miete nicht mehr leisten kann und zunehmend ob man das überhaupt innerhalb von Berlin noch kann.

Die Entwicklung wurde begleitet von Mieter*innen-Protesten. Häuser- oder Wohnblöcke organisierten sich, Kiez-Initiativen wurden gegründet. Zu einer Bündelung dieser punktuellen Proteste kam es während einiger Kampagnen, die mit Volksbegehren bzw. Volksentscheiden verknüpft wurden. Das Volksbegehren Deutsche Wohnen & Co enteignen (im folgenden „DW-enteignen genannt) steht in dieser Tradition.[1]

Ziel des Volksbegehrens ist: Große Immobilienkapitale (mit mehr als 3000 Wohnungen in Berlin) zu enteignen und die Wohnungen in eine Anstalt des öffentlichen Rechts zu überführen, in denen Mietervertreter*innen über die Geschäftspolitik mitbestimmen. Das wird dann im Gegensatz zu einer bloßen Verstaatlichung, Vergesellschaftung genannt. Durch die Vergesellschaftung soll verhindert werden, dass bei einer wechselnden Politik, die neue Wohnungsgesellschaft einfach per Gesetz wieder auf Rendite getrimmt wird und schließlich privatisiert wird (wie sowas Ende der 1980er, in den 1990er und 2000er Jahren umfangreich geschehen ist).

Die Kampagne betritt juristisches Neuland, weil sie sich auf einen Grundgesetzartikel (Art. 15) bezieht, der in der Geschichte der BRD bislang gar nicht zur Anwendung kam.[2] Viele Debatten in der Öffentlichkeit beziehen sich auf die Frage, ob die Forderungen der Kampagne überhaupt verfassungsmäßig und finanziell realistisch seien. Und die Kampagnenorganisator*innen verwenden viel Energie darauf nachzuweisen: sie sei es. Wie „realistisch“, also in der heutigen politischen Wirklichkeit verwirklichungsfähig, das Ziel der Kampagne ist, können weder wir noch sonstwer zurzeit beurteilen. Langjährige Gerichtsverfahren werden erwartet.

Grundsätzlich ist es ja erst mal ein erfrischender Vorschlag, den Immobilienunternehmen das Recht zu nehmen, aus ihrem Eigentum so viel rauszuholen wie es eben nur geht, indem man sie enteignet. Selbst wenn das vielleicht nur dazu führt, dass der Mietpreis für die vergesellschafteten Mieter*innen dann bei „nur“ acht Euro pro qm liegt und nicht mehr;, selbst wenn das nur die Politik nötigen würde, mehr auf die Nöte vieler Mieter*innen einzugehen, um dieses „letzte Mittel“ (SPD-Bundesjustizministerin Lambrecht) der Vergesellschaftung bloß nicht anwenden zu müssen; dann wäre ja auch schon was gewonnen. Zumindest für die Leute, denen ihre Wohnungen ansonsten weggenommen oder unbezahlbar verteuert werden würden.

Zumindest für Teile des Kampagnenbündnisses, vielleicht aber auch für alle, ist schon was gewonnen, wenn unabhängig vom konkreten Erfolg, die Debatte über die Vergesellschaftung von Wohnraum mal losgeht. Hier gelinge eine gesellschaftliche Bewusstseinsbildung.[3]

Auch das stimmt! So sympathisch das Anliegen ist, so verkehrt aber sind die falschen, irreführenden und schädlichen Argumente, die dem breiten Publikum mit der Kampagne ins Bewusstsein gebracht werden sollen.

Die Mieten steigen rasant seit 2004, warum ist das so? Die eine weit verbreitete Antwort in der Öffentlichkeit ist: Zu wenig Wohnraum für zu viele Leute. Es kommen einfach mehr Menschen nach Berlin als abwandern. In der Konsequenz wird Neubau gefordert und gefördert. Für die CDU und die FDP eindeutig (bei den anderen Parteien teils auch) gilt daher: Unternehmen, die Wohnungen bauen wollen, sollen gefördert werden.

Gegen diese „Analyse“ und Konsequenz tritt DW-enteignen an. Mietsteigerungen sind zwar auch für sie oberflächlich betrachtet ein Phänomen von Angebot und Nachfrage am Markt. Aber: Das Angebot selber wäre mal konkreter in den Blick zu nehmen. Die Kampagnenmacher*innen stellen zu Recht fest: Wenn die neuen Wohnungen alle in der oberen Preisklasse angesiedelt sind, taugen sie als Bremse für die allgemeine Mietentwicklung nicht. Das Gegenteil scheint der Fall zu sein, wenn diese neuen, teuren Wohnungen in den Mietspiegel eingehen und dann eine Rückwirkung auf alle anderen Wohnungen haben, so dass auch da die Mieten ordentlich angezogen werden können. Und letztlich: Was nützen Kapitale, die auch mehr Wohnungen bauen, aber zugleich bestehende Wohnungen übernehmen, sie zu ihrem Geschäftsmittel machen und dafür sorgen, dass die Mieten dort ordentlich steigen?

Gegen das Projekt, sich die Angebotsseite einmal genauer anzuschauen, ist nichts einzuwenden. Ärgerlich ist, wie das innerhalb der Kampagne passiert. Wo sie „strukturelle“ Ursachen ausmacht, verfällt sie zugleich immer wieder in moralische Anfeindungen (gierig, unanständig und moralisch verdorben) und verwandelt ökonomische Gesetzmäßigkeiten des Kapitalismus somit in eine persönliche Einstellungssache der Akteure. Das gleiche geschieht bei ihrer Erklärung der staatlichen Wohnungspolitik. Das soll in diesem Text ausgeführt und kritisiert werden. Zuvor soll noch ein Mangel der Kampagne dargestellt werden, der exemplarisch für die gesamte gesellschaftliche Debatte über „bezahlbaren Wohnraum“ steht:

Das große Ziel: „Bezahlbarer Wohnraum“ oder „leistbare Mieten“

„Eine soziale Wohnungsversorgung in Großstädten wie Berlin setzt in der Fläche dauerhaft sozial gebundene Wohnungen zu leistbaren Mieten voraus. Wer auch Haushalten mit geringen Einkommen Wohnungen zur Verfügung stellen will, muss unterdurchschnittliche Mieten sicherstellen. Dieses Ziel ist mit privaten Wohnungsunternehmen mit Gewinnerzielungsabsicht nicht zu erreichen.“[4]

Die Messlatte von DW-enteignen ist die des „bezahlbaren Wohnraums“. Wie auch sonst in der gesellschaftlichen Debatte über das Thema Wohnraum, wird in der Kampagne die Frage, warum eigentlich wer wieviel Zahlungskraft zur Verfügung hat, konsequent ausgeblendet.

Auf die Unterschiede der Zahlungskraft wird zwar hingewiesen, aber immer nur als Aufzählung, nicht als Frage nach dem Grund der unterschiedlichen Lebenslagen. Es gibt Obdachlose, es gibt HartzIV-ler*innen, es gibt Lohnarbeiter*innen, die verdienen gar nicht mehr als Hartz IV, es gibt Durchschnittsverdiener*innen, es gibt Selbstständige, deren Einkommen sich gar nicht über das von Lohnarbeiter*innen erhebt, es gibt Lehrer*innen, die vor allem in Berlin nicht die Welt verdienen usw. Allen gemeinsam ist durchaus, dass die derzeitige Mietentwicklung ihnen das Leben sehr schwer macht. Auf der anderen Seite kennen die Kampagnenmacher*innen Luxusmieter*innen, z.B. Mieter*innen mit Zweit- und Drittwohnung. Und denen wollen sie (nicht in der Kampagne, aber an anderer Stelle) alle mal Sondersteuern aufbrummen, anstatt ihnen das Leben leichter zu machen.[5] »Der Mieter« ist also eine ganz schön abstrakte Figur.

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) die Auswüchse gegen Mieter in ihrer Gesamtheit keine tragischen Einzelfälle darstellen, sondern vielmehr Ausdruck eines strukturellen Problems einer rein profitorientierten Wohnraumbewirtschaftung sind.“[6]

Ob „Mieter“ Probleme haben oder nicht, liegt nicht nur an der Angebotsseite, sondern eben auch an seiner Zahlungskraft, die wiederum auf die Einkommensquellen verweisen. Daher mögen mittlerweile viele Mieter*innen in Berlin Angst wegen der Wohnungsmarktsituation haben, aber auf jeden Fall nicht alle.

Daher ist es auch absurd, wenn die Interventionistische Linke (als eine tragende Organisation der Kampagne DW-enteignen) davon redet, dass „Berlin“ Angst hat.

„Berlin hat Angst. Laut einer Umfrage befürchten 47% der Berliner*innen, in den nächsten Jahren wegen Mietsteigerungen ihre Wohnung zu verlieren. Die Angst ist begründet, denn insbesondere seit der Finanzkrise 2008 ist Berlin zur Beute geworden – aus aller Welt flüchten Kapital und Investoren ins ‚Betongold‘. Wurde deswegen anfangs noch gegen Hipster und Studierende geschimpft, so haben viele Menschen inzwischen begriffen, dass nicht andere Mieter*innen, sondern die Eigentümer*innen das Problem sind: Wohnraum als Ware, die Immobilie als Spekulation sind Quellen unserer Angst.“[7] (Das Rote Berlin, IL, S. 3.)

Dieser positive Bezug auf „Berlin“ erinnert mehr an die Werbung für die Berliner Eisbären („Du bist kein Berliner, wenn dich XY kalt lässt“) oder den Berliner Rundfunk 91,4 („Wir Berliner für unsere Stadt“), als an eine vernünftige Analyse. Diese angebliche vorstaatliche oder vorkommunale Gruppe «Wir Berliner*innen» gibt es erstens nicht. Und als Ansammlung von Leuten, die im Herrschaftsbereich Berlin leben, haben sie zweitens so gut wie keine gemeinsamen Interessen und Ängste, aber viele gegensätzliche. Keineswegs hat „Berlin“ Angst vor steigenden Mieten; Neben den Mieter*innen mit genug Kohle ist z.B. Eigenheimbesitzer*innen das alles vermutlich ziemlich wurscht oder sogar willkommen. Vermietende Grundeigentümer*innen haben vermutlich eher Angst vor dem Mietendeckel und möglicher Enteignung. Mit der Gegenüberstellung vom guten, angstgeschüttelten „Berlin“ zu den „aus aller Welt“ daherkommenden „Investoren“, wird auch indirekt ausgesagt: Am bestehenden Gemeinwesen „Berlin“ kann es eigentlich nicht liegen, wenn es Probleme gibt – die kommen von außen hereingeschneit.

Und das ist falsch. Die Probleme vieler Mieter*innen auf und mit dem Wohnungsmarkt sind die Folgen dessen, wie und wofür hierzulande gewirtschaftet wird, ganz egal welchen Erstwohnsitz oder Pass die „gierigen Profitjäger“ haben. Der Reichtum wird in dieser Gesellschaft – und eben auch in Berlin – nicht als gemeinsames Projekt, sondern in Konkurrenz produziert: Arbeiter*innen konkurrieren um Arbeitsplätze, kämpfen also gegeneinander darum, für Kapitalist*innen arbeiten zu dürfen. Kapitalist*innen konkurrieren gegeneinander um Marktanteile. Dafür ist der Preis ihrer Waren das entscheidende Mittel, und so strengen sie sich fortlaufend an, die Stückkosten billiger zu machen. Ein Weg dies zu erreichen, ist Lohndrückerei oder mehr Leistung und Überstunden durchzusetzen – also ein Kampf gegen die Arbeiter*innen. Ein weiterer Weg sind Rationalisierungen, mit denen die Kapitalist*innen die Arbeiter*innen außer Lohn und Brot setzen. Und darum ist es auch kein Wunder, dass die steigenden Mieten nicht einfach durch Lohn- oder Rentenerhöhungen abgefangen werden. Darum müssen Lohnarbeiter*innen ja fürchten, dass die Grund- und Immobilienbesitzer*innen ihnen mit immer höheren Mietforderungen das Leben schwermachen.

Dass also es überhaupt zuwenig guten und bezahlbaren Wohnraum in den meisten Metropolen gibt, ist die Konsequenz dessen, dass die Lohnarbeiter*innen so in die kapitalistische Gesellschaft eingebaut sind, dass sie von zwei Seiten mit den Ansprüchen des Kapitals zu kämpfen haben: Auf der einen Seite die Kapitale, die die Lohnarbeits-Leistung für Gewinnzwecke benutzen wollen, was eine magere Einkommensquelle ergibt (wenn die Kapitale Lohnarbeiter*innen dann gleich gar nicht mehr benutzen wollen, sieht es noch schlechter aus, wenn man als Lohnarbeiter*in ohne Lohn da steht). Auf der anderen Seite kommen dann die Kapitale, die aus der Wohnbereitstellung ihren Profit ziehen wollen.[8]

Fazit und der erste zentrale Fehler der Kampagne: »Der Mieter« hat kein Problem mit der Wohnungssituation. Es sind Lohnarbeiter*innen oder ähnliche Figuren, die Probleme damit haben. Indem die Kampagne, die Gründe für die prekären Einkommenslagen nicht angeht, sondern die Lagen nur herbeizitiert, setzt sie sich für die armen Leute in der Gesellschaft nur so ein, dass sie die als dauerhaft arme Leute unterstellt und ihnen das Leben in der dauerhaften Armut leichter machen will.

Das Immobilienkapital

Auf der Kampagnen-Seite https://dwenteignen.de gibt es eine Extra-Rubrik „Warum enteignen?“. Dort gibt es unter der Einleitung „Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…)“ eine Auflistung von Gründen:

File:20190424105DR Dresden-Mitte ABB-Hochhaus Könneritzstraße 25.jpg

„Deutsche Wohnen die Häuser vergammeln lässt, keine ausreichende Instandhaltung betreibt (siehe ständige, tagelange Heizungsausfälle im Winter), um sie dann teuer zu modernisieren und die Bestandsmieter zu vertreiben.“[9]

„Die Auswüchse gegen Mieter in ihrer Gesamtheit keine tragischen Einzelfälle darstellen, sondern vielmehr Ausdruck eines strukturellen Problems einer rein profitorientierten Wohnraumbewirtschaftung sind. Dabei nehmen die führenden Immobilienunternehmen aufgrund ihrer Größe eine marktbeherrschende Sonderstellung ein. Sie sind einerseits aufgrund ihrer Größe in der Lage, die Entwicklung der Mieten und auch der Mietgesetzgebung zu beeinflussen (siehe Angriffe auf den Mietspiegel) und sind andererseits aufgrund ihrer wirtschaftlichen Ausrichtung im Besonderen für Preissteigerungen auf dem Wohnungsmarkt verantwortlich.“[10]

Hier wird halbwegs nüchtern darauf hingewiesen, dass die Konzerne Gewinne machen wollen und die Mietwohnungen dafür ihr Mittel sind. Nüchtern wird auch die Konsequenz dargestellt: Es folgt ein Interesse an Mietsteigerungen. Ein Mittel diese Mietsteigerungen durchzusetzen ist nach dem deutschen Mietrecht eine Modernisierung. Die Instandhaltung der Wohnung beschert dagegen erstmal vor allem Kosten, die es für den Gewinn zu vermeiden gilt. Soweit gilt das noch für alle Hauseigentümer*innen, die die Wohnungen als Einkommensquelle benutzen. Die Konzerne – so wird weiter analysiert – haben aufgrund ihrer Größe zudem die ökonomische Macht eine Mietentwicklung in einem ganzen Bezirk, wenn nicht sogar in einer ganzen Stadt zu beeinflussen. Wenn sie ganze Straßenzüge modernisieren und die Mieten anheben, dann tragen sie selbst zur Steigerung des Mietspiegels bei und können dann auch an dieser gesetzlich erlaubten Ecke die Mieten alle drei Jahre weiter anheben.

„Wer auch Haushalten mit geringen Einkommen anständige Wohnungen zur Verfügung stellen will, muss unterdurchschnittliche Mieten sicherstellen. Dieses Ziel ist mit privaten Bauträgern und privaten Wohnungsunternehmen mit Gewinnerzielungsabsicht, die eine mindestens durchschnittliche Verzinsung des eingesetzten Eigenkapitals erwarten, nicht zu realisieren.“[11]

Dass die großen Immobilienkonzerne als Aktiengesellschaften Teil des Finanzkapitals sind und was das bedeutet, wird in der Kampagne nicht gut entwickelt. Man könnte hier aber anknüpfen und weitere Aufklärungsarbeit leisten:

Die eben beschriebene ökonomische Macht der Konzerne beruht auf ihrer üppig vorhandenen Geldmacht, die andere Hausbesitzer*innen so erstmal nicht haben. Diese Geldmacht speist sich bei den Immobilienkonzernen nicht einfach aus vergangenen, eigenen Gewinnen, sondern aus der Benutzung des Kreditsektors. Der funktionierende Kapitalismus entwickelt eine Bankenlandschaft, die alles gerade nicht anderweitig benutzte Geld der Gesellschaft einsammelt und zur Grundlage ihrer Kreditvergabe macht.

Damit erlaubt der Kreditsektor eine Umkehrung für die kreditnehmenden Unternehmen: Die Geschäftserweiterung wird nicht mit vergangenen Gewinnen gemacht, sondern neue Gewinnsphären werden mit Kredit erschlossen, die dann erhöhte Gewinne einbringen. Der Zins ist dann der vorab festgelegte Mindestmaßstab für die Unternehmung. Dass das vorhandene Privateigentum von Unternehmen für manche Unternehmungen zu klein ist, wird durch den Kreditsektor zwar nicht außer Kraft gesetzt, aber deutlich entschränkt. Das passiert im erweiterten Maßstab bei den Aktiengesellschaften, die Gesellschaftsform in der die großen Immobilien-Konzerne organisiert sind.[12]

Diese Analyse taucht in der Kampagne oder auch in der Broschüre der Interventionistischen Linken „Das Rote Berlin“ punktuell auf. Das stimmt alles und soweit wäre die Kampagne ein guter Beitrag zur Bewusstseinsbildung, die hilfreich für konkrete Abwehrkämpfe als auch längerfristige gesellschaftliche Veränderungen wären. Das Kapital ist kein Sozialpartner, sondern die entscheidende wirtschaftliche Rechnung und Macht, der das gesellschaftliche Leben unterworfen ist. Das tut Lohnarbeiter*innen nicht gut, sie haben einen Interessengegensatz mit dem Kapital und sie haben einen guten Grund sich das Kapital vom Hals zu schaffen. Leider belässt es die Kampagne nicht dabei in dieser Art und Weise aufzuklären. Während sie einerseits auf die Interessengegensätze hinweist, trägt sie daneben oder dabei das Ideal einer moralisch anständigen Gemeinschaft vor sich her und in diesem Lichte sind die Immobilienkonzerne nicht einfach ein Gegner, sondern unanständig, moralisch verdorben, gierig usw.:

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Es notwendig ist, eine Grenze zu ziehen. Wie lange wollen wir zusehen, dass unsere Stadt zur Beute einiger gieriger Profitjäger wird? Ja, es muss auch ein Exempel statuiert werden, damit die weiterhin nach Berlin strömenden ‚Investoren‘ abgeschreckt werden.“[13]

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Der §559 BGB (Modernisierungsumlage) von großen Konzernen gezielt missbraucht wird, um die Mieteinnahmen zu steigern. Die Energieeinsparung und somit der umweltbezogene Nutzen dieser Maßnahmen wird von vielen Baufachleuten angezweifelt.“[14]

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Die Großkonzerne das Land Berlin und somit die Berliner*innen durch sogenannte ,share dealsʻ nach Schätzungen um einen dreistelligen Millionenbetrag hintergangen haben. Diese Einsparung der Grunderwerbssteuer ist zwar legal (wer macht solche Gesetze?), jedoch nicht legitim.“[15]

,Es reichtʼ, sagt Rouzbeh Taheri, Sprecher der Initiative. ,Wenn die Mieter in dieser Stadt keine Angst mehr haben sollen, dann müssen große Wohnungskonzerne raus aus der Stadt.ʼ Denn deren Geschäftsstrategie basiere ,auf Spekulation, auf ständigen Mieterhöhungen und auf Ausnutzung aller gesetzlichen Tricksʼ“[16]

Die Unternehmen wollen nicht einfach Gewinn machen, so gut es eben geht, sie sind vielmehr „gierige Profitjäger“. Mit dieser Charakterisierung wird unter der Hand gesagt, dass es ja so nicht sein müsse. «Maßvolles Gewinnstreben» wird so als o.k. und vorbildlich eingeführt und sogar als das eher Normale vorstellig gemacht – schließlich sind es nur „einige“, die „Beute“ machen und „Profitjäger sind“.

Die Unternehmen benutzen die Gesetze nicht, wie alle anderen auch, so gut es geht für die eigenen Zwecke, sie nutzen sie aus; Gesetze werden nicht gebraucht, sondern missbraucht – unverschämt! Zwar ist das alles juristisch einwandfrei, sei aber nicht legitim. Ein anständiger Bürger zahle dagegen brav seine Steuern, damit der Staat gut finanziert ist und für die Allgemeinheit was Gutes tun kann.

Mit dieser moralischen Beurteilung des Treibens der Immobilienkonzerne nimmt die Kampagne das Urteil „hier herrscht ein Gegensatz und zwar systematisch“ zurück. Es müsste gar nicht so sein, wie es ist, wenn die Kapitalist*innen sich auf einen maßvollen, nützlichen Gewinn beschränken würden. Statt einer für Lohnarbeiter*innen schädlichen ökonomischen Systematik, bleibt eine für alle schädliche moralische Einstellung der Konzernleitung übrig.

Oben wurde bereits angedeutet, dass die Kampagne es verpasst, das Finanzkapital als Vollendung der kapitalistischen Logik darzustellen. Im Lichte der moralischen Vorwürfe, muss man die Kritik genauer fassen: Die Kampagne begreift die Logik des Profits schlicht nicht als maßlos.[17] Sie will maßvollen und maßlosen Gewinn unterscheiden. Die Kampagne begreift die Logik des Finanzkapitals nicht als Verlängerung der üblichen Profitrechnung, sondern als das ganz Andere. Das Finanzkapital ist maßlos, die normalen Kapitalist*innen dagegen nicht. Das Unterscheidungskriterium von maßvoll und maßlos, gewinnt die Kampagne nicht aus der Analyse der ökonomischen Rechnung, sondern aus der Wirkung im Lichte der moralischen Kategorie des „Allgemeinwohls“. Damit steht sie in der schlechten Tradition linker »Kapitalismuskritik«, die das schmarotzende Kapital von dem der Allgemeinheit dienstbaren Kapital unterscheiden will.

So passen dann die „strukturellen“ Erklärungen mit dem Moralismus zusammen: Die Hinweise auf die Systematik oder Struktur der mietsteigernden Wirkung der Gewinnrechnung unterstreichen in der Kampagne nur die konsequente Bösartigkeit der Figuren, die das Immobilienkapital auszeichnen. Mit diesem Moralismus agitiert die Kampagne auf einem Plakat zum Mitmachen:

„Die Deutsche Wohnen schadet nicht nur ihren Mieter*innen, sondern längst dem Allgemeinwohl.“[18]

Das ist ein sehr interessanter Hinweis. Dass die Deutsche Wohnen ihren Mieter*innen nicht guttut, scheint als Grund, der Deutschen Wohnen etwas entgegen zu setzen, nicht auszureichen. Da wird jetzt auch noch das Allgemeinwohl geschädigt. Damit befinden sich die Kampagnenmacher*innen in bester Gesellschaft mit der herrschenden staatlichen Politik. Die beansprucht gerade im Gegensatz zu den privaten Einzelinteressen in der Gesellschaft das Allgemeine zu vertreten und zu fördern. Und die Politik wird auch nicht müde die Bürger*innen darauf hinzuweisen, dass das Allgemeinwohl nicht das Wohl Aller ist. Zu Recht. Wenn die privaten Einzelinteressen miteinander harmonieren würden, dann bräuchte diese Gesellschaft auch keine politische Instanz, die gerade getrennt von den Konkurrenzinteressen, die allgemeinen Grundlagen für die Konkurrent*innen stiftet.

Wenn aber die Einzelinteressen sich ständig in die Haare kriegen (und das liegt ja gerade an der Art und Weise, wie die Ökonomie hier läuft), dann ist das allgemeine Wohl auch nur der Umstand, dass alle irgendwie ihren Dienst in der kapitalistischen Gesellschaft machen können und der Staat, der das organisiert, handlungsfähig ist. Die Politik wetteifert dann um das beste Konzept, einerseits das Wirtschaftswachstum zu steigern (damit darüber der Staat via Steuern und Staatskredit handlungsfähiger wird) und auf der anderen Seite dabei drauf zu achten, dass die Bedingungen des Kapitalismus (Arbeiter*innen und Umwelt) nicht völlig ruiniert werden. Das ist der laufenden Widerspruch bürgerlicher Politik und alle Parteien präsentieren ihr Konzept als das Beste. Alle Parteien treten dabei irgendwelchen gesellschaftlichen Gruppen auf die Füße. Und alle Parteien wollen Bürger*innen, die das Treiben der Politik als Dienst an einer vorgeblich staatlichen Gemeinschaft gewürdigt wissen – der Allgemeinheit, dem «Wir», der Stadt.

Richtig wäre es zu sagen: Dieses Allgemeinwohl lehne ich ab. Die Gesellschaft ist keine Gemeinschaft. Ich weiß, dass ich als Lohnarbeiter*in das Material bin, den Staat und die Unternehmen stark zu machen (die Unternehmen heißen ja in der bürgerlichen Gesellschaft gleich «die Wirtschaft»). Und die moralische Verpflichtung auf das Allgemeinwohl soll mich geistig verpflichten, zu meiner armen, dienstbaren Rolle «Ja» zu sagen.

Die Kampagne geht den entgegengesetzten Weg: Sie agitieren ihre potentiellen Mitstreiter*innen mit der Aussage: Wenn du Probleme hast, dann zählt das nicht viel. Aber wenn das Allgemeine beschädigt wird, dann hast du ein Recht, echt unzufrieden zu sein. Und wo der Staat will, dass sich die Menschen über die er herrscht, sich mit ihm identifizieren, weil es sich so leichter regieren lässt, fördert die Kampagne explizit diese Identifizierung:

„Es gibt viele Gründe für die Enteignung von Deutsche Wohnen & Co [.] Eine Vergesellschaftung ist notwendig, weil: (…) Die überwiegende Mehrzahl der Wohnungen im Besitz der Deutsche Wohnen früher städtisch waren: GSW und GEHAG. Wir wollen einfach unsere Häuser zurück.“[20]

Städtisch = Unser! Das ist faktisch falsch und als politische Haltung schlecht.

Fazit und der zweite zentrale Fehler der Kampagne ist die moralistische Betrachtung des Immobilienkapital. Einerseits abgebrüht: Die wollen halt Gewinn machen. Dann aber laufend: Gesetze ausnutzen, Profitgier usw. Mit dem positiven Bezug auf das Allgemeinwohl agitiert die Kampagne im Feld der Moral dann für den positiven Bezug auf die Politik. Das setzt sich fort im folgenden dritten Fehler der Kampagne:

Der Staat, die Stadt, die Kommune

„Wir brauchen eine groß angelegte Kommunalisierung beim Wohnungsbau und bei der Bereitstellung von Wohnungen, weil nur diese langfristig und auch in angespannten Situationen eine soziale Versorgung mit Wohnungen sicherstellen kann.“[21]

Vom Markt erwartet sich die Kampagne in Sachen billigen Wohnraum zu Recht nichts. Für die Kampagne ist dann die Kommune die Instanz, die dafür Sorge tragen soll. Die Politik ist gefragt. Eine bloße Enteignung der großen Wohnungskonzerne und die Überführung des Eigentums in die öffentliche Hand, reicht der Kampagne aber nicht. Sie haben nicht vergessen, dass viele Wohnungen der Immobilienkonzerne über den Weg der Privatisierung gerade aus den Beständen der öffentlichen Hand herkommen. Und die Wohnungsgesellschaften, die in der Hand des Senates sind, haben sich in Sachen Mietsteigerungen auch gründlich hervorgetan. Die Kampagne schließt daraus, dass „Mehr als Verstaatlichung“[22] her muss. Sie fordern eine Vergesellschaftung:

„Bisher ist das Staatseigentum in Berlin schlecht verwaltet worden: Mietsteigerungen zur Haushaltssanierung und die Privatisierung Zehntausender landeseigener Wohnungen sind die Ursachen der heutigen Wohnungskrise. Ohne die Privatisierungen durch schwarz-rote und rot-rote Koalitionen im Berliner Senat gäbe es Immobilienriesen wie die Deutsche Wohnen gar nicht. Weiterhin haben die landeseigenen Wohnungsgesellschaften Berlins private Rechtsformen wie die GmbH oder die Aktiengesellschaft. Ihre Politik hat sich auf Druck langjähriger Proteste langsam geändert – aber ihre Bücher sind den Bürgern verschlossen, Mieter*innenmitbestimmung findet faktisch nicht statt.

Ein Verkauf der Bestände ist jederzeit möglich, wenn sich politische Mehrheiten ändern. Wohl auch deshalb haben viele Berliner*innen Bauchschmerzen, wenn aktuell die Schulgebäude Berlins der landeseigenen HOWOGE GmbH überschrieben werden. Die von der Initiative ,Deutsche Wohnen & Co enteignenʻ angestrebte Vergesellschaftung geht daher einen anderen Weg. Erstmals soll das im Artikel 15 des Grundgesetzes erwähnte ,Gemeingutʻ mit Leben gefüllt werden. Gemeingut bedeutet, dass es der neuen Anstalt öffentlichen Rechts verboten wäre, Wohnungen zu privatisieren oder Profite auszuschütten – ihr Auftrag wäre allein die Versorgung Berlins mit bezahlbarem Wohnraum. Die AöR müsste alle Gewinne aus der Vermietung in Instandhaltung, Sanierung und Neubau bzw. Ankauf investieren. Sonst wäre das im Grundgesetz geforderte Kriterium eines Gemeingutes nicht erfüllt. Die Anstalt öffentlichen Rechts steht daher nicht in Konkurrenz zum Neubau, ganz im Gegenteil – ihre Gewinne würden den Neubau vorantreiben.“[23]

Per Volksbegehren bzw. Volksentscheid soll der Senat ein Gesetz erlassen, mit dem er die großen Immobilienkapitale enteignet und in sein Eigentum übergehen lässt. Das Eigentum soll zugleich eine besondere Rechtsform bekommen (Anstalt des öffentlichen Rechts), in der festgezurrt ist, dass der Zweck der Gesellschaft die Versorgung mit bezahlbaren Wohnraum sein soll und eine (erneute) Privatisierung ausgeschlossen wird. Das Misstrauen in die Politik soll weiter durch eine Mitbestimmung von Mietervertreter*innen bei der Geschäftspolitik Rechnung getragen werden.

In Hinsicht auf die Immobilienunternehmen lässt sich die Kampagne nichts vormachen – die taugen nichts. Hier gibt sich die Kampagne immerhin Mühe an einigen Stellen zu erklären, wie die Logik der Unternehmen funktioniert und ist sich sicher, dass die Logik notwendig „leistbare Mieten“ ausschließt.

In Hinsicht auf den Staat oder den Senat ist die Kampagne nicht so streng. Einerseits taugt die Politik auch nichts, die Politik will sie aber nicht aus der Stadt verjagen. Sie will sie benutzen und zugleich verpflichten. Sie soll das Instrument für die Beseitigung der Existenzangst an der Wohnungsfront sein. Der Grund dafür liegt in den Erklärungen der staatlichen Wohnungspolitik seitens der Kampagnenmacher*innen – und diese sollen hier auch deshalb diskutiert werden, weil es den Kampagnenmacher*innen ja neben dem konkreten, politisch aber schwierigen und langwierigen Projekt des Volksbegehrens um die Bewusstseinsbildung geht:

Warum ist dem Staat oder der Politik zu misstrauen? Eigentlich gibt die Kampagne nur empirische Hinweise. Sie verweist auf die vergangenen Jahrzehnte von Bundes- und Berlinpolitik, vergleicht die Politik mit ihrem Maßstab „bezahlbare Mieten“ und sagt: Das war Mist. Das Staatseigentum ist „schlecht verwaltet worden“ (das kann man also besser machen!). „Strukturelle“ Gründe, warum der Staat selber das Immobilienkapital unterstützt, die eigenen öffentlichen Wohnungsbaugesellschaften auf Gewinn verpflichtet hat und in den Fällen, wo das gelungen ist, sie dann privatisiert hat, finden sich auf der Kampagnen-Seite gar nicht.[24]

Man muss dann schon auf Papiere der beteiligten Organisationen oder Interviews der Kampagnenmacher*innen zurückgreifen, und da wird man dann schon fündig:

Der neoliberale Staat

„Das BImA-Errichtungsgesetz[25] von 2004, geschrieben von der rot-grünen Schröder-Regierung, sieht eine Verwaltung ,nach kaufmännischen Grundsätzenʻ vor mit dem Ziel, ,nicht betriebsnotwendiges Vermögen wirtschaftlich zu veräußernʻ. Die BImA funktioniert somit nach der Logik des neoliberalen Staates, der öffentliches Eigentum auch da abbaut, wo es rentabel ist. So werden die Staatseinnahmen geschmälert und neue Sparzwänge aufgebaut. Privatisierung spart kein Geld, sie kostet Geld und ist eine reine Herrschaftstechnik. Sie verwandelt nicht nur öffentliches Eigentum in privates Kapital, sondern beschränkt auch den Raum demokratischer Politik. Über die Verwendung von Privateigentum wird nicht diskutiert, sie unterliegt allein den Mechanismen des Kapitals. Wohnungspolitik wird so strukturell unmöglich gemacht. Jede privatisierte Wohnung schwächt politisches Handeln und stärkt kapitalistisches Privileg.“[26]

Wenn eine rot-grüne Regierung ein politisches Programm radikal durchzieht, was die vorherige christdemokratische Regierung unter Helmut Kohl nur häppchenweise angegangen ist: nämlich eine gründliche Reformierung des Lohnes und des Sozialwesens, eine Stärkung des Finanzplatz Deutschland und eine auf Signale an die Finanzmärkte bedachte Haushaltspolitik (alles Agenda 2010); das alles zum Zwecke der Stärke Deutschland in der internationalen Standortkonkurrenz, dann entdeckt die IL nur eine Schwächung des politischen Handelns. Schröders Credo war, dass man als Staat in der Globalisierung entweder Hammer oder Amboss ist und hat sich mit seinen Regierungsparteien dazu entschieden, dass Deutschland ein Hammer werden soll. Und dieser Hammer hat in einem bürgerlichen Staat nun mal seine Substanz in dem privaten Wirtschaftsleben, über das der Staat gebietet.

Das bringt ihm Steuereinnahmen, das verschafft Kreditwürdigkeit und ein starker Finanzplatz ist letztlich für eine Währung, die Weltgeld sein soll, unverzichtbar. Mit einem erfolgreichen privaten Geschäftsleben, über das der Staat gebietet, kann er Druck auf andere Staaten ausüben, sei es zum Zwecke einer vorteilhaften Hierarchie in der EU, sei es zum Eingemeinden neuer Staaten in die EU (und Herausbrechen aus der russischen Einflusssphäre), sei es zum Zwecke der Abwehr von Flüchtlingen, wenn afrikanische Staaten das für die EU übernehmen sollen. Wo Regierungen (Kohl, Schröder und Merkel, die Schröders Erbe verwaltet und hie und da eine Übertreibung korrigiert) deutlich machen, dass ein handlungsfähiger Staat eine florierende Privatwirtschaft braucht und die Armut von vielen Menschen geradezu die Bedingung dafür ist, da entdeckt die IL nur eine Logik des Neoliberalismus. Diese Logik hat für die IL staatlicherseits keinen Sinn, außer: sie fördert Privilegien der Kapitalisten, die doch einfach nur schädlich für die Allgemeinheit seien.

Mit ihrem Ideal von bürgerlicher Politik geht die IL agitieren, denkt sich in lauter Staatsnotwendigkeiten rein und präsentiert ihre »realistische Alternativen« und versöhnt damit am laufenden Meter die betroffenen Menschen mit der Politik. Und dann wieder nicht, wenn es um die Erklärung der doch offensichtlich unsinnigen Politik geht:

Korruption

„Die SPD ist, gerade in Berlin, eng mit den großen Playern der Immobilienwirtschaft verbunden. So kam 2014 heraus, dass der Berliner Baulöwe Klaus Groth gestückelte Spenden an die SPD getätigt hat, auch an den Kreisverband des damals zuständigen SPD-Bausenators Andreas Geisel. ,Kooperative Strategieʻ hört sich schön an, bedeutete aber in der Vergangenheit, dass der SPD die Interessen der Immobilienwirtschaft wichtiger waren als die Bedürfnisse der Mieterinnen und Mieter.“[27]

„Die Privatisierung der GEHAG war durch die Große Koalition in Berlin bereits im Jahr 1998 erfolgt. Der zuständige Bausenator war damals übrigens ein gewisser Jürgen Klemann (CDU). Funfact: Etwa ein Jahr später wurde er Chef der von ihm mitprivatisierten GEHAG. (…) Aber niemandem käme in den Sinn, hierfür das Wort Korruption zu verwenden (lacht).“[28]

Mit Bezug auf Korruptionsfälle im alten West-Berlin:

„Das Bauen war Instrument lokaler Wirtschaftsförderung, da Berlin als Inselstadt ohne öffentliche Subventionen ökonomisch kaum überlebensfähig war. Realistische Abschätzungen von Kosten und Bedarf waren geradezu unerwünscht, Risiken wurden mit Bürgschaften des Senats abgefedert, die Profite durch private Bauträger erwirtschaftet. Jüngere Skandale wie etwa der seit Jahren stillstehende Hauptstadtflughafen BER weisen ein ähnliches Profil auf: unrealistische Bedarfsplanung, Bevorzugung lokaler Unternehmen mit dem Argument der Wirtschaftsförderung, Haftung des Landes bei mangelnder oder völlig fehlender Kostentransparenz.“[29]

„Unsere Vorstellung für eine sozialistische Wohnungspolitik in einem ‚Roten Berlin‘ beginnt mit der Kritik des Immobilienmarktes und des privaten Wohnungseigentums. Wohnungspolitik in (West-)Berlin und der BRD wollte diesen Markt durch öffentliches Eigentum ergänzen, meist auch private Investitionen durch öffentliches Geld locken. Insbesondere Letzteres hat in Berlin zur Herausbildung eines korrupten Filzes aus Bauwirtschaft und Politik geführt.“[30]

Der Sprecher der Kampagne und die IL verweisen bei der »Erklärung« der stattgefundenen Politik auf Korruptionsfälle und Filz. Damit erklären sie sich, warum Politiker*innen Sachen machen, die in ihren Augen politisch völlig unverständlich sind. Dass es Korruption gibt und warum es das gerade in der Bauwirtschaft häufig gibt, stimmt und wäre gesondert zu erklären. Dass aber die bloße Bestechung der Grund dafür sei, warum die Politik die Immobilienkapitale, die Bauwirtschaft oder einzelne Unternehmen davon fördert, ist zu bezweifeln. Warum nicht die wirtschaftspolitischen Spekulationen der Politik einmal ernst nehmen und den Gehalt davon erklären?

  • dass das politische Projekt „Wirtschaftswachstum fördern“ den dabei erfolgreichen Staat (oder die Stadt) durchaus handlungsfähig macht;
  • dass diese Wirtschaftspolitik notwendig eine Spekulation auf zukünftigen Erfolg seitens der Kommunen darstellt und Staaten und Städte sich dabei wechselseitig Konkurrenz machen;
  • dass daher diese Spekulation auch mal danebengehen kann, wie sich im Berliner Bankenskandal gezeigt hat;
  • dass diese Spekulation auch Erfolg haben kann, wie sich in Berlin ab 2004 gezeigt hat;
  • aber egal, ob der Staat oder die Stadt erfolgreich ist oder nicht, in jeden Fall eine Armut für viele Leute eingepreist ist.[31]

Dann käme man nämlich bei einem nüchternen, negativen Urteil über bürgerliche Politik raus und müsste nicht die moralische Integrität der Politiker*innen bemühen. Die spielt nämlich dann umgekehrt bei den positiven Beispielen eine Rolle, wenn „glaubwürdige“ Politiker*innen unterstützt werden sollen:

„Außerparlamentarisch bedeutet: Wir sind nicht an Koalitionsverträge gebunden und unterliegen keinem Fraktionszwang. Wenn Einzelne, wie im Gefolge des Mietenvolksentscheid geschehen, öffentliche Ämter annehmen, müssen sie in eine andere Rolle wechseln. Dies bedeutet nicht das Ende jeder Solidarität, wie die Solidaritätskampagne für Andrej Holm 2017 gezeigt hat. Auch nach seinem Wechsel aus Wissenschaft und Aktivismus auf einen Staatsekretärsposten verteidigte ihn die Bewegung. Sozialer Druck bedeutet auch, dass glaubwürdige politische Persönlichkeiten gegen Angriffe des Immobilienkapitals verteidigt werden. Ebenso müssen sinnvolle Ziele des Rot-Rot-Grünen Berliner Koalitionsvertrages immer wieder eingefordert werden. Die meisten dieser Ziele stimmen ohnehin eins zu eins mit langjährigen Forderungen der stadtpolitischen Bewegung überein.“[32]

Das ist schon ein starkes Stück. Am Koalitionsvertrag unterscheidet sich kaum etwas von den Kampagnenmacher*innen? Es ist nur eine Frage der glaubwürdigen Umsetzung? Nur dafür braucht es die außerparlamentarische Opposition, damit Politiker*innen auch machen, was sie sich vorgenommen haben? Und verteidigen musste man Holm nur gegen das Immobilienkapital, nicht etwa gegen alternative politische Konzepte der Herrschaftsausübung etwa seitens der CDU/FDP/SPD/Grüne/Die Linke in Berlin? So kommt raus: Macht macht Leute irgendwie korrupt, bringt sie von ihren Zielen ab – daher muss man sie ständig unter Druck setzen. Was ist aber, wenn es andersherum ist und die Tatsache, dass jemand es vernünftig findet, bestimmte Anliegen mit Hilfe staatlicher Macht durchzusetzen, diese Anliegen einfach modifiziert? Dass, wer den Staat für welche Anliegen auch immer benutzen will, sich dann auch um die Handlungsfähigkeit des Staates kümmern muss und dann auf den sozialdemokratischen Sinnspruch bezüglich des Kapitals kommt: Wer die Kuh melken will, darf sie nicht schlachten. Und daher müsse man als verantwortlicher Sozialpolitiker immer zugleich wirtschaftspolitisch denken.

Fazit und der dritte zentrale Fehler der Kampagne: Eine Erklärung der Politik, die davon geleitet ist, dass sich viel von ihr erwartet wird, gleitet in lauter Fehler ab, so dass sie letztlich da landet, womit Politiker*innen immer Werbung für sich machen: alles eine Frage von Ehrlichkeit und Glaubwürdigkeit der Person.

So endet also eine Kampagne, die angetreten ist, Leute davon zu überzeugen, sich gegen die Zumutungen des Mietmarktes auch mal politisch zu wehren und dabei das Eigentum nicht als unantastbares Heiligtum anzuerkennen, dabei, ein recht vertrauensseliges Misstrauen in die Politik und eine Prise alternativen Patriotismus zu verbreiten. Dem konkreten Anliegen der Kampagne, die DW & andere zu enteignen, ist aller Erfolg zu wünschen. Ihren Analysen und Argumenten hingegen nicht

Fussnoten:

[1] Ein Volksbegehren in Berlin verläuft immer in drei Stufen: Zunächst muss die Initiative genügend Unterstützer*innen finden, um dieses Volksbegehren zu beantragen. In dieser ersten Stufe sind 20.000 Unterschriften der wahlberechtigten Berliner notwendig. Die Initiative hätte sechs Monate Zeit gehabt, diese Zahl zu erreichen. Die Unterschriftenaktion startete am Samstag, 6. April 2019 und ist am 14. Juni abgeschlossen worden. Die 77.000 Unterschriften wurden von den Behörden geprüft, es sind genügend Gültige vorhanden. Geprüft wird derzeit noch (Stand 21.09.2019), ob das Volksbegehren mit höherrangigem Recht vereinbar wäre. Ist der Antrag auf Einleitung des Volksbegehrens zulässig, teilt der Senat dem Abgeordnetenhaus seinen Standpunkt zu dem Volksbegehren mit. Sodann muss die Trägerin vier Monate abwarten, ob das Abgeordnetenhaus das Begehren in seinem wesentlichen Bestand übernimmt. Will das Abgeordnetenhaus das Anliegen nicht einfach selber umsetzen, folgt die zweite Stufe – das Volksbegehren. Sieben Prozent der wahlberechtigten Berliner*innen ab 16 Jahren müssen diesem zustimmen. Das sind derzeit etwas mehr als 170.000 Personen. Vier Monate ist dafür Zeit. Ist das Volksbegehren erfolgreich, kommt es zum Volksentscheid. Er ist dann erfolgreich, wenn 50 Prozent der Abstimmenden und mehr als 25 Prozent der Wahlberechtigten zustimmen.

[2] Übliche Enteignungen etwa für den Bau einer Autobahn berufen sich auf den Artikel 14. Dort geht es um „Enteignung (…) zum Wohle der Allgemeinheit (..)“. In Art. 15 heißt es: „Grund und Boden, Naturschätze und Produktionsmittel können zum Zwecke der Vergesellschaftung durch ein Gesetz, das Art und Ausmaß der Entschädigung regelt, in Gemeineigentum oder in andere Formen der Gemeinwirtschaft überführt werden. Für die Entschädigung gilt Artikel 14 Abs. 3 Satz 3 und 4 entsprechend.“

[3] So die Interventionistische Linke (IL): „Unsere erste Aufgabe muss sein, einen nicht-kapitalistischen Wohnungsmarkt denkbar zu machen. Einige Schritte dazu sind bereits getan. So hat eine neue Generation von Mieter*innenprotesten in den letzten zehn Jahren den neoliberalen Ausverkauf unserer Stadt angeprangert und an vielen Stellen ausgebremst. Neue Privatisierungen wurden verhindert, Großprojekte von Investoren gestoppt. Außerdem gibt es neuen Aufbau öffentlichen Eigentums. Doch dies ist noch nicht die Wohnungswende. Unser erstes Ziel muss es daher sein, Bewusstsein zu schaffen, dass nur die Vergesellschaftung des Wohnungsmarktes den Namen ‚Wohnungswende‘ wirklich verdient.“ Broschüre „Das Rote Berlin“ von der IL, S. 33;https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[4] Beschluss für ein Gesetz zur Vergesellschaftung von Grund und Boden (Rekommunalisierungsgesetz): https://dwenteignen.de/2018/11/27/beschlusstext-fertig/; eingesehen am 10.06.2019.

[5] Eine ,Luxuswohnsteuerʻ wäre sinnvolle Umverteilung (…).“; „Das Rote Berlin“ von der IL, S. 19; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[6] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[7] „Das Rote Berlin“ von der IL, S. 3; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[8] Warum es vielen Selbstständigen und auch vielen öffentlichen Bediensteten oft nicht besser geht als den Lohnarbeiter*innen, kann man im folgenden Buch nachlesen: Die Misere hat System: Kapitalismus, S. 141-143. Als Buch zu kaufen oder als PDF umsonst runter zuladen unter: https://gegen-kapital-und-nation.org/page/die-misere-hat-system-kapitalismus/

[9] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[10] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[11] Beschluss für ein Gesetz zur Vergesellschaftung von Grund und Boden (Rekommunalisierungsgesetz): https://dwenteignen.de/2018/11/27/beschlusstext-fertig/; eingesehen am 10.06.2019.

[12] Das Privateigentum einzelner Kapitalist*innen ist zu klein für manche großangelegten, aber vielleicht sehr gewinnträchtigen Geschäftsstrategien. In der Aktiengesellschaft schließen sich Kapitalist*innen zusammen. Sie haben dann als Aktiengesellschafter keine freie Verfügung über das Eigentum der Gesellschaft mehr, kein einzelner Kapitalist kann als Aktiengesellschafter irgendwie über ein paar Häuser verfügen und entscheiden. Stattdessen haben die einzelnen Kapitalist*innen nur den Rechtstitel auf einen Anteil des Gewinns in Form einer Dividende. Dieser Rechtstitel bekommt selber einen Preis in Form von Kurswerten an der Börse. Wenn eine Aktionärin ihr Eigentum verkauft, dann wird nicht ein Haus verkauft, sondern ein Rechtstitel auf Gewinn. Die Aktiengesellschaft ist satzungsgemäß darauf verpflichtet, seinen eigentümlichen Eigentümer*innen einen Gewinn auszuschütten oder aber den Kurswert der Aktien zu steigern – im besten Falle beides zu gleich. Das Finanzkapital ist also eine Vollendung der kapitalistischen Profitrechnung, wenn es die letzte Schranke, die das Kapital in einer fertig befriedeten Klassengesellschaft hat (nämlich seine privateigentümliche Größe), durch die Kooperation von Kapitalist*innen überwindet.

[13] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[14] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[15] https://dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[16] https://www.rbb24.de/politik/beitrag/2019/04/volksbegehren-deutsche-wohnen-enteignen-berlin-brandenburg.html; eingesehen am 10.06.2019

[17] Warum der Profit generell eine maßlose Angelegenheit ist, kann man hier nachlesen: Die Misere hat System: Kapitalismus, drittes Kapitel. Als Buch zu kaufen oder als PDF umsonst runter zuladen unter: https://gegen-kapital-und-nation.org/page/die-misere-hat-system-kapitalismus/

[18] Zitat von einem Plakat der Kampagne. Zu finden unter: https://dwenteignen.de/2019/02/27/entschädigungszahlung/; eingesehen am 10.06.2019.

[19] Ausführlicher wird diese Sorte von Unzufriedenheit hier kritisiert: „Von Schland nach Gauland – Das Krisenprogramm der AfD und seine demokratische Grundlage“, im Abschnitt „Berechtigte Kritik in der Demokratie: Was geht und was nicht geht“, S. 7-10, nachzulesen: https://gegen-kapital-und-nation.org/media/broschüre_schland.pdf

[20] https://www.dwenteignen.de/warum-enteignen/; eingesehen am 10.06.2019.

[21] Beschluss für ein Gesetz zur Vergesellschaftung von Grund und Boden (Rekommunalisierungsgesetz): https://dwenteignen.de/2018/11/27/beschlusstext-fertig/; eingesehen am 10.06.2019.

[22] https://www.dwenteignen.de/2019/04/05/eine-antwort-auf-die-wohnungskrise/; eingesehen am 10.06.2019.

[23] https://www.dwenteignen.de/2019/04/05/eine-antwort-auf-die-wohnungskrise/; eingesehen am 10.06.2019.

[24] Liest man das längere Papier „Das Rote Berlin“ der Interventionistischen Linken durch, die die Kampagne als eine Organisation von vielen unterstützt, wird man ebenfalls enttäuscht. Zwar machen auch sie sich einerseits nichts vor: „Denn Spaltung wird die Antwort von Staat und Immobilienkapital sein, um unsere Kämpfe klein zu halten“ (S. 35). Sie kennen also den Staat als Subjekt, das den eigenen Interessen entgegensteht. Und auch über linke Parteien haben sie keine Illusion: „Denn natürlich wird Rot-Rot-Grün seine Wahlversprechen nicht einhalten.“ (S. 35) Was der eigenständige Zweck des Staates oder der Politik ist, was dessen Logik ist, darüber steht in der ganzen Broschüre nichts – und dann doch so einiges, was gleich weiterverfolgt werden soll. https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[25] BImA steht für Bundesanstalt für Immobilienaufgaben.

[26] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 28; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[27] Rouzbeh Taheri (Sprecher des Bündnisses »Spekulation bekämpfen – Deutsche Wohnen & Co. Enteignen«) in einem Interview mit Marx21: https://www.marx21.de/deutsche-wohnen-co-enteignen-spekulanten-berlin-verschrecken/; eingesehen am 16. Juni 2019.

[28] Rouzbeh Taheri (Sprecher des Bündnisses »Spekulation bekämpfen – Deutsche Wohnen & Co. Enteignen«) in einem Interview mit Marx21: https://www.marx21.de/deutsche-wohnen-co-enteignen-spekulanten-berlin-verschrecken/; eingesehen am 16. Juni 2019.

[29] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 14; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[30] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 6; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

[31] Siehe hierzu den zweiten Teil des Textes „Gentrification“ von den Gruppen gegen Kapital und Nation: https://gegen-kapital-und-nation.org/media/broschüre_gentrification.pdf

[32] Broschüre „Das Rote Berlin“ von der Interventionistischen Linken, S. 35; https://interventionistische-linke.org/sites/default/files/attachements/rotes_berlin_-_2_auflage_onlineversion_final.pdf; eingesehen am 16.06.2019.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————-

Grafikquellen  :

Oben        —         Deutsche Wohnen in Berlin-Wilmersdorf

Abgelegt unter Berlin, Deutschland, Mensch, Umwelt | Keine Kommentare »

Der Attentäter von Halle

Erstellt von DL-Redaktion am 13. Oktober 2019

Täterfilme, Opferbilder – ergibt dieses einen Sinn 

HalleSynagoge 01.JPG

Eine Kolumne von

Gewalttäter und Attentäter stellen Fotos und Filme ihrer Taten ins Netz. Zeitungen, Fernsehsender und sonstige Medien zeigen sie. Ist das erlaubt, ist es vielleicht notwendig, kann es überhaupt sinnvoll sein?

Fragestellung

Der Attentäter von Halle hat bekanntlich seine Tat – bzw. den Ablauf seiner mehreren Taten – mittels einer Helmkamera aufgenommen und live gestreamt. Diese Sendung fand jedenfalls zum Teil die Abnehmer, auf welche sie gezielt war, also Bewunderer, potenzielle Nachahmer, Brüder und Schwestern im Geiste. Sie fand aber auch Eingang in die Nachrichten ganz unverdächtiger Medien. In einer Hauptnachrichtensendung am Abend des 9. Oktober wurde eine Sequenz aus dem Innenraum des Täter-Pkw mit einem Überblick über die dort gelagerten Sprengmittel und Waffen gezeigt. Ein Sprecher kündigte das mit den Worten an, man zeige nun „ganz bewusst nur einen kurzen Ausschnitt“ aus dem Videofilm.

Nun wird man als Bürger und Gebührenzahler davon ausgehen dürfen, dass eigentlich fast alles, was öffentlich-rechtliche Sender tun, zumindest auch „ganz bewusst“ erfolgt und nicht nur Erscheinungsformen des Unterbewussten sind. Das deutet darauf hin, dass mit dem Hinweis etwas anderes gemeint war: Eine besondere Demonstration, eine plakative Entscheidung, ein Signal. Die konkludente Botschaft lautete: Wir zeigen Ihnen, liebe Zuschauer, nur einen (kleinen) Teil des Videos, obwohl wir es auch ganz zeigen könnten und obwohl Sie das vielleicht auch erwarten. Wir tun das aus Gründen, die wir uns „bewusst“ gemacht haben und die gute Gründe sind. Die guten Gründe kann sich, wer halbwegs bei Trost ist, denn auch denken; für den Rest wurde es gelegentlich und auf anderen Kanälen zur Sicherheit nochmal gesagt: Man wolle dem Täter nicht ein Forum geben, seine unerwünschten Inhalte zu verbreiten.

Zum Glück hatte man wenigstens ein Handy-Video eines Anwohners zur Hand, das uns aus der Perspektive eines Fensters im Zweiten Stock zeigte, wie es aussieht, wenn ein Mann hinter einem Auto steht und auf nicht sichtbare Ziele schießt. So konnte man sich das einmal vorstellen. Man kann das so oder so finden, ebenso wie die wirklich immer sehr spannenden Filmaufnahmen davon, wie ein gefesselter, mit Kapuze und/oder Gehörschutz ausgestatteter Gefangener von ungefähr 10 schwerst getarnten und bewaffneten Polizeibeamten 25 Meter weit über den Rasen des Bundesgerichtshofs geführt wird. Um diese sensationellen Bilder herzustellen, stellen sich mehrere Übertragungswagen diverser Fernsehsender, besetzt mit fassungslosen Journalistenteams, stundenlang vor den Zäunen des Geländes auf und filmen alles, was sich innen bewegt. In Tagesschau, heute & Co. sagt dann die Sprecherin, Herr B. sei heute dem Ermittlungsrichter des BGH vorgeführt worden. Hierzu sieht man zwei Sekunden lang die Glatze von Herrn B und die Kompanie vermummter Menschen, die hoffentlich allfällige Befreiungsversuche zurückschlagen könnten.

Hinter diesen eher ironischen Notizen zum Informationsgehalt und Informationsbedürfnis gibt es natürlich auch ernsthafte Fragen. Sie sind teils strafrechtlicher, teils medienrechtlicher, teils vielleicht staatsrechtlicher Art, zum Teil aber auch nur medienpolitischer Natur. Man muss da ein bisschen unterscheiden.

Unterscheidungen

Eine erste Unterscheidung betrifft die Herkunft des Gegenstands: Tätervideos sind nicht dasselbe wie Zeugenvideos. Videos sind nicht dasselbe wie „Erklärungen“, Rechtfertigungen oder Programm-Schriften, wie sie bei politisch motivierten Straftaten (auch) immer noch üblich sind. In der Regel wird bei Dokumenten, die von Zeugen hergestellt wurden, der Propaganda-Effekt geringer sein als bei solchen, die von Tatbeteiligten herrühren.

Eine zweite Unterscheidung betrifft den unmittelbaren Inhalt: Das Abfilmen oder -Fotografieren von äußeren Abläufen, allgemeinen Auswirkungen, Aktivitäten der Polizei usw. hat eine andere Natur als die Darstellung der Tat selbst, sei es der Täterhandlungen, sei es der Handlungswirkungen.

Beispielhaft: Die Filmsequenz aus dem Tätervideo aus dem Kfz ist anders zu beurteilen als die Szene mit dem schießenden Täter (erste Unterscheidung); unter den Szenen aus dem Tätervideo sind Sequenzen aus dem Kfz, Szenen vom Versuch des Eindringens in die Synagoge und Darstellungen der beiden Tötungsverbrechen verschieden zu beurteilen (zweite Unterscheidung).

Das Verbreiten von bildlichen Tatdokumentationen kann strafbar sein. Es kommen hier in Betracht: § 126 StGB (Störung des öffentlichen Friedens durch Androhen von Straftaten), § 140 StGB (Belohnen und Billigen von Straftaten), § 130 StGB (Volksverhetzung), § 130a StGB (Anleitung zu Straftaten), § 131 StGB (Gewaltdarstellung). Alle genannten Tatbestände sind Äußerungsdelikte, also auf Kommunikation nach außen ausgerichtet, und können (gerade) auch durch Verbreitung über Funk (Fernsehen) und Internet begangen werden. Dabei ist natürlich im Grundsatz jeweils zu unterscheiden, von wem das Verbreiten vorgenommen wird.

Die Delikte der (Belohnung und) Billigung von Verbrechen, der Volksverhetzung (durch Aufstacheln zu ähnlichen Gewalthandlungen) und der Anleitung zu schweren Straftaten, wenn die Verbreitung die Bereitschaft Dritter zur Begehung fördern soll (§ 130a Abs. 2), betreffen regelmäßig nur Tatbeteiligte, Unterstützer oder Sympathisanten; sie setzen jeweils in der einen oder anderen Form voraus, dass der Täter (des Verbreitens) sich mit der angedrohten, gebilligten oder beabsichtigten Tat identifiziert, sie befürwortet. Das scheidet bei Fernsehsendern, Zeitungen und legalen Internetmedien meistens aus, ist aber auch hier nicht ausgeschlossen. Hierzu muss man sich nur klar machen, dass der Charakter einer Tat als schwere Straftat (im Sinn von §§ 126, 130, 140 StGB) durchaus streitig sein kann. Man denke etwa daran, wie oft von öffentlich-rechtlichen deutschen Sendern die Videoaufnahmen von der irrtümlichen Tötung von mehr als 140 Zivilisten durch deutsche Soldaten in Kundus gezeigt wurden. Anders als etwa die ebenfalls vielfach gesendeten Filmaufnahmen von der Erschießung von Zivilisten aus einem amerikanischen Kampfhubschrauber in Bagdad am 6. April 2010 wurde hier ja durchaus die Meinung vertreten, es handle sich um einen vollkommen gerechtfertigten Fall massenhafter Tötung. Es ist also nicht immer ganz so einfach wie erwünscht, zwischen der Dokumentation von Heldentaten, Unfällen und Verbrechen zu unterscheiden. Und dasselbe Video kann von einem Sender als Dokument eines Verbrechens gezeigt werden, von einem anderen als Dokument rechtmäßigen Verhaltens.

Motive

Quelle        :           Spiegel-online       >>>>>          weiterlesen

—————————————————————

Grafikquellen      :

Oben      —             Synagoge in Halle (Saale), Jüdischer Friedhof, Humboldtstraße

———————————-

Unten         —             Thomas Fischer auf der re:publica 2016

Abgelegt unter Innere Sicherheit, Justiz-Kommentare, Religionen, Sachsen-Anhalt | Keine Kommentare »

Bodo, der Balancekünstler

Erstellt von DL-Redaktion am 12. Oktober 2019

Der Rote, den die Schwarzen lieben

2019-02-09 Viessmann Luge World Cup Oberhof StP 0103 LR10 by Stepro.jpg

Wer hat den größten Mund ?

Aus Vietnam und Thüringen Anna Lehmann

Ende Oktober wählt Thüringen. Bodo Ramelow, der einzige Ministerpräsident der Linkspartei, regiert dort seit fünf Jahren – und zwar so, dass selbst CDU-Anhänger sich eine weitere Amtszeit wünschen. Wie macht er das?

Gleich wird Bodo Ramelow in seine Vergangenheit hinabfahren, 800 Meter in die Tiefe. Das Bergwerk Merkers liegt im Westen Thüringens, an Hessens Grenze. Tausende Kilometer Stollen durchziehen die Landschaft unterirdisch.

Unter einem stählernen Förderturm warten an diesem warmen Augusttag der Leiter des Bergwerks, einige Politikerinnen und Journalisten. Zwei Dienstlimousinen mit Blaulicht fahren vor. Aus einer steigt Bodo Ramelow. Zusammen mit Gregor Gysi ist der Ministerpräsident Thüringens auf Wahlkampf-Wandertour. Beide sind mit Funktionshemden, Outdoorhosen und fabrikneuen Wanderstiefeln ausgerüstet. Dabei werden sie nach dem Bergwerksbesuch nur den 380 Meter hohen Hundskopf hochstapfen.

Zuvor fährt Ramelow in Merkers ein, heute ein Schaubergwerk mit Klettergarten und Konzerthalle. Die Kumpel, die hier noch arbeiten, sind vorwiegend mit Verfüllung beschäftigt, sie stopfen Hohlräume zu. Der Werksleiter schüttelt Ramelow die Hand. Ramelow boxt dem Mann daneben spielerisch vor die Brust. „Och, der Betriebsrat“, sagt er. Der Mann grinst.

Anfang der neunziger Jahre kämpfte Ramelow selbst als Arbeitnehmervertreter in Thüringen um Arbeitsplätze im Bergbau – gegen den westdeutschen Monopolisten, die Kali und Salz AG. Und gegen die Politik. Damals verlor er.

Fast 30 Jahre später kämpft er erneut um Arbeitsplätze im Bergbau. Diesmal zusammen mit K+S, wie die Kali und Salz AG heute heißt. Und die Politik ist er.

Selbstverständlich ist es nicht, dass die Gegner von einst nun Verbündete sind. So wenig wie es erwartbar war, dass die Linke, die erstmals einen Ministerpräsidenten stellt, nach fünf Jahren Regierung in Thüringen weder entzaubert noch zerstritten ist. Wenige Wochen vor der Landtagswahl führt sie sogar in den Umfragen.

Fast 25 Jahre hat die CDU das Land regiert. Bis 2014 Ramelow kam. Seit fünf Jahren führt er eine Koalition aus Linken, SPD und Grünen, die sich auf nur eine Stimme Mehrheit im Landtag stützt. Derzeit ist völlig offen, welche Konstellation nach dem 27. Oktober regieren könnte. Sicher ist nur: Wenn die Linke gewinnt, dann wegen Bodo Ramelow.

Die Partei weiß das. Alle Großplakate zeigen Ramelows Konterfei – mal als Lokführer, mal als Spaziergänger. Personenkult? Na klar doch.

„Seilfahrt“. Hinab saust der Korb mit Ramelow in die „Teufe“, wie es bergmännisch heißt. In der salzhaltigen Luft der Kaligrube erzählt Ramelow, jetzt in blauem Bergmannskittel und mit weißem Helm, in einer Bar in 807 Meter Tiefe, wie er sich 2015 mit dem Vorstandsvorsitzenden von K + S, Norbert Steiner, aussöhnte.

Kalischacht Bleicherode, Thüringen 8.JPG

Der Steiner sei ein Raubatz, wie er selbst, sagt Ramelow. „Alle haben gedacht: Weil ich damals auf der Seite der Kalikumpel war, würde ich niemals mit dem reden können.“ Aber man sei sich auf Augenhöhe begegnet und habe Frieden geschlossen.

Bodo Ramelow ist ein Mann der Gegensätze. Der Ministerpräsident ist aufbrausend und eitel, rechthaberisch und rauflustig. Mal kotzt ihn die Antifa an, mal der MDR. Mit Nazis und der AfD legt er sich seit jeher an. Wenn er auf Autofahrten allein mit seinem Handy ist, schwitzt sein Team. Ramelows Twitter-Scharmützel sind gefürchtet. Seine Mitarbeiter räumen hinter dem Chef auf.

Corinna Hersel traf Bodo Ramelow im Frühjahr 1990 zum ersten Mal. „Jetzt kommt der aus dem Westen und will uns die Welt erklären“, dachte sie damals. Hersel ist heute Verdi-Bezirksgeschäftsführerin, damals arbeitete sie für die Ost-Gewerkschaft Handel, Nahrung und Genuss. Ramelow, den die hessische Gewerkschaft Handel, Banken und Versicherung nach Thüringen entsandt hatte, traf dort auf viele tausend Frauen, die gerade ihre Arbeitsplätze verloren. Die Treuhand löste die Handelsorganisation der DDR auf. Von ihm habe man Wunder erwartet, erzählt Ramelow. „Die Menschen haben ja gedacht: Ich als Westdeutscher muss es wissen.“

Der Gewerkschaftssekretär aus Mittelhessen landet mitten im Osten und jener Umbruchzeit, deren Verwerfungen heute, 30 Jahre nach dem Mauerfall, wieder aufbrechen. Ramelow sieht, wie massenhaft Betriebe plattgemacht werden und sich Menschen von der gerade erkämpften Demokratie wieder abwenden.

Stunden hätten sie zusammen in Betriebsversammlungen verbracht, erzählt Hersel. Aus dem „arroganten Arsch“ wurde der Bodo – „einer, der immer für uns da war, den man auch mal nachts anrufen konnte“.

Der aber auch jähzornig sein kann. Als die Aktentasche mit dem frisch ausgehandelten Tarifvertrag beim Grillabend verschwindet, tobt er. Der Vertrag findet sich später in der Mikrowelle, jemand hatte sie als Tresor ausgewählt, als Ort für besonders Schützenswertes. Ramelow kann sich aber auch entschuldigen. „Das hat ihm viele Punkte eingebracht“, sagt Hersel.

Drei Jahre später, als auch die Kaligruben im Osten geschlossen werden sollen, wird aus dem Gewerkschafter Bodo der Politiker Ramelow. Die Schließung der Grube in Bischofferode 1993 habe ihn politisiert, erzählt Ramelow. „Sonst wäre ich immer noch der nette Gewerkschaftssekretär, der schaut, wann der nächste Tarifvertrag um die Ecke kommt.“

Die Treuhand-Anstalt, die das Volksvermögen der DDR privatisiert, plant damals die ostdeutschen Gruben mit dem westdeutschen Monopolisten Kali und Salz zu fusionieren. Der Schönheitsfehler: Zusammen produzieren die Gruben mehr Kali, als der Markt braucht, also sollen vor allem Gruben im Osten geschlossen werden. Die Bischofferoder Kumpel besetzen die Grube und treten im Sommer 1993 in den Hungerstreik. Die IG Bergbau macht nicht mit, stattdessen kommt der HBV-Sekretär Ramelow. „Wer bist’n du? Mach dich vom Tor“, empfangen ihn die Kumpel. Ramelow bleibt, obwohl er für Bergbau nicht zuständig ist. Er verstehe das Problem, sagt er, er wolle helfen.

Was der Gewerkschafter Ramelow damals nicht verstand: Bischofferode war nur ein kleiner Stein in einem größeren Spiel. In den geheimen Verträgen zwischen der Treuhand und Kali und Salz, die erst 20 Jahre später geleakt werden, stand, was viele ahnten: Die Schließung von Bischofferode war politisch gewollt. Die Treuhand hatte der Kali und Salz AG die Grube regelrecht aufgedrängt: Um den Erhalt von Jobs sollte sich der Konzern nicht scheren, für Verluste und ökologische Altlasten würden größtenteils die Steuerzahler haften. Die Arbeitsplätze im Westen waren wichtiger.

Als zum Jahresende 1993 alle Verhandlungen gescheitert sind, handelt Ramelow im Auftrag der Kumpel die Sozialpläne mit der Treuhand aus. Warum sie ihm doch vertraut haben? „Der war kein Phrasendrescher, hat sich reingekniet“, erzählt Gerhard Jüttemann, damals stellvertretender Betriebsratsvorsitzender. „Er war immer da: mit Informationen und Adressen – und vorbereitet, wie kaum einer sonst.“

Jüttemann, weißer Bart, schwarze Bergmannskluft, ist mit anderen ehemaligen Kumpeln nach Erfurt gekommen, wo die Rosa-Luxemburg-Stiftung im August 2019 eine Ausstellung über die Treuhand eröffnet. Es ist voll. Jüttemann erwartet Ramelow vor der Tür, sie begrüßen sich mit Schulterklopfen. „Bodo“ – „Gerd“.

Die Leiterin der Luxemburg-Stiftung spricht zur Eröffnung von der „Entwertung von Biografien“. Und sagt: „Es war nicht eure Schuld.“ Einige der Ältere weinen. Ramelow schaut zu Boden, nickt.

Bischofferode wird ein Wendepunkt: Menschen, die vier Jahre vorher noch skandierten „Wir sind ein Volk“, sind nun zutiefst enttäuscht. Und Ramelow? Tritt 1999 in die PDS ein, wird Fraktionschef in Thüringen, sitzt später im Bundestag, managt die Fusion von WASG und PDS zur Linken und kehrt nach Thüringen zurück.

2009 tritt er zum ersten Mal als Ministerpräsidentenkandidat an, die SPD koaliert aber als Juniorpartner mit der CDU. 2014 wird die Linke erneut zweitstärkste Partei, Ramelow schmiedet eine Koalition mit SPD und Grünen und stellte sich im Landtag zur Wahl. Im ersten Wahlgang fällt er durch. Im zweiten Versuch klappt es.

File:NNU đền Ngọc Sơn.jpg

Bodo Ramelows Besuch im Ngoc-Son-Tempel in Hanoi

In Ramelows Arbeitszimmer in der Staatskanzlei steht eine Lampe aus Metall – die letzte Grubenlampe aus Bischofferode. „Darum sitze ich hier“, sagt er, als die taz im Frühjahr 2017 auf der Besuchercouch sitzt. In Erinnerung an den schwersten Arbeitskampf im Osten kämpft er jetzt um die 4.500 Arbeitsplätze im Bergbau Thüringens.

Aber Kalivorräte sind endlich, außerdem wird die Lauge seit Jahren in den Fluss Werra entsorgt und versalzt das Wasser. Auch Ramelow weiß, dass die Zukunft anders aussieht.

Quelle        :      TAZ        >>>>>         weiterlesen

————————————————————-

Grafikquellen         :

Oben          —      Viessmann Luge World Cup Oberhof; Ministerpräsident Bodo Ramelow mit Schneemann „Flocke“; Maskottchen, mascot

  ———————————-

2.)   von Oben        —       Kalischacht Bleicherode, Thüringen

—————————

Unten       —       Casablanca1911 at Vietnamese Wikipedia

This work has been released into the public domain by its author, Casablanca1911 at the Wikipedia project. This applies worldwide.

Abgelegt unter Feuilleton, L. Thüringen, P. DIE LINKE, Überregional | 1 Kommentar »

Kollektiver Einzeltäter-Halle

Erstellt von DL-Redaktion am 11. Oktober 2019

Terror und die Mitte der Gesellschaft

Police on the Lichtenberger Brücke in Berlin in front of the "Heß-Marsch" Demonstration 16.jpg

Von Alexander Nabert

Der antisemitische Anschlag in Halle kam nicht von ungefähr. Das Schweigen der Mehrheitsgesellschaft ermutigt rechtsextreme Gewalttäter.

Als die Polizei am Mittwoch nach dem antisemitischen Terroranschlag in Halle ermittelte, fahndete sie zunächst nach mehreren Tatbeteiligten. Lange nachdem der Täter Stephan Balliet gefasst war, kamen dann die Meldungen über den Ermittlungsstand: Es sei doch ein Einzeltäter gewesen. Das bedeutet in der Sprache von Ermittlern zunächst lediglich, dass man davon ausgeht, dass es einen einzelnen Tatbeteiligten gegeben hat. Auch jetzt ist das noch der Stand der Ermittlungen.

Der zunächst auch als Einzeltäter geltende Stephan Ernst, der im Juni den Kassler Regierungspräsidenten Walter Lübcke ermordet haben soll, stellte sich innerhalb von wenigen Wochen als ein in rechtsextremen Strukturen gut eingebundener Neonazi heraus, der nicht nur Demonstrationen der AfD besuchte, sondern auch mindestens einen ganz konkreten Helfer bei seiner Tat hatte. Auch von der lange als „NSU-Trio“ bezeichneten rechtsextremen Terrorgruppe kennt man mittlerweile ein Unterstützerumfeld mit vielen Dutzend Helfenden.

Es ist nicht ausgeschlossen, dass auch bei dem rechtsextremen Täter von Halle noch Unterstützer, Helfer oder Mitwisser ermittelt werden. Doch selbst wenn er sich als Täter ohne ein entsprechendes Umfeld herausstellt, war er nicht allein. Der Begriff Einzeltäter suggeriert immer genau das: Ein Einzelner, der irgendwo in seinem stillen Kämmerlein durchdreht, vermutlich verrückt ist, schreitet unabhängig vom Rest der Welt zu einer grausamen, einzelnen Tat. Das klingt so wunderbar entlastend in unseren Ohren. Es klingt, als hätten wir alle nichts mit dem Mörder zu tun, als gäbe es kein größeres, strukturelles Problem. Und gerade deshalb ist es so falsch.

HalleSynagoge 02.JPG

In dem Livevideo, das der Täter Stephan Balliet von seiner Tat ins Internet und damit an die internationale Rechtsterrorismus-Community übertrug, wird seine Ideologie deutlich. Stephan Balliet ist ein Antisemit und Verschwörungsideologe. Er glaubt, dass die Juden schuld an allen Übeln dieser Welt sind. Für ihn sind diese Übel: Die Migration, der Feminismus, die Geburtenraten. Er glaubt an eine Erzählung, die die rechtsextreme Identitäre Bewegung den „großen Austausch“ nennt. Demnach würde die Bevölkerung in Staaten des Westens planvoll ersetzt und ausgetauscht werden, nach Balliets Lesart eben kon­trol­liert durch die Juden. Mit dieser Erzählung ist er nicht allein, auch wenn nicht jeder so deutlich sagt, wen er für verantwortlich hält.

Quelle          :      TAZ         >>>>>         weiterlesen

————————————————————–

Grafikquellen          :

Oben        —          Die Polizei war mit hunderten Fahrzeugen und Tausenden Personen an der Strecke des „Heß-Marsches“, bei dem der Kriegsverbrecher Rudolph Heß geehrt werden sollte, um zu Verhindern, dass Gegendemonstrationen die Straße besetzen.

  —————————-

Untenn            —       Synagoge in Halle (Saale), Jüdischer Friedhof, Humboldtstraße

Abgelegt unter Innere Sicherheit, Religionen, Sachsen-Anhalt, Wirtschaftpolitik | Keine Kommentare »

Wut schlägt Scham

Erstellt von DL-Redaktion am 10. Oktober 2019

Das »Wir sind das Volk« der AfD als nachgeholter Widerstand

Wirr ist das Volk.jpg

von Annette Simon

Es ist eine erstaunliche Koinzidenz: Während die AfD mit „Vollende die Wende“ nicht „nur“ die friedliche Revolution für sich reklamiert, sondern mit der Revolutionsparole „Wir sind das Volk“ zugleich behauptet, für die gesamte DDR-Bevölkerung zu sprechen, versucht – stellvertretend für viele ähnlich agierende Medien – „Der Spiegel“ die ominöse „ostdeutsche Seele“ zu ergründen und kommt zu dem (sicherlich furchtbar ironisch gemeinten) Schluss: „So isser, der Ossi“.[1]

Eine Debatte, zwei Reaktionsmuster, die aber eines verbindet: Beide sehen die DDR-Bürger als eine homogene Masse – alle gleich. Doch die DDR war ein heterogenes Gebilde und eine gespaltene Gesellschaft, gespalten in Herrscher und Beherrschte – wobei die Trennlinien dazwischen alles andere als scharf waren. Es gab Spitzel und Bespitzelte, Parteisekretäre und Dissidenten, Karrieristen und Aussteiger. Und es gab viele verschiedene Milieus: kirchliche, künstlerische und intellektuelle Kreise, Arbeiter, Stadt und Land, den Partei- und Staatsapparat.

Im Jahr 1989 hatten die Mitglieder dieser gespaltenen Gesellschaft eine ungeklärte, fragile Identität. Die DDR-Identität war hinter der Mauer gleichsam stumm geblieben, hatte sich nicht im Vergleich mit dem Westen schärfen und artikulieren können. 1989 waren wir nicht mehr DDR-Bürger und noch nicht Bundesdeutsche, sondern Zwischenwesen. Nur ein Teil der DDR-Bürger fühlte sich wirklich noch mit der DDR identifiziert, ein anderer kleiner Teil fühlte sich bereits oder noch immer als „Deutsche“.

Dieser Tage wird daher oft behauptet, dass die ostdeutsche oder gar DDR-Identität überhaupt erst nach der Wende entstanden sei, durch die schwierigen, teilweise traumatischen Erfahrungen, die die Ostdeutschen im Vereinigungsprozess machen mussten. Meines Erachtens geht dies am Kern der Sache vorbei: Jeder, der in der DDR lebte, musste sich irgendwie zu diesem Staat in Bezug setzen, weil er zwangsläufig und immer mit ideologisch-hierarchischen Machtstrukturen konfrontiert war und dies hatte dann immer auch mit der eigenen Identität zu tun. Die Ostdeutschen teilten den gleichen Erfahrungsraum, in dem sie sich aber durchaus unterschiedlich verhielten.

Eines allerdings ist richtig: Der Vereinigungsprozess hat uns Ostdeutsche in einer Weise vereint, die die oben geschilderte Spaltung der Gesellschaft nur wenig berücksichtigt hat. Durch die schnelle Installierung der neuen Strukturen wurden die Spaltungen und Differenzen übertüncht. Egal ob Herrscher oder Beherrschter, Parteisekretär oder Bürgerrechtler – alle mussten sich mit den neuen westdeutschen Strukturen und der Infragestellung ihrer bisherigen Existenz auseinandersetzen. Alle bekamen vereint weniger Geld als Westler in vergleichbaren Positionen und wurden genauso „vereint“ als Diktaturgeschädigte gesehen. „Zwischen den früheren Stützen des Regimes und den notgedrungen Angepassten entsteht eine Eintracht, wie sie zu DDR-Zeiten nie existiert hat“, bilanzierte treffend Stefan Wolle.[2]

Zu der gemeinsamen sozial-ökonomischen Abwertung kam jedoch noch eine zweite, nicht weniger gravierende: Auch kulturell wurden die Ostdeutschen in der Bundesrepublik nicht begrüßt. Die Leistung ihrer Selbstbefreiung fand keine symbolische Würdigung. Es kam nicht zu einer neuen gemeinsamen Verfassung, es gab keine neue Fahne und auch nicht eine neue gemeinsame Nationalhymne. Und warum wurde nicht der 9. Oktober zum Feiertag der deutschen Einheit gemacht, der Tag des Friedensgebets in der Nikolaikirche, an dem 1989 in Leipzig die Menschen mit großem Mut in Massen demonstrierten und damit das Ende der DDR mit einläuteten? Der 3. Oktober als Tag der Einheit sagt dagegen nur etwas über den Verwaltungsakt des Beitritts aus, nichts aber, was sich irgendwie auch mit ostdeutscher Identität verbinden ließe.

Hinzu aber kommt ein Weiteres: Durch die schnelle Vereinigung, die die Mehrheit der Ostdeutschen in freier Entscheidung selbst gewählt hat, konnten die gravierenden Konflikte zwischen ihnen nicht ausgetragen werden, sondern wurden mehr oder weniger unter den Tisch gekehrt oder durch die rasante Installierung der neuen Strukturen weggebügelt. Für manche war und ist dies bis heute eine unverdiente Gnade, für andere Grund zu großer Bitterkeit. So kann es einem ehemaligen Häftling, der wegen Republikflucht einsaß, passieren, dass ihm sein ehemaliger Verhörer in der Berliner S-Bahn gegenübersitzt – und dass er zusammen mit ihm zwischen den Bahnhöfen Friedrichstraße und Hauptbahnhof elegant über den ehemaligen Mauerstreifen fährt. Und falls sie beide inzwischen Rentner sind, kann man fast sicher sein, dass der einstige Verhörer eine höhere Rente bekommt als der Ex-Häftling.

Es gibt also massive, unaufgehobene Widersprüche aus DDR-Zeiten, die weiter wirken, Bitterkeit und Zorn erzeugen. Allerdings gehen viele Ex-DDR-Bürger der Auseinandersetzung mit ihrem psychischen und sozialen Geprägtsein durch die DDR bis heute aus dem Weg. Dies ist durchaus verständlich, weil sie nach 1989 extremen existenziellen Anforderungen ausgesetzt waren und zum Teil weiterhin sind. Die Ostdeutschen sind durch einen Systemwechsel gegangen, wie ihn die Menschen in der alten Bundesrepublik in den letzten 70 Jahren nie erlebt haben. 30 Jahre nach 1989 mehr oder weniger „angekommen“, fühlt sich die Hälfte der Ostdeutschen nach den neuesten Umfragen immer noch als Bürger zweiter Klasse.

Stralsund (2013-07-08), by Klugschnacker in Wikipedia (251).JPG

Doch die Zeit seit 1989/90 erklärt beileibe nicht alles. Zudem, und vielleicht noch weit stärker, werden nämlich Selbstbewusstsein und Selbstverständnis aus dem eigenen Inneren angegriffen: wenn einem zunehmend bewusster wird, dass man in einer Diktatur gelebt hat, ihr ausgesetzt war und dies natürlich Spuren hinterlassen hat. Der narzisstischen Kränkung von außen auch noch eine eigene Verunsicherung von innen hinzuzufügen, stellt eine hohe Anforderung an Stabilität und Reflexionsvermögen dar, die nicht jeder aufbringen kann.

Darüber hinaus fühlen sich manche Ostdeutsche durch die Art des öffentlichen Umgangs mit ihrer Vergangenheit beschämt. Der Leipziger Psychoanalytiker Jochen Schade hat schon 2001 eine alte Scham benannt, „die doch entstehen sollte, wenn man sich verordneten Dummheiten unterwirft, sich bedingungslosen Redeverboten fügt und Demutsgesten vollbringt. Wer von uns kennt nicht die erfahrungsnahe, geradezu körperliche Registrierung peinigender Gefühle der Subalternität, die der öffentliche Alltag im Sozialismus so oft bereithielt?“[3] Diese alte, oft unbewusste und verdrängte Scham aus der DDR-Zeit, in der man sich Zwängen mehr als notwendig gebeugt hatte, wird jetzt in vielfältiger Weise ans Licht gezerrt. Und im grellen Licht der Öffentlichkeit und der Westscheinwerfer wird sie zu einer neuen Beschämung und zur Entwertung. Als ein Beispiel dafür kann der Umgang mit dem DDR-Antifaschismus dienen, der häufig als teilnahmsloser Antifaschismus gedeutet wurde. Doch die Sache ist weitaus komplizierter.

Willkommene Schuld-Entlastung

Die in der DDR nach 1945 in die Macht eingesetzten Politiker waren zum Teil erwiesenermaßen antifaschistisch oder reklamierten dies für sich. Sie schufen den Mythos, dass die DDR aus dem Antifaschismus geboren worden sei. Diese Saga entfaltete eine ungeheuer starke Wirkung – bis in die einzelne Familie hinein –, weil sie umfassende Schuldentlastung von den deutschen Verbrechen bot. Die Identifikation mit den Antifaschisten und später auch mit der DDR hatte den ungeheuren Vorteil, nun scheinbar auf der richtigen deutschen Seite zu stehen, auf der Seite des Widerstands und damit der Opfer. Wir sind die Guten, drüben sind die bösen Imperialisten. Diese Schuldentlastung wurde von den Deutschen Ost, die gar nicht unschuldiger waren als die Deutschen West, bereitwillig ergriffen und nach und nach sogar geglaubt.

Alles, was nach 1945 an psychischen Dispositionen, an Anfälligkeit für Unterordnung, an autoritärem Denken, Verachtung des Fremden und Schwachen weiter internalisiert war, wurde außer in der Kunst und Literatur nicht öffentlich bearbeitet. In den Institutionen und in den Familien gab es das gleiche Schweigen wie anfänglich im Westen. So wurde zugedeckt, was denn vor 1945 konkret an einer bestimmten Universität oder in einem bestimmten Krankenhaus oder in dieser oder jener Familie geschehen war.

Die ostdeutsche Großgruppe wurde von den russischen Siegern und ihren Erfüllungsgehilfen in Pankow bzw. Wandlitz in eine Ideologie gezwungen. Wenn man diese Ideologie, die anfangs mit wirklichem Terror, später mit Diktatur einherging, diesen Doppelknoten aus Sozialismus und Antifaschismus annahm, konnte man sich scheinbar von Schuld befreien und aus der deutschen Identität lösen. Konsequenterweise versuchte die DDR Anfang der 1970er Jahre, aus allen Bezeichnungen das Wort „deutsch“ zu entfernen: die deutsche Mark wurde zur Mark, die Strophe der DDR-Nationalhymne von Johannes R. Becher, die von „Deutschland einig Vaterland“ sprach, sollte nicht mehr im Wortlaut gesungen, sondern nur noch mit Instrumenten intoniert werden. Im September 1974 wurde mit einer Verfassungsänderung die deutsche Nation abgeschafft. Nun gab es die „sozialistische DDR-Nation“.

Mit der Aufpfropfung der Ideologie ging auch eine Zuteilung der Traumata und Ruhmesblätter einher. Sie wurden den Ostdeutschen von außen und oben zugeteilt, geboren auch aus der Lebensgeschichte ihrer in die Machtpositionen eingesetzten Führer wie Walter Ulbricht oder Erich Honecker, die beide in keiner Weise repräsentativ waren für die ostdeutsche Mehrheit. Ulbricht und Honecker kamen als Tischler und Dachdecker beide aus der Arbeiterklasse; sie waren schon vor 1933 Mitglieder der Kommunistischen Partei und dann im Widerstand gegen den Nationalsozialismus. Und so hatten wir dann in der DDR nicht nur den 1. Mai, den Kampftag der Arbeiterklasse, oder den 8. Mai, den Tag der Befreiung vom Hitlerfaschismus, sondern außerdem noch den Tag der Opfer des Faschismus am 11. September und natürlich den 7. Oktober, den Gründungstag der DDR, an dem die große Militärparade abgehalten wurde.

Dies waren aber nicht die Gedenk- oder Feiertage eines Großteils der DDR-Bevölkerung, etwa meiner Großeltern. Es waren die Tage ihrer Not und Verzweiflung, ihrer Niederlage und Scham. Denn sie waren wie die Mehrheit der DDR-Bürger nicht Opfer des Faschismus, sondern kleine Mitläufer gewesen, die unter der Vertreibung aus ihrer brandenburgischen Heimat, die jetzt in Polen liegt, sehr litten. Als Kaufmannsleute hatten meine Großeltern an den Kämpfen der Arbeiterklasse nie teilgenommen. Diese grandiosen Umdeutungen von Geschichte und Identität durch die russischen Sieger und die neuen Machthaber wurden von meinen Großeltern nur teilweise, von meinen Eltern und später von mir als einer Nachkriegsgeborenen allerdings schon stärker in die eigene Identität übernommen – und wir hatten uns dann an ihr abzuarbeiten.

Das Problem ist, dass diese aufgepfropfte Identität einerseits angenommen wurde, es andererseits aber immer eine andere Unterströmung von realen Erfahrungen gab: von Erfahrungen, die die Menschen in Krieg und Nachkrieg gemacht hatten und natürlich auch Erfahrungen mit der neu installierten Macht. Viele fühlten sich auf der benachteiligten deutschen Seite, in der DDR nicht am richtigen Platz. Immerhin haben von 1949 bis 1961 rund 2,7 Mio. Menschen die DDR, verlassen und nach dem Mauerbau noch rund 800 000.

Neben den offiziösen Geschichtsinterpretationen und -schilderungen gab es also immer erlebte wirkliche und manchmal erzählte Geschichten, die nur nirgendwo öffentlich artikuliert werden konnten. Ich kann mich noch sehr gut an die 1963 beim gemeinsamen Abwaschen hervorgepressten Sätze meiner Großmutter erinnern: Ich solle kein Wort glauben über die guten Russen, sie seien brutal und ungerecht gewesen nach dem Krieg. Und die Menschen trugen in sich neben den ihnen zugeteilten Traumen und Ruhmesblättern auch das Erlebnis neuer eigener Traumen und neuer eigener Heldengeschichten, die mit anderen geschichtlichen Daten verbunden sind: mit dem 17. Juni 1953, dem Jahr 1956, der Niederschlagung des Aufstandes in Ungarn, dem Bau der Mauer am 13. August 1961, dem Jahr 1968 und schließlich der Ausbürgerung von Wolf Biermann 1976.

17. Juni 1953 oder: Die Spaltung von Beginn an

Quelle           :        Blätter         >>>>>        weiterlesen

——————————————————————

Grafikquellen     :

Oben          —          Wirr ist das Volk, Banner von „DIE PARTEI Hessen“, NoFragida 11. Mai 2015, Frankfurt

2.) von Oben      —       Gedenkstätte für den Volksaufstand am 17. Juni 1953 und die politische Wende 1989. Inschrift auf den vier ins Gras eingelassenen Tafeln: „Wir „sind“ „das“ „Volk“. „1953 1989“

——————————

Unten     —     Leipzig, 8 janvier 1990.

Abgelegt unter Deutschland, Kultur, Mensch, Mitteldeutschland | Keine Kommentare »

Beleidigungsbrief der ARGE

Erstellt von DL-Redaktion am 8. Oktober 2019

 ca. 35 Erwerbslose feierten eine „Arme Würstchen Party“ im Jobcenter

Quelle      :        Scharf  —  Links

Von KEAs e.V. und Initiative erwerbslos nicht wehrlos

Verleihung der Auszeichnung „Goldener Haufen rassistischer/klassistischer Scheiße“ an die Leitung des Jobcenters Köln-Porz

Anlass der Party war ein anonymer Beleidigungs- und Drohbrief, der per Hauspost an die Beratungsstelle Die KEAs e.V. (Kölner Erwerbslose in Aktion) gesendet wurde und mit offiziellem Stempel aus dem Jobcenter versehen ist . In diesem Brief werden Beratende und Alg II-Bezieher*innen pauschal als “Arme Würstchen“, „ Penner“ , „lächerlicher Haufen Scheiße“ und „ Asis und Kanaken“ bezeichnet. Die heutige Party war die Antwort der Initiative erwerbslos nicht wehrlos darauf .

Der Einladung folgten über dreißig Menschen, die eine stimmungsvolle Party mit Musik, Tanz uvm. im Wartebereich des Jobcenters feierten. Schmunzelnde sog. „Kunden „ im Wartebereich, Verteilung von Ballons an Kinder, sichtlich überforderte Mitarbeiter*innen und Sicherheitsdienst und immer wieder die Forderung, die Leitung möge sich her bemühen um ihren hart bzw. „hartz“ verdienten Preis entgegen zu nehmen – den goldenen Haufen rassistischer/ klassistischer Scheiße.

Die Preisträgerin ließ eine halbe Stunde auf sich warten, dennoch wurde sie mit einem hartzlichen Applaus begrüßt.

Auf den Wunsch der Preisträgerin hin wurde die Preisverleihung vor das Gebäude verlegt. Dort wurden die Gäste bereits von ca. 20 Polizist*innen erwartet. Trotz kleinerer Störungen seitens der Beamt*innen, wurde der Leitung der anonyme Beleidigungs- und Drohbrief verlesen. Die Jobcenter Leitung nahm den Inhalt desinteressiert auf und beauftragte im Anschluss die Beamten, die Personalien der Demonstrierenden festzustellen.

Diese Reaktion bestätigte die Jury in der Entscheidung, dass sie eine wirklich würdige Preisträgerin ist. Nach einer kurzen Laudatio und der Überreichung des goldenen Haufens rassistischer/ klassistischer Scheiße wollten die Protestierenden das Gelände verlassen. Einigen gelang dies, andere wurden auf dem Parkplatz von der Polizei eingekesselt oder vom öffentlichem Raum zurück auf das Jobcenter Gelände gezerrt. Dieses Vorgehen diente der Feststellung von Personalien, auch wenn dies nicht bei allen gelang.

File:Protest - "Hartz 4 macht nackig".JPG

Hiernach wurde noch auf der Straße bei Snacks und Grillwurst heiter weiter gefeiert und gefleyert.

Es bleibt dabei – Widerstand lohnt sich! Der Ausgangspunkt der Proteste und des Schreibens vom Jobcenter, war eine besonders böswillig und rassistisch agierende Fallmanagerin – Fr. A.. Diese soll laut mehrerer Betroffener seit Anfang September immerhin nicht mehr in Erscheinung getreten sein (erste Aktion: https://www.die-keas.org/Jobcenter%20Porz%20Begleitung ).

„Ihr werdet uns nicht los, wir sind viele und werden mehr.“ so die Ansage von Kim O. .

Hartz IV abschaffen!

Reichtum verteilen!

Armut abschaffen! 

Initiative erwerbslos nicht wehrlos & KEAs e. V.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————-

Grafikquellen       :

Oben      —          Scharf-Links

privat     —   KEAs

———————————-

Unten       —  

„Hartz 4 macht nackig“.
Date
Source Own work
Author High Contrast
Permission
(Reusing this file)
I, the copyright holder of this work, hereby publish it under the following license:
w:en:Creative Commons
attribution

Abgelegt unter Deutschland, HARTZ IV, Köln, Nordrhein-Westfalen | Keine Kommentare »

Climate: Justice – Chaos ?

Erstellt von DL-Redaktion am 4. Oktober 2019

Wetterfeste FFF Bewegung

Quelle      :  Scharf  —  Links

Von Jimmy Bulanik

Das Thema von FFF ist das Klima. Deshalb gilt es für die Bewegung unabhängig an Lebensjahren, Raum der Sozialisierung, gegenwärtiger Aufenthaltsort (wie von Besucherinnen und Besucher einer Messe oder Touristinnen und Touristen), Bildungsgrad, soziale Stellung in der Gesellschaft und Wohnorten mit ihrer Wetterfestigkeit wie der aktuell bevorstehenden Herbstferien auch zur Weihnachtsferien, Weihnachtszeit 2019, im Übergang zum Jahr 2020 das bestehende Ausmaß an Entschlossenheit öffentlich und medial unter Beweis zu stellen. Das stärkt ihre bereits bestehenden Glaubwürdigkeit im Inland als auch im Ausland. Sofern die Menschen in der Bundesrepublik Deutschland weiter unbeirrt Freitags für das Klima demonstrieren, desto höher die Chance das die Menschen im EU Ausland es vor Ort gleich handhaben werden.

Insbesondere die Menschen in Großstädten mit ihrem vorhandenen ÖPNV stehen in der Verantwortung. Ebenfalls wichtig dabei ist, dass von allen Landeshauptstädten, der Bundeshauptstadt Berlin, den EU Großstädten und EU Hauptstädten ein sichtbares und hörbares Signal ausgesendet wird, das weltweit nicht zu ignorieren ist. Jene Menschen welche im Umland einer Landeshauptstadt, Großstadt, EU Hauptstadt wohnen haben die Option eine Gemeinschaft zu bilden um gemeinsam in einer Großstadt vor Ort an den FFF Veranstaltungen teilzunehmen. Um Hürden abzubauen, gerne sich an die eigene Familie, Freundeskreis, ein (Sport) Verein, die Gewerkschaft oder eine Partei zu wenden um nach Unterstützung zu fragen. Einen Mangel an Fahrräder wird es mit Sicherheit nicht geben. Eine weitere Möglichkeit besteht darin Geld zusammenzulegen damit mehrere Personen auf ein ÖPNV Ticket fahren dürfen. Was allen offen steht ist die Menschen im persönlichen Zirkel, Zirkeln in jeglicher Form der analogen, digitalen Form der Kommunikation zu motivieren auch an den FFF Demonstrationen teilzunehmen. Die Bundesrepublik Deutschland hat viele Rentnerinnen und Rentner, Pensionärinnen und Pensionäre dessen Bedeutung an politischen Wahlen stetig wächst.

In der Thematik der Verschmelzung von Ökologie, Ökonomie und Soziales insbesondere in Verbindung mit der Digitalisierung befindet sich erheblich viel an positiver und progressiver Macht. Mitunter die Behandlung einer globalen Frage des bestehenden und zukünftigen System. Dies darf gerade in global volatilen Zeiten zu keinem Zeitpunkt unterschätzt werden und immer richtig eingeordnet. Menschen die an Kapitalmärkten, Banken, Unternehmungen dahinter arbeiten wissen dies nur zu präzise. Deshalb ist es ratsam das teilnehmende Personen an den FFF Demonstrationen mittels des dem Smartphone, Laptop, dem Internet ungefiltert Öffentlichkeit schaffen. Für die Qualität sind alle selbst verantwortlich und können sich dahingehend gemeinsam und gegenseitig fachlich optimieren.

Die Motive zur Teilnahme an den FFF Demonstrationen gibt es genug. Die neueste Augenwischerei der gegenwärtigen Bundesregierung in Sachen Klimapolitik ist aktuell lediglich eines davon.

Die innerdeutsche Landschaft der politischen Parteien wird die Entwicklung der FFF Demonstrationen bemerken. Es obliegt allen Menschen ob sie und ihre legitimen Inhalte und Ziele von der bestehenden Bundesregierung weiter ernst genommen werden oder ob die Parteien der neoliberalen FDP und der menschenverachtenden AfD, dessen Funktionär Höcke laut Gericht als Faschist betitelt werden darf bei ihren bevorstehenden Veranstaltungen zum Karneval im Jahr 2020 im Fernsehen in der Live Übertragung wie beispielsweise der politische Aschermittwoch hämische Witze auf Kosten von über 1,4 Millionen Menschen in der Bundesrepublik Deutschland, weitere Millionen Menschen in der Europäischen Union und weltweit der FFF, Klima Demonstrantinnen und Demonstranten artikulieren und obendrein dafür noch Applaus bekommen werden und beim geneigten Publikum lautes Gelächter auslösen werden. Die deutsche und internationale Industrie wie zum Beispiel der Automobilindustrie, Pharma Konzerne  würde es ihren Erfüllungsgehilfinnen und Erfüllungsgehilfen in den politischen Parteien mittels Aufträge, Posten und monetäre Zuwendungen danken.

Daher ist es allen möglich sich wetterfeste Kleidung anzuziehen, sich ökologisch und gerecht gehandelten vegetarisch oder veganen Proviant vorzubereiten und Fairtrade Kaffee, Kräutertee in einer Thermokanne auf die FFF Demonstrationen mitzunehmen. Von Menschen aus Südkorea habe ich vor vielen Jahren in meinem Leben gelernt, das diese ziemlich gerne eine warme Suppe in einer Thermokanne transportieren um dies außer Haus zu genießen. Vielleicht ist dies in kalten Zeiten auch etwas für die Menschen im Herzen oder Westen von Europa, bzw. der Europäischen Union.

Quelle:

https://fridaysforfuture.de

Bodo Wartke – Hambacher Wald

https://www.youtube.com/watch?v=tTKcnlp0x_Y

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————-

Grafikquelle      :

Wellington, Neuseeland, 15. März 2019