DEMOKRATISCH – LINKS

                      KRITISCHE INTERNET-ZEITUNG

RENTENANGST

Archiv für die 'Deutschland' Kategorie

Stadtgespräch aus Neukölln

Erstellt von DL-Redaktion am 13. Dezember 2019

Hipsterkiez mit Hakenkreuzen
Rechte Anschlagserie in Berlin-Neukölln

Von Malene Gürgen

Die rechten Taten bleiben weitgehend unter dem Radar der bundesweiten Öffentlichkeit. Doch die Opfer wissen ganz genau, wer gemeint ist.

Vielleicht wäre es einfacher, wenn Neukölln in Sachsen läge. Oder wenigstens am östlichen Rand von Berlin. Vielleicht wäre es einfacher, öffentliches Augenmerk auf eine aktuelle, unaufgeklärte rechtsextreme Terrorserie zu lenken, auf mangelnde Ermittlungserfolge und eine mögliche Verstrickung der Sicherheitsbehörden, wenn die Geschichte an einem Ort spielte, von dem man das erwartet: Neonazis, die Anschläge begehen, Polizei und Verfassungsschutz, die mindestens wegschauen.

Aber diese Geschichte spielt in Berlin-Neukölln. Ein Großteil der mehr als 60 Angriffe, Anschläge und Brandstiftungen, die der seit Mai 2016 laufenden Serie zugerechnet werden, ereignet sich dort, wo auch die mutmaßlichen Täter zu Hause sind, im Süden des Bezirks, viel weniger großstädtisch und viel weniger medial bekannt als der Norden. Aber ab und an trifft es auch den Norden, der dem Rest der Republik wahlweise als Hipster-Mekka oder Clankriminalitäts-Gruselmärchen bekannt ist. Zum Beispiel in dieser Woche, als die Fenster eines Imbissrestaurants, eines Spätkaufs sowie ein Treppenhaus großflächig mit Hakenkreuzen und SS-Runen besprüht wurden.

Vielleicht wäre es mit der bundesweiten Aufmerksamkeit auch einfacher, wenn durch diese Anschlagserie Menschen nicht nur eingeschüchtert, finanziell belastet und psychisch zermürbt würden, sondern wenn schon Menschen körperlich zu Schaden gekommen wären, so richtig. Bei Ferat Kocak, kurdischstämmiger Lokalpolitiker der Linkspartei, wäre es damals fast so weit gewesen, in einer Februarnacht 2018, als sein Auto nur ein paar Zentimeter neben der durchs Einfamilienhaus verlaufenden Gasleitung verbrannte.

Der Betreiber des Imbisses, auf dem am Dienstagmorgen große rote Hakenkreuze prangten, ist ein naher Verwandter von Ferat Kocak. Ob sich die Einschüchterung gegen ihn und seine Familie richtet oder allgemein gegen ein migrantisches Neukölln, ob die Täter dieselben waren wie die, die Kocaks Auto anzündeten, werden die Ermittlungen zeigen, würde man gern schreiben. Allein, die Ermittlungen haben in dieser Sache überhaupt noch nie irgendetwas gezeigt, weder jetzt noch bei der letzten Serie vor acht Jahren, als beispielsweise eine Einrichtung der Falken so oft attackiert wurde, dass die Jugendarbeit dort bis heute hinter einem meterhohen Hochsicherheitszaun stattfindet.

Tatort: Wildenbruchstraße

Gedenktafel Wildenbruchstr 10 (Neuk) Günter Bodek.JPG

Die beschmierten Häuser befinden sich in der Wildenbruchstraße, die in der Liste der Tatorte dieser Serie bereits mehrfach auftaucht: 2016 deponierten Unbekannte einen Brandsatz vor einem linken Café, ein weiteres Lokal, das als Treffpunkt linker und migrantischer Gruppen dient, wurde schon zweimal attackiert, zuletzt vor wenigen Wochen. Ebenfalls in der Wildenbruchstraße, Ecke Sonnenallee, befindet sich in einem imposanten Gebäude: die Polizeidienststelle Direktion 5, Abschnitt 54.

Quelle          :           TAZ         >>>>>         weiterlesen

——————————————————————

Grafikquellen           :

Oben         —      Berlin-Neukölln,

This work has been released into the public domain by its author, Alex1011 at German Wikipedia. This applies worldwide.

—————————

Unten          —    Memorial plaque, Günter Bodek, Wildenbruchstraße 10, Berlin-Neukölln, Germany

Abgelegt unter Berlin, Bildung, Religionen, Überregional | Keine Kommentare »

Transport nach Russland

Erstellt von DL-Redaktion am 12. Dezember 2019

Gronau: Nächster Atommüll-Export blockiert

File:Urananreicherungsanlage der Firma Urenco in Gronau (6964380303).jpg

Quelle       :        untergrund-blättle  CH.

Von   pm

Erneut blockieren Aktivist_innen einen Zug mit Uranmüll der Firma Urenco, der auf dem Weg nach Russland ist. Vorerst kann er nicht weiter fahren, da sich eine Person von der Autobahnbrücke bei MS-Häger über die Schienen abgeseilt hat.

Transparente in russisch und deutsch fordern den Stopp der umstrittenen Transporte: „Keine Atommüll Exporte nach Russland“ und „Gronau stilllegen“ ist dort zu lesen. Dadurch wollen sie ihre Solidarität mit den Menschen in Russland sowie den gemeinsamen Protest zeigen.

Die Blockade ist bei weitem nicht die einzige Protestaktion im Zusammenhang mit diesem Transport, der von seinem gewöhnlichen Fahrplan abwich. Geplant war der Transport an diesem Montag. Vom Münsterland über das Ruhrgebiet und die Niederlande bis hin nach Amsterdam haben zahlreiche Initiativen zu Mahnwachen und Aktionen entlang der Strecke aufgerufen, in Russland werden die Proteste ebenfalls unterstützt. Sogar von dort sind Menschen angereist, um auf das Thema aufmerksam zu machen.

Die Aktivist_innen freuen sich darüber: „Es ist wichtig, zu kämpfen,“ sagt Anne. „Die Exporte nach Russland zeigen einmal mehr, dass Atomkraft ein schmutziges Geschäft ist und dass alle Anlagen abgeschaltet gehören.“ „Mit der Urananreicherungsanlage fangen wir an,“ fügt ihr Mitstreiter hinzu.

Sie sind zuversichtlich, denn die Menschen wirken entschlossen und der Widerstand wächst: „Aufgrund der Proteste konnte der Zug gestern nicht fahren und wird womöglich das Schiff nach St. Petersburg verpassen. Ein klares Zeichen, dass wir erfolgreich sind!“

Bereits der Transport vor drei Wochen war für viele Stunden blockiert worden und hatte für internationale Schlagzeilen gesorgt. Wie sich gestern gezeigt hat, nehmen die Proteste nicht ab. Schliesslich will die Firma Urenco noch zehntausende Tonnen Uranmüll exportieren, die bei der Urananreicherung entstehen.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————–

Grafikqueqelle    :    Urananreicherungsanlage der Firma Urenco in Gronau   –  Torbereich der Anlage

Source Urananreicherungsanlage der Firma Urenco in Gronau
Author UAA Nee
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license.
Checked copyright icon.svg This image was originally posted to Flickr by UAA Nee at https://flickr.com/photos/77741985@N07/6964380303. It was reviewed on by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc-by-sa-2.0.

Abgelegt unter International, Nordrhein-Westfalen, Regierung, Wirtschaftpolitik | Keine Kommentare »

Augsburg-Weihnachtsmarkt

Erstellt von DL-Redaktion am 12. Dezember 2019

Ein merkwürdiges Verbrechen

Ein Kommentar von

In Augsburg ist ein Mann durch eine Gewalttat zu Tode gekommen. Ein anderer Mann ist verletzt worden. Die öffentliche Behandlung dieses Geschehens wirft ein grelles Schlaglicht auf den Zustand der Gesellschaft.

Merkwürdigkeit

„Aktenmäßige Darstellung merkwürdiger Verbrechen“ nannte einst der Wirkliche Staatsrat und Präsident des Appellationsgerichts Ansbach, der Strafrechtslehrer Paul Johann Anselm Ritter von Feuerbach eine von ihm herausgegebene Sammlung von Kriminalfällen. Er meinte mit „merkwürdig“ nicht „seltsam“, sondern: bemerkenswert. Und als bemerkenswert erschienen ihm die Fälle, weil man daraus etwas lernen konnte: Über die Taten, die Menschen, die sie begehen und erleiden, die Aufklärung und das Recht, das sie als strafwürdige Taten erfassen und „würdigen“ will. Seit dem Jahr 1828, als Feuerbach sein Buch veröffentlichte, hat sich die Schlagzahl der Berichte über Straftaten vertausendfacht. Die daraus zu ziehenden Lehren haben sich nicht im selben Maß entwickelt.

Seit dem 6. Dezember ist wiederum die Rede von einem merkwürdigen Verbrechen: In Augsburg ist ein Mann durch Gewalteinwirkung getötet worden; ein zweiter Mann wurde verletzt. Wenn man den seither anhaltenden Verlautbarungen und Berichten folgt, ist die Tat, vorab und auf jeden Fall, als entsetzlich, grauenhaft, fürchterlich, schockierend, zutiefst verstörend, unfassbar usw. zu bezeichnen. Alles andere wäre fast schon wieder selbst ahndungswürdig, da es „verharmlost“, die Opfer missachtet, die Realität verkennt, Verbrechen entschuldigt, usw. Man kann sich also vermutlich, sofern man nicht alsbald, ungefragt und bedingungslos in das lautest mögliche Wehgeschrei einstimmt, nur unbeliebt machen, mindestens aber verdächtig der Förderung von Gewalt, Verrohung und Menschenverachtung.

Dennoch ist es notwendig, auf Distanz zum Geschehen zu gehen, ein wenig Luft zu holen und die Geschehnisse von außen zu betrachten. Im Gegensatz zu den teils erlogenen, teils erfühlten Eindrücken, die rund um die Uhr vermittelt und berichtet werden, befinden sich nämlich annähernd 100 Prozent aller Menschen im „Außen“ des Geschehens: Sie sind nicht betroffen, auch wenn sie noch so laut ihre „Betroffenheit“ versichern. Sie waren nicht dabei, auch wenn sie noch so lang die Fotos vom Tatort anschauen. Und sie sind nicht Teil des nun ablaufenden „Verfahrens“ medialer, strafrechtlicher, politischer Art, sei es als Verletzte oder Hinterbliebene, sei es als Beschuldigte oder (deren) Angehörige.

Pressekonferenz

Bitte überlegen Sie einmal, wann Sie zuletzt in ARD oder ZDF eine live übertragene polizeiliche Pressekonferenz von 50 Minuten Dauer gesehen haben, und bei welchem Tat-Ereignis das der Fall war. Ich denke, da wird vielen gar nichts einfallen, andere werden vage Erinnerungen an Terroranschläge, andere katastrophale Ereignisse oder ungewöhnlich gravierende Ermittlungsverfahren haben. Zu den im vergangenen Jahr von der Polizei registrierten 3.200 vollendeten oder versuchten Tötungsdelikten hat die ARD, soweit ich weiß, keine Live-PK bundesweit übertragen.

Vor den Kameras: Ein Polizeipräsident, ein Leiter der Kriminalinspektion, ein Leitender Oberstaatsanwalt. Jeder der drei hat viele Jahre Berufserfahrung. Jeder weiß, was ein Totschlag ist, was eine Körperverletzung. Jeder kennt den Unterschied zwischen Jugendlichen und Erwachsenen, die Voraussetzungen für Haftbefehle und für Verurteilungen. Jeder kennt die Statistiken über Gewaltdelikte, und hat schon viele hundert Verfahren wegen solcher Delikte gesehen. Von all diesen Erfahrungen fließt in die Statements der drei Auskunftspersonen ein: Nichts. Und keiner der zahlreichen Journalisten fragt danach. Der Polizeipräsident versichert, er sei über die Tat ganz besonders betroffen, weil der „Blaulichtsektor“ (Polizei, Feuerwehr, Rettungsdienste) in Augsburg besonders gut zusammenarbeiten, und lobt die herausragend gute Zusammenarbeit in der vorliegenden Sache. Der KPI-Leiter erklärt ein ums andere Mal, wie ganz außerordentlich gut, erfolgreich und perfekt er und die von ihm geleitete Inspektion gearbeitet haben. Die „20-köpfige Ermittlungsgruppe“ habe in „herausragender Polizeiarbeit“ die Tat aufgeklärt und alle Verdächtigen festgenommen. Etwas später erläutert er: Ein Jugendlicher habe der Polizei auf Befragen mitgeteilt, er könne sich vorstellen, wer bei der Tat dabei gewesen sein könnte. Von diesem Hinweis aus habe man die Täter ermittelt. Dagegen ist nichts einzuwenden. Es ist allerdings nicht „herausragend“, sondern ziemlich schlichte Routinearbeit.

Der Leitende Oberstaatsanwalt (LOStA) bittet um Entschuldigung dafür, dass „seine Kapitaldezernentin“ (er meint: die für Tötungsdelikte zuständige Staatsanwältin) nicht anwesend sei: Gerade im Moment sei sie beim Amtsgericht, „um Haftbefehle zu erwirken“. Fünf habe sie schon erwirkt, er hoffe, dass er noch im Laufe der PK für die weiteren zwei Vollzug melden könne.

Alle sieben Haftbefehle sind, wie man erfährt, wegen dringenden Verdachts des Totschlags (ein Beschuldigter) bzw. der Beihilfe dazu (sechs Beschuldigte) am ersten Opfer sowie der gefährlichen Körperverletzung (alle sieben Beschuldigte) am zweiten Opfer ergangen. Das ist aus verschiedenen Gründen wichtig, vor allem deshalb, weil nach § 112 Abs. 3 StPO bei Verdacht eines Totschlags ein so genannter „Haftgrund“ nicht erforderlich ist: Die Annahme von Totschlagsverdacht führt auch ohne Flucht, Fluchtgefahr oder Verdunkelungsgefahr zur Anordnung von Untersuchungshaft. LOStA und KPI-Leiter erwähnen diesen Umstand nicht. Es trifft sich freilich gut, dass man der in Angst, Schrecken und Zorn aufgewühlten Bevölkerung und „Social-Media“-Nation nicht erklären muss, was Haftgründe sind und warum man Jugendliche mit „mehreren Staatsangehörigkeiten“ eventuell nicht in Haft genommen hat. Erst mal einsperren ist immer gut. Bayern ist sicher.

Tatverdacht

Die Sache selbst blieb in der Pressekonferenz im Vagen. Das Geschehen, aufgezeichnet von einer Überwachungskamera, soll sich nach Auskunft der Polizei innerhalb weniger Sekunden abgespielt haben: Die Opfer-Gruppe ging zunächst an der Tätergruppe vorbei; dann dreht sich das spätere erste Opfer um und ging auf die sieben Personen zu. Diese „umringten“ ihn kurz, es wurde geredet; dann schlug einer unvermittelt mit der Hand gegen den Kopf. „Und das führte so zum Tod“, wiederholte der KPI-Leiter gleich mehrmals; auf weitere Journalistenfragen gab es „aus Gründen des Opferschutzes“ keine Auskunft. Diese Schilderung lässt natürlich alles offen. Das kann vielleicht auch gar nicht anders sein, weil man halt noch nicht mehr weiß. Aber man sollte dann nicht so tun, als stünden irgendwelche ausschlaggebenden Tatsachen schon fest.

Quelle         :           Spiegel-online         >>>>>        weiterlesen

————————————————————-

Grafikquelle         :

Oben        —        Augsburger Christkindlesmarkt

————————————-

Unten              —         Thomas Fischer auf der re:publica 2016

Abgelegt unter Bayern, Deutschland, Justiz-Kommentare, Schicksale | Keine Kommentare »

Zerwürfnisse in der Linken

Erstellt von DL-Redaktion am 12. Dezember 2019

Linke muss noch mal nachsitzen

Sahra Wagenknecht and Dietmar Bartsch. Hannover Parteitag 2017.jpg

Sagt zum Abschied – bitte servus  ……..

Von Anna Lehmann

Auch im Drittel Anlauf scheitern die KandidatInnen, die Linke im Bundestag kriegt einfach keinen Vorstand zusammen. Die Gräben in der Fraktion.

Wieder eine Wahlniederlage für die Linke, diesmal eine interne. Dreimal hat die Partei im Bundestag versucht, ihren Fraktionsvorstand neu zu wählen. Auch nach dem dritten Wahlgang am Dienstag schafften es die Genossen nicht, ihren Vorstand in Gänze neu zu besetzen. Von der Aufbruchstimmung, die die beiden Fraktionschefs Amira Mohamed Ali und Dietmar Bartsch nach ihrer Wahl Mitte November verbreiten wollten, kann derzeit nicht die Rede sein. Abgeordnete sprechen vielmehr von desaströsen Zuständen.

Zwei Posten sind im 13-köpfigen Vorstand nach wie vor unbesetzt: ein Vize und die Stelle der Beauftragten für soziale Bewegungen. Für den Vizeposten kandidierten am Dienstag erneut Nicole Gohlke und Sören Pellmann. Während Pellmann, der bei der Bundestagswahl ein Direktmandat in Leipzig holte, der Wunschkandidat der Fraktionschefs ist, trat Gohlke als Repräsentantin der sogenannten Bewegungslinken an. Diese sehen sich als Initiative zur Erneuerung der Partei, die laut eigener Erklärung weg will von der „innerparteilichen Selbstzerfleischung“. Das offizielle Gründungstreffen findet an diesem Wochenende in Berlin statt.

Doch weder Pellmann noch Gohlke erreichten die nötige absolute Mehrheit von 35 der 69 Abgeordnetenstimmen. Für Gohlke stimmten 32 Abgeordnete, für Pellmann 31. Der Rest enthielt sich oder war nicht vor Ort. Ein klassisches Patt also.

Amira Mohamed Ali Rheda.jpg

Das gleiche Bild bei der Besetzung des dritten Postens, des Beauftragten für soziale Bewegungen. Dieser Vorstandsposten existiert erst seit 2017 und zwar als Konzession an das Lager um die Parteivorsitzende Katja Kipping. Lorenz Gösta Beutin, der klimapolitische Sprecher, trat zweimal an und scheiterte zweimal ohne GegenkandidatIn. Während er vor einem Monat mit 34 Stimmen knapp durchfiel, stimmten nun nur noch 24 Abgeordnete für ihn.

Wie zwei ineinander verkeilte Böcke

Er werde nicht noch einmal antreten, sagte Beutin der taz. Von der Klimakonferenz aus Madrid äußerte er sich ernüchtert über den Ausgang der Wahlen: „Die Hoffnung, dass mit der Neuwahl der Fraktionsspitze auch frischer Wind in die Fraktion kommt, hat sich erst einmal nicht erfüllt.“ Nun müsse die Führung in sich gehen und überlegen, wie sie diese Fraktion zusammenbringen wolle, um wieder handlungsfähig zu werden.

Aus dem Büro von Pellmann hieß es, er wolle erneut kandidieren. Gohlke ließ das noch offen.

Quelle        :         TAZ         >>>>>          weiterlesen

——————————————————————

Grafikquellen         :

Oben         —         Die Spitzenkandidaten der Linkspartei für die Bundestagswahl 2017, Sahra Wagenknecht und Dietmar Bartsch, während des Bundesparteitages der Linken. 2. Tagung des 5. Parteitags der Linken. Vom 9. bis 11. Juni 2017 in Hannover.

—————————-

Unten      —         MdB Amira Mohamed Ali (DIE LINKE) redet auf einer Veranstaltung in Rheda, Nordrhein-Westfalen.

Abgelegt unter Berlin, Bundestag, P. DIE LINKE, Überregional | Keine Kommentare »

Solidarität unter Studenten

Erstellt von DL-Redaktion am 11. Dezember 2019

 Hallo Hongkong  – Schaut auf diese UNI !

Datei:Eingangsgebaeude TU Darmstadt.jpg

Aus Darmstadt von Kevin Culina

Studierende der TU Darmstadt solidarisieren sich mit den Protesten in Hongkong. Darunter zwei Austauschstudenten aus China. Anderen Landsleuten geht das zu weit.

Es ist eine erstaunliche Kooperation: Lee aus Hongkong, groß und mit Brille, der sagt, dass er für Frieden und Demokratie in Hongkong bete. Und Franklin aus China, etwas kleiner, der schnell und aufgeregt spricht und seine Argumente mit unzähligen Videos zu untermauern sucht. Beide studieren in Darmstadt und sorgen sich um die Zukunft Hongkongs. So sehr, dass sie zu drastischen Worten greifen. „Ich sehe hier, von außen, wie meine Hongkonger Freunde vielleicht vernichtet werden“, sagt Lee und wirkt dabei sehr ergriffen. Die beiden Austauschstudenten haben beschlossen, nicht mehr länger zusehen zu wollen, wie die Demokratie in der Sonderverwaltungszone vor die Hunde geht.

Seit Mai dieses Jahres protestieren immer wieder Zigtausende Hongkonger gegen den zunehmenden politischen Einfluss aus China. Die Peking-nahe Regierung geht gewaltsam gegen die Proteste vor, Demonstrant*innen liefern sich immer wieder Straßenschlachten mit der Polizei. Zum Sinnbild des Protestes wurde die gewaltsame Räumung der Polytechnischen Universität. Weltweit solidarisierten sich Politiker*innen, Künstler*innen und natürlich Hochschulen mit den Hongkonger Studierenden (siehe Spalte).

Einstimmig für Resolution

So auch in Deutschland. Unter anderem in Lüneburg, Heidelberg und Berlin haben sich Studierendenvertretungen solidarisch mit Hongkong erklärt – und dank Lee und Franklin auch in Darmstadt. Mit vier weiteren Mitstreiter*innen initiierten sie eine Resolution. „Solidarität mit Protesten in Hongkong“ heißt sie und wurde am 20. November einstimmig vom Studierendenparlament der Technischen Universität Darmstadt beschlossen. Doch wie auch an anderen Hochschulen sind nicht alle mit dieser Resolution einverstanden.

In Darmstadt sei eine über 10-köpfige Delegation des Vereins der Chinesischen Wissenschaftler und Studenten in Darmstadt (VCWSD) in den Büroräumen der Studierendenvertretung aufgetaucht und habe eine Rücknahme der veröffentlichten Resolution gefordert, erinnert sich AStA-Vorstand Felix Ziegler. „Das Auftreten war teilweise feindselig“, beschreibt er den Besuch. Man habe versucht, im Gespräch den Entstehungsprozess verständlich zu machen, aber „aus dem Gespräch ist keine Versöhnung mehr entstanden“. Die Delegation habe angekündigt, „weiter gegen uns vorgehen zu wollen und Proteste zu planen“, so Ziegler.

Unter ausländischen Studierenden an deutschen Universitäten ist die Gruppe der Chinesen am größten, 42.676 waren es im Wintersemester 2018/19. Wie viele Chinas Rolle in Hongkong kritisch sehen, ist schwer zu sagen. Lee und Franklin zumindest sind zwei von ihnen. Lee studiert Informationstechnik, arbeitet zudem bei einem großen deutschen Technikunternehmen. Seinen vollen Namen will er nicht in der Zeitung lesen. Er hat Angst vor Verfolgung. Anlass dazu geben ihm die hitzigen Diskussionen über die Rolle Chinas in Hongkong, die nicht nur an seiner Hochschule entbrannt sind. So berichtet der AStA der TU Berlin von Morddrohungen nach ihrer Soli-Aktion mit Hongkong. Einschüchtern wolle man sich jedoch nicht lassen.

191001 HK police draws gun against protesters 01.jpg

Auch Franklin ist besorgt. Der 23-Jährige, der eigentlich anders heißt, wohnt erst seit Kurzem in Darmstadt, studiert Maschinenbau. Das Leben in Deutschland ermögliche ihm „persönliche und akademische Freiheit“, die er aus China nicht kenne. In seiner Heimat sieht Franklin derzeit keine Zukunft für sich. „Mir war früh klar, dass ich raus will aus China“, sagt der im Südwesten des Landes aufgewachsene junge Mann. „Das chinesische Regime bedroht die Freiheit der Welt“, sagt er. Und, „wir müssen etwas gegen die aufstrebende Macht der Regierung unternehmen“, insbesondere an einem auch für China so wichtigen Technikstandort wie Darmstadt.

Bei vielen seiner Kommiliton*­innen stoßen Lee und Franklin mit ihrem Anliegen auf offene Ohren. So bewundert das Studierendenparlament in seiner Resolution den „Mut“ der Demonstrant*innen, „trotz der lebensbedrohlichen Umstände für ihre Grundrechte und die Menschenrechte in Hong Kong einzustehen“, und verurteilt „die kompromisslose, gewalttätige und menschenrechtsverletzende Vorgehensweise der Regierung und der Polizei“. Außerdem solle die TU Darmstadt prüfen, ob Kooperationen und Austauschprogramme mit den Partneruniversitäten in Hongkong angesichts der Polizeigewalt „noch ethisch tragbar sind“.

Die TU Darmstadt sieht jedoch „keinen Anlass“, die Kooperationen mit den Partner­uni­versitäten in Hongkong „in irgendeiner Weise einzuschränken“, heißt es in einer Stellungnahme. Man betrachte „enge internationale Beziehungen zwischen Hochschulen unter demokratischen Bedingungen als sehr sinnvoll“ und schätze die „‚Brücken bauende‘ Funktion von Netzwerken“, heißt es. Man biete Darmstädter Austauschstudierenden jedoch eine umgehende Rückholung an. Einer von vier hätte dieses Angebot angenommen.

Ähnlich zurückhaltend ist auch die Hochschulrektorenkonferenz (HRK): „Nach aller Möglichkeit sollten die Kommunikationskanäle, gerade auch in schwierigen Zeiten, offen gehalten werden“, heißt es auf Anfrage der taz. Der Zusammenschluss deutscher Hochschulen und Universitäten wolle den „akademischen Austausch“ aufrechterhalten und „gerade jetzt eine wichtige Stütze sein“, so die HRK. Fast wortgleich plädiert auch der Deutsche Akademische Austauschdienst (DAAD) für die Fortführung bestehender Programme.

 

Quelle         :      TAZ       >>>>>          weiterlesen

Taiwan bietet Asyl und Studienplätze

2019-10-01 Demonstration Hong Kong 08.jpg

Aus Thaipeh von Felix Lee

Nirgendwo ist Unterstützung für die Hongkonger Demokratiebewegung so groß wie auf der Nachbarinsel. „Wir wollen zeigen, wie gastfreundlich wir Taiwaner sind“. Chou Chia-pei, NTU-Vizepräsidentin.

Von außen ist der Presbyterianischen Kirche von Taipeh nicht anzusehen, dass sie ein Hort des Widerstands ist. Die Kirche steht neben dem Parlamentsgebäude im Zentrum von Taiwans Hauptstadt. Gegenüber erstreckt sich das weitläufige Geländer der NTU, der renommiertesten Universität des Inselstaats. In einem Lagerraum der Kirche stehen Kisten mit Helmen und Gasmasken. Die Kirche wolle die Kisten demnächst nach Hongkong transportieren, sagt Hsu Hanyu. Mit den Gasmasken sollen sich die Demokratieaktivisten vor dem Tränengas der Polizei schützen können.

Hsu, 27, ist Mitglied der Sozialdemokratischen Partei Taiwans und war 2014 Teil der Sonnenblumen-Bewegung. Ihre Anhänger:innen hatten damals für mehrere Wochen das Parlamentsgebäude besetzt. Sie protestierten gegen die Annäherung der prochinesischen Regierung unter der konservativen Partei Kuomingtan (KMT). Seit vier Jahren ist mit der Demokratischen Fortschrittspartei (DPP) allerdings eine Regierung im Amt, die den China-freundlichen Kurs der Vorgängerregierung ablehnt und für eine offizielle Loslösung Taiwans von der mächtigen Volksrepublik eintritt, die Taiwan als „abtrünnige Insel“ betrachtet. Umso stärker setzt sich Hsu nun für die Demokratiebewegung in Hongkong ein. „Wir haben schließlich denselben Feind.“

Quelle          :         TAZ         >>>>>          weiterlesen

—————————————————————

Grafikquellen       :

Oben         —           Das Foto zeigt das neue Eingangsgebäude („Karo5“, Vordergrund), das Verwaltungsgebäude (rechts) und das Audimax-Gebäude (links) der TU Darmstadt.

Urheber Che010      /  Quelle    :    Eigenes Werk

Ich, der Urheberrechtsinhaber dieses Werkes, veröffentliche es als gemeinfrei. Dies gilt weltweit.

———————–

2.) Von Oben      —    Police draws gun against protesters, then shot warning rounds to the sky.

Unten      —       Hongkong    –     Demonstration against extradition bill, 1 October 2019

Abgelegt unter Asien, Bildung, Deutschland, Hessen, Mensch | Keine Kommentare »

Bewegung in der LINKEN?

Erstellt von DL-Redaktion am 11. Dezember 2019

Die Bewegungslinke gründet neue Strömung in der Partei

Nachdem die „Aufsteher in Erstarrung“ endeten wird in der braunen Suppe erneut kräftig gerührt? – Es kann der Frömmste nicht in Frieden leben – wenn es dem bösen Nachbarn nicht gefällt ?

Quelle      :       AKL

Von Sascha Staničić

Im Dezember gründet sich die Bewegungslinke als neue Bundesarbeitsgemeinschaft in der Partei DIE LINKE. Nicht wenige Parteimitglieder, die sich dem linken Flügel verbunden fühlen, verbinden damit die Hoffnung, dass DIE LINKE sich dahin bewegt, wo sie hingehört – nach links und auf die Straße. Ein Blick auf den Entwurf der Gründungserklärung der Bewegungslinken muss aber Skepsis hervorrufen.

Die Bewegungslinke ist entstanden aus den Konflikten, die sich im Zusammenhang mit Sahra Wagenknechts migrationspolitischen Positionen in der Parteiströmung Sozialistische Linke (SL) entwickelt hatten. Eine Mehrheit der SL unterstützte den linkspopulistisch-nationalen Kurs von Wagenknecht, während eine Minderheit um die Gruppe marx21 und andere die migrationspolitischen Positionen der Partei verteidigte. Diese Minderheit stellt nun den Kern der Bewegungslinken. Allein dieser Umstand legt die Vermutung nahe, dass wir es mit altem Wein in neuen Schläuchen zu tun haben.

Vieles, was die Bewegungslinke schreibt ist nicht falsch. Sie mahnt an, dass DIE LINKE verparlamentarisiert ist und sich zu wenig um soziale Bewegungen und Gewerkschaften kümmert. Sie sagt: Weniger Sitzungen, mehr Aktionen! Und sie will sich aktiv in die gesellschaftlichen Kämpfe gegen die Auswirkungen des kapitalistischen Systems einbringen. So weit, so gut. Doch die Praxis einer Partei ist letztendlich Folge ihres politischen Programms, ihrer Klassenzusammensetzung und ihrer politischen Perspektive und Orientierung.

Sozialismus fehlt

Das grundlegende Problem der Linkspartei ist, dass sie zwar von Sozialismus redet, aber kein sozialistisches Programm und keine sozialistische Perspektive vertritt; dass ihre nicht ganz selten guten Beschlüsse nur auf dem Papier stehen und nicht in praktische Politik umgesetzt werden – zum Beispiel wenn ein Bundesparteitag nach dem anderen auf Initiative von Parteilinken die Überführung der Banken und Konzerne in Gemeineigentum fordert, der Parteivorsitzende Bernd Riexinger sich aber explizit dagegen ausspricht, die Forderung nach Überführung der Autoindustrie in öffentliches Eigentum aufzustellen und stattdessen das Ausgeben von Belegschaftsaktien fordert, die die Arbeiter*innen dann doppelt zu Opfern der Krise in der Automobilindustrie machen würden und nichts an der umweltzerstörenden und profitgetriebenen Automobilproduktion ändern würden.

Regierungsbeteiligung als Gretchenfrage

Politisch drückt sich dieser Mangel an Sozialismus in der LINKEN unter anderem darin aus, dass große Teile der Partei darauf setzen in Regierungen mit den prokapitalistischen Parteien SPD und Grünen Arzt am Krankenbett des Kapitalismus zu spielen, anstatt alle Kraft darauf zu verwenden, Menschen aus der Arbeiter*innenklasse zu organisieren, um Verbesserungen von unten zu erkämpfen und den Kapitalismus perspektivisch zu überwinden. Diese politische Ausrichtung hat dazu geführt, dass sich die Partei in verschiedenen Landesregierungen von Mecklenburg-Vorpommern bis Bremen als zahnloser Tiger erwiesen hat, wenn nicht als Bettvorleger. Nirgends kann davon gesprochen werden, dass eine Regierungsbeteiligung der LINKEN zu dem viel versprochenen Politikwechsel geführt hat; oftmals hat sie sich an Kürzungen und Privatisierungen beteiligt, die sie haben in Konflikt mit denjenigen kommen lassen, die sie eigentlich vertreten soll: Lohnabhängige, Erwerbslose, sozial Benachteiligte, Gewerkschafter*innen. Ergebnis: DIE LINKE wird von vielen als linker Teil des politischen Establishments betrachtet und sie verliert in der Regel (mit der vorübergehenden Ausnahme von Thüringen) die Unterstützung, die sie sich vor dem Eintritt in die entsprechenden Regierungen aufgebaut hatte. Die Regierungsbeteiligung mit prokapitalistischen Parteien ist konzentrierter Ausdruck des mangelhaften Programms, der falschen Politik und Perspektive der Linkspartei. So kann es keine bewegungsorientierte, klassenkämpferische und antikapitalistische Partei geben.

Praxis-Fetisch

Die Bewegungslinke setzt aber nicht an Programm und Politik der LINKEN an, sondern an ihrer Praxis. Diesen Ansatz verfolgt die marx21-Strömung schon seit Gründung der Partei – mit zweifelhaftem Erfolg. Gerade in diesem Jahr hat sich das Pendel in der Linkspartei wieder mehr nach rechts bewegt, nicht zuletzt durch die Regierungsbeteiligung der Partei in Bremen – zum ersten Mal in einem westdeutschen Bundesland. Die Fraktionsvorsitzende der LINKEN in der Bremischen Bürgerschaft ist Sofia Leonikadis, gleichzeitig einer der Köpfe der Bewegungslinken. Diese erklärt im Entwurf zu ihrer Gründungserklärung, dass an ihr auch solche Parteilinke beteiligt sind, die Regierungskoalitionen mit SPD und Grünen als Teil des Wegs zu gesellschaftlicher Veränderung sehen. Dieser Versuch sich zu waschen ohne nass zu werden ist zum Scheitern verurteilt.

Leonidakis, Sophia-9483.jpg

Eine sozialistische Parteilinke muss als Ausgangspunkt eine schonungslose Kritik der bestehenden Politik, Programmatik und Praxis der Linkspartei nehmen. Die Systemimmanenz großer Teile der Partei und die Ausrichtung auf Koalitionen mit SPD und Grünen müssen Ausgangspunkt dieser Kritik sein. Davon ausgehend kann dann eine Debatte über Inhalte und Strategien für eine Parteilinke stattfinden. Eine Parteilinke, die aber die Verwaltung des kapitalistischen Elends in Kooperation mit den Hartz IV-Parteien als eine Möglichkeit sozialistischer Politik betrachtet, bringt einen schweren Geburtsfehler mit, der sie daran hindern wird, eine wirkliche Alternative zum jetzigen Kurs der Partei zu formulieren.

Die einzige Bundesarbeitsgemeinschaft in der LINKEN, die eine solche Kritik formuliert und Koalitionen mit SPD und Grünen konsequent ablehnt ist die Antikapitalistische Linke (AKL).

Sascha Staničić ist Mitglied des AKL Länderrats und Bundessprecher der Sozialistischen Organisation Solidarität (Sol).

akl - Antikapitalistische Linke

——————————————————————

Grafikquellen      :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

——————————

Unten         — 

Sophia Leonidakis (* 27. April 1984 in Überlingen) ist eine bremische Politikerin (Die Linke) und Abgeordnete der Bremischen Bürgerschaft.

Abgelegt unter Berlin, Bremen, P. DIE LINKE, Saarland, Überregional | Keine Kommentare »

Nobelpreis für Peter Handke

Erstellt von DL-Redaktion am 11. Dezember 2019

Am Arsch der Hölle

Graves srebrenica bosnia and herzegovina.jpg

Kommentar von Doris Akrap

Peter Handke ist ein Kretin, ein Arschloch. Dass er mit dem höchsten Literaturpreis geehrt wird, hat aber etwas Gutes.

Peter Handke ist ein Kretin. Er hat die Opfer des schwersten Verbrechens im postfaschistischen Europa verhöhnt, das Verbrechen geleugnet, sich mit einem überaus unappetitlichen Regime gemein gemacht und seine Worte und Urteile weder in aller gebotenen Eindeutigkeit und Lautstärke zurückgenommen noch mit aller gebotenen Schamesröte im Gesicht bei den Opfern und ihren Angehörigen um Entschuldigung gebeten.

Peter Handke ist ein Kretin, ein Arschloch. Dennoch hat die Entscheidung, dem österreichischen Schriftsteller am 10. Dezember in Stockholm den Nobelpreis für Literatur zu verleihen, etwas ausgelöst, das gut war.

Für die Überlebenden des Massakers von Srebrenica im Jahr 1995 ist die Nobilitierung eines Mannes, der als „Genozidleugner“ bezeichnet wird, eine „existenzielle Kränkung“, so formuliert es der aus dem belagerten Sarajevo 1994 nach Deutschland geflohene Schriftsteller Tijan Sila.

Aber, und das ist das Gute, diese Entscheidung blieb nicht unkommentiert. Noch einmal musste die ganze Welt darüber reden, dass es mitten in Europa nach dem Ende des Nationalsozialismus einen Genozid gegeben hat. Noch einmal musste die ganze Welt sich fragen, wie das trotz der Losung „Nie wieder“ eigentlich passieren konnte. Noch einmal musste die ganze Welt zur Kenntnis nehmen, dass sie im Bosnienkrieg versagt hat.

Dass es dazu kam, ist der Vehemenz, der Unerbittlichkeit und der Akribie zu verdanken, mit der dem Auszuzeichnenden seine eigenen Worte um die Ohren gehauen wurden.

Noch in den 1990ern und bis in die nuller Jahre hinein hätte ich das nicht ganz so gesehen. Ich bin in meinen Ansichten zum blutigen Zerfall Jugoslawiens gefühlt drei bis fünf Mal um den Block gelaufen. Und ich kann nicht ausschließen, dass ich vielleicht nochmal rummuss.

Ich hatte nie auch nur die leisesten Sym­pathien für den restjugoslawischen hyper­nationalistischen Autokraten, den serbischen Staatschef Slobodan Milošević. Aber genauso wenig hatte ich die für sein kroatisches Pendant Franjo Tuđman. Mein Vater hatte mir 1991 den jugoslawischen Pass abgenommen und durch einen kroatischen ersetzt.

Das aber ersetzte nicht meine Ansicht, dass das ursprüngliche jugoslawische Modell wesentlich friedlicher, kosmopolitischer, demokratischer und cooler war als diese von Nationalismus, Antisemitismus und ethnischem Testosteron aufgepumpte kroatische Unabhängigkeit.

Das war keine exklusive Haltung als deutsche Linke. Im Gegenteil. Während der eine Teil im wiedervereinigten Deutschland den Sieg über den Kommunismus feierte, kämpften die Nichtsodeutschen und Linken mit dem gesamtdeutschen Nationalismus, Rassismus und neonazistischer Gewalt – Baseballschlägerjahre ist das aktuelle Stichwort dafür. Diese Gruppe sah im neuen Deutschland das alte. Und dazu passte auch das Verhalten der deutschen Regierung in den jugoslawischen Zerfallskriegen ab 1991.

50 Jahre Manuskripte - Alfred Kolleritsch und Peter Handke.jpg

Von Bild bis Joschka Fischer, deutsche Medien und Politiker sahen in Serbiens Präsident Hitlers Wiedergänger, im Kosovo ein neues Auschwitz und bombardierten zum dritten Mal in diesem Jahrhundert Belgrad (1999). Und das alles, nachdem man den Massakern im Bosnienkrieg (1991 bis 1995) quasi zugeguckt hatte und der deutsche Außenminister Kroatien im Alleingang als unabhängigen Staat anerkannt hatte (1991).

Hans-Dietrich Genscher ist in Kroatien der einzige Politiker, nach dem zu Lebzeiten Straßen und Plätze benannt wurden. Schützenhilfe alter Verbündeter aus faschistischen Zeiten – so redeten wir damals.

Quelle         :           TAZ         >>>>>           weiterlesen

———————————————————-

Grafikquellen       :

Oben         —        New graves for victims of the Srebrenica genocide in 1995. Burial took place on 11 July 2010.

Abgelegt unter Bildung, Deutschland, Europa, Schicksale | Keine Kommentare »

5G: Ankündigung

Erstellt von DL-Redaktion am 10. Dezember 2019

5G: Ankündigung der Inhaftungnahme des Deutschen Staates und der vier Mobilfunkanbieter

Von Stefan Weinert – Ravensburg

An 
alle Mitglieder des 19. Deutschen Bundestages,
an die Frau Bundeskanzlerin Dr. Angela Merkel,
alle Ministerinnen und Minister der Deutschen Bundesregierung (extra explizit), alle Mitglieder der 16 Deutschen Landtage,
alle Ministerpräsidentinnen und Ministerpräsidenten der Bundesländer der BRD, alle Ministerinnen und Minister der 16 Deutschen Landesregierungen (extra explizit), alle Mobilfunkanbieter der ersteigerten 5G-Mobilfunklizenzen: Telekom, 1&1, vodafone, O², 

Ankündigung Ihrer Inhaftungnahme durch die Bürgerinnen und Bürger der Bundesrepublik Deutschland im Falle von Gesundheitsschädigungen aufgrund der von Ihnen zugelassenen und durchgeführten Implementierung der 5G-Mobilfunktechnik

Sehr geehrte Frau Bundeskanzlerin,
sehr geehrte Damen und Herren Ministerpräsidenten
sehr geehrte Damen und Herren in den Parlamenten; Ministerien und Geschäftsleitung der Mobilfunkanbieter,

der Deutsche Staat hat die schädlichen Auswirkungen der Dauerbestrahlung durch die 5G (und zukünftig 6G) – Mobilfunkstrahlung, sowohl terrestrisch als auch aus dem Orbit (geplant sind tausende von Satelliten in einer Umlaufbahn von 1.200 Kilometer, One Web und andere, SCOBEL) nicht oder viel zu wenig bedacht. Nicht nur das CO² schadet dem Klima, sondern die elektronische Highspeedtechnologie tut es ebenfalls – und das in doppelter Hinsicht und ist damit weitaus gefährlicher als CO². Zum einen ist der Energieverbrauch (Energie wird derzeit überwiegend und über noch längerer Zeit aus fossilen Brennstoffen gewonnen) für das „Streamen“ von Filmen (der kauf einer DVD hat eine wesentlich bessere Ökobilanz), das Zahlen mit „bitcoins“), das Internet der Dinge (5G) et cetera … extrem hoch und stoßen (auf verschleierten Umwegen) mehr CO² aus, als es unsere Diesel und Benziner (Land und Wasser) zusammen tun — und zum anderen sind die Strahlen selbst nicht nur für den homo sapiens (physisch und psychisch), sondern auch für die Fauna und Flora entwicklungs- und erbgutschädlich und eben auch umweltschädlich. Ein Skandal, dass unsere Parlamente, unsere Regierungen und die vier Mobilfunkanbieter, die alle unserem Gemeinwohl verpflichtet sind, all dies außer Betracht lassen, um ihre Interessen und die der Wirtschaft durchzusetzen.

Inzwischen gibt es – im wahrsten Sinne des Wortes – unzählige Gutachten, Forschungsergebnisse und persönliche Erfahrungsberichte, die „belegen“, dass 5G in der Tat sehr menschen- und darüber hinaus grundsätzlich bioschädlich (Bioethik) ist. Genauso aber gibt es Gutachten, Forschungsergebnisse etc. die „belegen“, dass dem nicht so sei. Befürworter unterstellen den Gegnern, sie würden 5G dämonisieren oder Verschwörungstheorien anhängen; Gegner unterstellen den Befürwortern schlichtweg Unverantwortlichkeit. Und so wird es – trotz zahlreicher Petition und weiterer Gutachten pro und contra  5G  weitergehen.

Deshalb brauchen wir ein sowohl bundesweites und EU-weites objektives von Wirtschaft und Gegnern der 5G-Mobilfunktechnik unabhängiges professionelles Expertengutachten – am besten durch zwei eben solche Zweitgutachten belegt – die klar, durch empirische Daten und von beider  Seiten anerkannt belegen, wie es sich bei der 5G-Mobilfunkstrahlung wirklich verhält.

Es gibt drei Möglichkeiten.

a) Das/die Gutachten werden erstellt und bilateral anerkannt und sagen aus, 5G – terrestrisch und orbital – ist für das Leben auf dem Planeten Erde (vor allem für den homo sapiens) ungefährlich bzw. nicht gefährlicher als das bisherige 4G/LTE. In diesem Fall, käme es dennoch durch 5G zu gesundheitlichen gutachterlich bestätigten Beeinträchtigungen beim Menschen, kann dieser den Staat und die Mobilfunkanbieter auf Schadensersatz verklagen und /oder ist das erfolglos, den Staat in Haftung nehmen und regresspflichtig machen. Bei gesundheitlichen Beeinträchtigen bei Tieren, sind es die Landwirte, Tierschutzvereine und Tierhalter, die Regress einfordern können. Bei Schädigung der Pflanzen durch 5G sind es die Umweltverbände und ebenso Landwirte, die vom Staat finanzielle Wiedergutmachung fordern werden. Durch eine „Einstweilige Verfügung“ seitens des Bürgers ist es dann auch möglich, per Gericht die 5G-Mobilfunkstrahlung abschalten zu lassen (siehe auch weiter unten, es besteht Anwaltspflicht)

b) Die Gutachten sagen aus, 5G – terrestrisch und orbital – ist für das Leben auf dem Planeten Erde (vor allem für den homo sapiens) gefährlich und vor allem gefährlicher als das bisherige 4G/LTE, wobei die „Gefährlichkeit“ konkret benannt wird. In dem Fall — käme es dennoch zur Implementierung von 5G — würden sich der Staat und die Mobilfunkanbieter definitiv und explizit gegen das im GG verankerte Vorsorgeprinzip wenden, und sich von vorn herein – im Falle einer gesundheitlichen gutachterlich bestätigten Schädigung durch 5G, einer Prozesswelle unbekannten Ausmaßes begeben. Folgerichtig müsste es deshalb  zum Verzicht auf die Implementierung der  5G-Mobilfunktechnik  kommen. Hier können der Staat und die Mobilfunkanbieter dann von dem Bürger in Haftung genommen werden, wenn eine Schadensersatzforderung erfolglos bleibt (Anwaltspflicht) *)

Bild des Objektes

c) Es gibt trotz Bemühens kein/e Gutachten, das/die klar und empirisch belegen können ( so wie es dato der jetziger Stand 2019 ist), ob a) oder b) in Frage kommen. Es bleibt bei einem Patt. Diese „Patt“-Situation ist durchaus voraus zu sehen, da Wirtschaft und Politik andere Interessen vertreten, als viele Bürger und  Bürgerinnen und Verbraucher und von beiden Seiten jeweils interessenaffine Gutachter bestellt würden und bisher auch bestellt wurden (dito 2019). Auch in diesem Fall würden sich der Staat und die Mobilfunkanbieter im Falle von Gesundheitsschädigungen des auf der Erde Lebenden juristisch schuldig machen, da ein Unschädlichkeitsnachweis fehlt. Auch hier gilt: Der Staat und die Mobilfunkanbieter können vom Bürger auf Schadensersatz verklagt  und/oder in Haftung genommen werden (Anwaltspflicht)

Folgendes zu Ihrer Information
*) Nach dem deutschen Recht kann der Staat (in absoluten kaum vorkommenden Ausnahmefällen der einzelne Beamte) vom Bürger nur dann in Haftung genommen werden, wenn der Schaden am Bürger durch Staatsversäumnis bereits entstanden – nicht wenn er zu befürchten –  ist. Grundsätzlich ist das „in Haftung nehmen des Staates“ juristisch aber möglich –  allerdings als „letzte Instanz“, wenn alle anderen Möglichkeiten der Schadenswiedergutmachung des Bürgers zuvor fehlgeschlagen sind.  Den Staat in Haftung zu nehmen, ist also das letzte Mittel, um eine Entschädigung zu erhalten. Zuvor müssen Geschädigte alle anderen Optionen zum Erhalt von Schadensersatz erfolglos genutzt haben. Aber wie gesagt muss der Schaden an der klagenden Person zuvor bereits entstanden sein. —>

—> Etwas anders sieht es bei der „Einstweiligen Verfügung“, mit der etwas verhindert/untersagt werden soll aus. Auch hier muss zuvor ein nachweislicher Schaden durch den Staat bzw. die Mobilfunkanbieter am Bürger  geschehen sein. Das muss dann nicht der Klagende als Betroffener selbst sein, sondern das können auch Dritte sein, an denen Schaden geschehen ist. Wenn ie Bürger/innen durch eine „Einstweilige Verfügung“ die Implementierung von 5G verhindern oder rückgängig machen wollen, dann muss a) 5G zuvor tatsächlich in Aktion gebracht, implementiert worden sein und b) ein Gutachten bestätigen, dass ich, oder mein Nachbar, Arbeitskollege durch 5G erkrankt/geschädigt worden sind.  In der aktuellen Situation ist das sehr schwierig, weil die heute bereits durch 4G/LTE erkrankten Menschen von offizieller Seite oft als Hypochonder und/oder Verschwörungstheoretiker abgetan werden. Und selbst da, wo und wenn man sie ernst nimmt, wird 4G/LTE nicht abgeschaltet, sondern höchsten Schutzräume oder strahlungsfreie Enklaven in Erwägung gezogen.

Unter dem Gemeinwohl wird als Gegenbegriff zu bloßen Einzel- oder Gruppeninteressen innerhalb einer Gemeinschaft verstanden. Er kann auf jedwede über individuelle Gemeinschaft bezogen werden, wie Familie, Region, Land, Volk, Völker einer Vertragsgemeinschaft, Weltgemeinschaft, aber auch auf Welt, Natur, Universum. Staatliche Gewalt wird vom Bundesverfassungsgericht als „dem Gemeinwohl verpflichtet“  interpretiert. (BVerfG, Urteil vom 22. Januar 2011, Az. 1 BvR 699/06) Nicht von Allgemeinwohl kann gesprochen werden, wenn der Staat lediglich aus fiskalischen Interessen handelt ( BVerfG, Beschluss vom 18. November 1998, 1 BvR 21/97 = Neue Juristische Wochenschrift 1999, S. 1176.), oder wenn die  Förderung privater Interessen im Focus steht. Im Grundgesetz (GG) findet das Gemeinwohl Niederschlag in Artikel 14 (2) GG.

Aber nicht nur der Staat, sondern auch vor allem große Unternehmen tragen in Sachen „Gemeinwohl“ eine tragende Verantwortung. Für sie  gewinnt der Gemeinwohl (Public Value) -Ansatz dann an Bedeutung, wenn sie ihre Rolle im gesellschaftlichen Umfeld bestimmen wollen. Dabei muss es um die ganzheitliche Betrachtung, bei der die finanziell-ökonomische Wertschöpfung nur einen Ausschnitt des Gemeinwohl-Beitrages darstellt, gesehen werden. Aus dieser Perspektive leisten Unternehmen (bzw. sollen/sollten) neben dem funktionalen Kundennutzen auch moralisch-ethische, politisch-soziale auch hedonistisch-ästhetische Beiträge zum Gemeinwohl – sie beeinflussen gesellschaftliche Werte. In der Praxis wurden bisher einzelne Gemeinwohlaspekte unter Begriffen wie „Nachhaltigkeit“ oder „gesellschaftliche Verantwortung“ thematisiert, doch in der Regel nicht im Sinne eines Wertbeitrages verstanden. Das aber muss unbedingt bedacht werden (Gemeinwohlbilanz).

 „Die Gutheit eines jeden Teiles hängt immer ab vom Entsprechungsverhältnis zu seinem Ganzen; … Da nun jeder Mensch Teil eines bürgerlichen Gemeinwesens ist, kann der Mensch unmöglich gut sein, wenn er nicht dem Gemeingut gerecht wird,“ sagte einst … Thomas von Aquin.

„Die Grundlage der Demokratie ist die Volkssouveränität und nicht die Herrschaftsgewalt eines obrigkeitlichen Staates. Nicht der Bürger steht im Gehorsamsverhältnis zur Regierung, sondern die Regierung ist dem Bürger im Rahmen der Gesetzte verantwortlich für ihr Handeln. Der Bürger hat das Recht und die Pflicht, die Regierung zur Ordnung zu rufen, wenn er glaubt, das sie demokratische Rechte missachtet.“  – Gustav Heinemann

Das Vorsorgeprinzip ist ein Prinzip der Umweltpolitik und Gesundheitspolitik. Danach sollen die denkbaren Belastungen bzw. Schäden für die Umwelt bzw. die menschliche Gesundheit im Voraus (trotz unvollständiger Wissensbasis) vermieden oder weitestgehend verringert werden.Die beiden Dimensionen des Vorsorgeprinzips sind die Risikovorsorge und die Ressourcenvorsorge. Risikovorsorge bedeutet, bei unvollständigem oder unsicherem Wissen über Art, Ausmaß, Wahrscheinlichkeit sowie Kausalität von Umweltschäden und -gefahren vorbeugend zu handeln, um diese von vornherein zu vermeiden. Das Vorsorgeprinzip ist Leitlinie der Umweltpolitik auf der deutschen, der EU- und der internationalen Ebene. Es spielt als solche eine zentrale Rolle bei umweltpolitischen Entscheidungen. Bereits im Umweltbericht von 1976 und in den „Leitlinien Umweltvorsorge“ aus dem Jahr 1986 erklärte die Bundesregierung das Vorsorgeprinzip – neben dem Verursacher- und dem Kooperationsprinzip – zum Handlungsprinzip ihrer Umweltpolitik. Auch die Umweltpolitik der Europäischen Union beruht auf dem Vorsorgeprinzip (Artikel 191 des Vertrags über die Arbeitsweise der Europäischen Union).

In Situationen der Ungewissheit können die Folgen eines Tuns für die Umwelt wegen unsicherer oder unvollständiger wissenschaftlicher Erkenntnisse nicht endgültig eingeschätzt werden, die vorliegenden Erkenntnisse geben aber Anlass zur Besorgnis. In diesen Fällen muss der Staat nicht abwarten, bis Gewissheit besteht, sondern er kann/muss unter Beachtung des Verhältnismäßigkeitsgrundsatzes auf den Besorgnisanlass reagieren. Wie er dies tut, legt das Vorsorgeprinzip nicht im Einzelnen fest. Der Gesetzgeber muss vielmehr entscheiden, wie er Vorsorge rechtlich und instrumentell gestaltet.

Die Erklärung der Konferenz der Vereinten Nationen über Umwelt und Entwicklung (UNCED) 1992 in Rio de Janeiro konkretisiert das Vorsorgeprinzip in Kapitel 35 Absatz 3 der Agenda 21: „Angesichts der Gefahr irreversibler Umweltschäden soll ein Mangel an vollständiger wissenschaftlicher Gewissheit nicht als Entschuldigung dafür dienen, Maßnahmen hinauszuzögern, die in sich selbst gerechtfertigt sind. Bei Maßnahmen, die sich auf komplexe Systeme beziehen, die noch nicht voll verstanden worden sind und bei denen die Folgewirkungen von Störungen noch nicht vorausgesagt werden können, könnte der Vorsorgeansatz als Ausgangsbasis dienen.“

Für die europäische Gemeinschaftspolitik und die auf ihr beruhenden Politiken der Mitgliedsstaaten gibt die Mitteilung der Europäischen Kommission zur Anwendbarkeit des Vorsorgeprinzips einen gemeinsamen Rahmen vor, der mit den politischen Diskussionen auf der internationalen Ebene in Übereinstimmung ist.

Dort wurden zur Anwendung des Vorsorgeprinzips drei Grundsätze formuliert: Die Anwendung des Prinzips sollte auf einer möglichst umfassenden wissenschaftlichen Bewertung beruhen, in der auch das Ausmaß der wissenschaftlichen Unsicherheit ermittelt wird. Vor jeder Entscheidung für oder gegen eine Tätigkeit sollten die Risiken und die möglichen Folgen einer Untätigkeit bewertet werden Sobald die Ergebnisse der wissenschaftlichen Bewertung und/oder der Risikobewertung vorliegen, sollten alle Betroffenen in die Untersuchung der verschiedenen Risikomanagement-Optionen ein bezogen werden. Ängste der Bevölkerung können sehr wohl Einfluss auf Entscheidungen der Politik haben und müssen es auch, wenn es sich um rationale Ängste handelt. Die Ängste und Befürchtungen des Bürgers bei der anstehenden 5G-Strahlung ist nicht irrationaler Art. Sie ist berechtigt, denn sie zeigt wirkliche Gefahren oder Bedrohungen an. Doch diese Angst vor der 5G-Mobilfunkstrahlung ist keine von sozialpsychologischen Mechanismen oder Massen medialer Beeinflussung hervorgerufen, sondern durch seriöse und hoch fachliche Erkenntnisse von Spezialisten veranlasst. (sieh aber oben „pro und contra“)

Es folgt eine entsprechende Petition – gerichtet an Sie – durch die viele Bürger und Bürgerinnen der Bundesrepublik Deutschland und der EU diesen meinen Brief an Sie unterschreiben und unterstützen können.

Mit freundlichen Grüßen

Stefan Weinert, Ravensburg – 7.12.2019

Bundestagskandidat 2017 (unabhängig); 2021 in Planung

Theologe, Konflikt- und Case Manger FH, Publizist bei DL; Köln

———————————————–

FAZ vom 27.09.2004 (https://www.faz.net/aktuell/wirtschaft/oeffentliche-dienste-9-daseinsvorsorge-zwischen-wettbewerb-und-gemeinwohl-1177144.html?printPagedArticle=true#pageIndex_2
Das Feld der öffentlichen Dienstleistungen reicht von den großen netzgebundenen Leistungen wie Bahn und Telekommunikation bis hin zu sozialen und kulturellen. Eine Abwägung zwischen Wettbewerb und Gemeinwohl ist geboten. Zur Sicherstellung dieser Dienstleistungen genießen die Städte und Gemeinden ein hohes Maß an Gestaltungsfreiheit. Sie können darüber entscheiden, ob sie eine Aufgabe der Daseinsvorsorge selbst durch eigene Unternehmen und Einrichtungen oder durch die Beauftragung privater Dritter erfüllen, sagt Helmut Dedy, stellvertretender Hauptgeschäftsführer des Deutschen Städte- und Gemeindebundes. Doch in der Definition der Dienstleistungen von allgemeinem wirtschaftlichen Interesse bestehen auf Grund der nicht aufeinander abgestimmten rechtlichen Vorgaben des deutschen und europäischen Rechtsrahmens Probleme. Nicht geklärt sei zum Beispiel, welche Dienstleistungen der Daseinsvorsorge als wirtschaftlich anzusehen seien, und auf welche Dienste das europäische Wettbewerbsrecht Anwendung finde, sagt Dedy. Nach Ansicht der EU-Kommission und des Europäischen Gerichtshofs sind es alle Dienstleistungen, für die tatsächlich oder potentiell ein Markt besteht. Das ist ein weites Feld. Es reicht von den großen netzgebundenen Dienstleistungen wie Bahn, Telekommunikation, Energie und zunehmend auch von Wasser und Abwasser bis hin zu sozialen und kulturellen Dienstleistungen. –  Mit der Schöpfung des Rechtsbegriffs der Daseinsvorsorge hat der Staatsrechtler Ernst Forsthoff in den dreißiger Jahren Weichen gestellt, deren Bedeutung in Deutschland und Europa erst jetzt voll erkannt wird. So hieß es vor zwei Jahren auf einem Kolloquium der Universität Heidelberg aus Anlaß seines 100. Geburtstages. Angesichts des Endes staatlicher Monopolbetriebe – etwa in der Energieversorgung – zittern jetzt viele Kommunalbetriebe und Kommunalpolitiker vor den Forderungen nach weiterreichender Marktöffnung, Konkurrenz und Privatisierung. Kein Wunder, dass der hehre Begriff der Daseinsvorsorge in Deutschland eine Renaissance erlebt. Forsthoff hat die Daseinsvorsorge zu einer staatlichen Aufgabe erklärt, die sich nicht auf existenznotwendige Leistungen beschränken sollte. Sie umfass die Versorgungswirtschaft (Strom, Gas, Fernwärme, Wasser), die Entsorgung (Abwasser, Müll), das Verkehrswesen, der Rundfunk (Grundversorgung), Telekommunikation, Kreditwesen und kommunale Einrichtungen für die Bildung, Soziales, Gesundheit, Kultur und Freizeitgestaltung. Ziel der kommunalen Daseinsvorsorge ist die qualitativ hochwertige, sichere und möglichst preisgünstige Versorgung der Bürger vor Ort mit den entsprechenden Dienstleistungen, sagen die deutschen Städte und Gemeinden.“

>>>>>    Zur Petition     <<<<<

——————————————————————–

Grafikkquellen       :

Oben          —        Privat      –    Stefan Weinert

——————————-

Unten     —         Datei:Funkstelle Lerchenberg 1.jpg

Abgelegt unter Baden-Württemberg, Bundestag, Deutschland, Regierung | Keine Kommentare »

Weiter – immer weiter SPD

Erstellt von DL-Redaktion am 10. Dezember 2019

Wie lange bleiben Frau Esken und Herr Walter-Borjans im Amt?

Quelle      :         Scharf   —   Links

Von Wolfgang Gerecht

Die „Schröderianer“, die  überzeugten Anhänger einer kapitalismuskonformen Politik des SPD-Ex-Kanzlers werden ihre Politik weiter betreiben wie bisher. Weiter so !!!

Nur DIE LINKE glaubt noch an den politischen Nutzen des von neoliberalen  Metastasen befallenen SPD-Parteikörpers, weil alles was nicht CDU-CSU-FDP-AfD heißt, das ist für die LINKEN-Führung um Kipping/Riexinger  „Links“.

So kann sich Mensch auch orientieren, findet aber keine Richtung.

Welche Forderungen haben Frau Esken und Herr Walter-Borjans:

Wollen Sie überhaupt zu einer Änderung der fatalen SPD-Politik seit 1998 beitragen? Die Antwort lautet: Natürlich, NEIN!!!

12 Euro Mindestlohn sofort,

ein neues Klimapaket,

massive Investitionen,

Schluss mit der schwarzen Null –

Das sind allgemeine Forderungen und in keinem Punkt eine Abkehr von der durch die GroKo-Parteien CDU-CSU-SPD so verehrten AGENDA 2010.

Die Abschwächung, die Verwässerung der ursprünglichen Esken/Walter-Borjans-Forderungen, soweit sie überhaupt konkret beschrieben waren, sind schon in dem im Willy-Brandt-Haus erstellten Leitantrag GroKo-freundlich redigiert worden. Damit ist die Zustimmung des größten Teils der Rechten in der SPD, im Partei-Apparat, der Bundestagsfraktion und bei den SPD-Regierungs-Mitglieder gewährleistet.

Darüberhinaus haben die Apparatschkis der Seeheimer, der Netzwerker und der Parlaments-„Linken“ die Medien auf ihrer Seite.

Die meisten Organe der Qualitäts-Presse bis zur „linken“ TAZ warnten in dem Tenor: Raus aus der Groko ist jetzt die falsche Forderung.

Und genau so kam es auch, es ist nur noch von „Gesprächen“ mit den Koalitions-Partnern CDU-CSU die Rede.

Auch der GroKo-Fan, Herr Müntefering hat sich zu Wort gemeldet und weißt die beiden „Neuen“ ohne GroKo-„Stallgeruch“ darauf hin,  das die Politik in der Bundesregierung und in der Parlamentsfraktion „gemacht“ und entschieden wird. Und eben schon gar nicht, im SPD-Partei-Vorstand.

Bei den Damen und Herren im SPD-Präsidium, SPD-Vorstand,  in der SPD-Bundestagsfraktion und in den Bundesländern in denen die SPD noch Ministerpräsidenten bzw. den Regierenden Bürgermeister stellt, handelt es sich in der Regel um absolut überzeugte Anhänger der Kapitalismuskonformen Politik des Herrn Schröder aus Hannover.

Da hilft kein Wahlergebnis von um die 10%, keine Wahl-Umfragen von 14-15%.

Diese SPD-Schröder-Anhänger haben durch diese Politik, neben CDU-CSU-FDP, auch einen erheblichen Anteil am Aufstieg der AfD!

Deshalb gilt: CDU-CSU-SPD sind Vater und Mutter der AfD.

Ein Plakat mit dieser Aufschrift hat der Autor vor dem Parteitag in Wiesbaden am 22.04.2018, als Frau Nahles mit ca. 66,35 % zur SPD-Vorsitzenden gewählt wurde, den Delegierten zur Kenntnis gegeben. Erstaunlich, einige hatten sogar Zustimmung bzw. Verständnis signalisiert.

2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg

Was waren die Schlagzeilen zum damaligen Parteitag auf der SPD-Website?

https://www.spd.de/partei/aobpt2018wiesbaden

Unser Versprechen:

Solidarität –    #SPD erneuern – Jetzt geht es los!   „Auf, packen wir’s an“

Schulz und Nahles hatte eine kurze „Haltbarkeitszeit“. Beide waren „abgehärtete“ Politiker die den täglichen Kampf um die innegehaltene  Position jahrelang gewöhnt waren. Sowohl Schulz als auch Nahles mussten schnell erkennen, dass sie – obwohl erst vor kurzer Zeit gewählt  – von ihren „Genoss Innen“ nicht akzeptiert wurden und dementsprechend nicht mehr im Amt bleiben konnten.

Eskens und Walter-Borjans können sich im Traum nicht vorstellen, was jetzt auf sie zukommt, wenn sie sich nicht der Regie der Mitstreiter und Nachfolger des AGENDA-Mannes aus einem „Arbeiter-Haushalt“ namens G. Schröder unterwerfen.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————–

Grafikquellen       :

Oben        —        Karikatur von Gerhard Mester Weiter so (2016)

  • CC-BY-SA 4.0
  • File:20161221 xl 1515–Gehard-Mester Weiter so.jpg
  • Erstellt: 21. Dezember 2016

——————-

Unten      —           Team Saskia Esken und Norbert Walter-Borjans bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg
  • Erstellt: 2019-09-10 18:00:40

Abgelegt unter Berlin, Medien, P.SPD, Regierung | Keine Kommentare »

Die Linke muss nachsitzen

Erstellt von DL-Redaktion am 10. Dezember 2019

Anhaltender Flügelkampf in der Partei

DIE LINKE Bundesparteitag 10. Mai 2014-59.jpg

Diese Flügelkämpfe begannen schon vor 11 – 12 Jahren, kurz vor den Zusammenschluss zwischen WASG und PDS. In NRW kam es zu ersten Zerwürfnissen auf einer Landesversammlung, ich Glaube es war  in Dortmund, auf der darum ging, die Kandidaten für den anstehenden Bundestag zu finden. Auf der Bundes – Versammlung welche in Kassel folgte, ging es weiter, da war Lafontaine noch kein Mitglied der vereinigten Linke und ließ sich auf einer Bank vor der Versammlungshalle Hoheitsvoll ansprechen und umwerben. Die meisten der Kanditatenplätze  waren auf diesen Versammlungen lange im Vorfeld in festen Händen.  DL-Red. -IE-

Von Martin  Reeh

Dienstag steht die zweite Vorstands-Wahlrunde in der Linken-Fraktion an. Dass es diesen neuen Anlauf braucht, zeigt, wie zerrissen die Partei ist.

Zu einem Hintergrundgespräch „in entspannter, adventlicher Atmosphäre“ lud die neue Fraktionsspitze der Linken im Bundestag in der vergangenen Woche. Humor haben sie immerhin noch in der Partei. Denn von einer entspannten Stimmung ist die Fraktion weit entfernt, seitdem die Wahl der neuen Frak­tions­spitze Mitte November abermals die Zerrissenheit der Partei dokumentierte. Neben Dietmar Bartsch wurde die bisher weitgehende unbekannte Amira Mohamed Ali an die Fraktionsspitze gewählt. Die mietenpolitische Sprecherin Caren Lay unterlag.

Am Dienstag steht die zweite Runde der Vorstandswahlen an. Gleich drei Posten konnten Mitte November nicht besetzt werden, weil die Kandidaten nicht die erforderliche Mehrheit erreichten: Für den Vizesprecherposten kandidierten Sören Pellmann und Nicole Gohlke erfolglos gegeneinander. Als Leiterin des Arbeitskreises Außenpolitik fiel Heike Hänsel durch, als Beauftragter für soziale Bewegungen Lorenz Gösta Beutin. Zumindest Pellmann, Hänsel und Beutin wollen es am Dienstag erneut versuchen, auch Gohlke tritt erneut an.

Der seit Langem tobende Machtkampf zwischen den Flügeln hat mit den Fraktionsvorstandswahlen einen neuen Höhepunkt erreicht. Mit der Wahl von Mohamed Ali hat sich das sogenannte „Hufeisen“-Bündnis von eher traditionellen Linken und Ost-Reformern gegen die Kipping-Linke durchgesetzt. Wie gespalten die Fraktion ist, zeigt das Ergebnis von 36 Stimmen für Mohamed Ali, 29 entfielen auf Lay. Bartsch erhielt ohne Gegenkandidat nur 44 Stimmen, der Parlamentarische Geschäftsführer Jan Korte 39.

Auf den Vorstandsposten, die im November nicht besetzt werden konnten, blockierten sich die beiden Lager gegenseitig. Offenkundig gibt es einige Abgeordnete in der Mitte, die vor allem profilierten Vertretern beider Seiten ihre Stimme verweigern: Pellmann und Hänsel werden zum Hufeisen gerechnet, Gohlke und Beutin zum Kipping-Lager. Das Problem für beide Seiten: Die Abweichler halten sich bedeckt.

Kompromisse oder offener Machtkampf?

Mohamed Alis Wahl ist ein Zeichen dafür, wie sehr die Linke im Machtkampf steckt. Schon zu Beginn des Jahres, bei der Nominierung der Spitzenkandidaten für die Europawahl, waren innerparteiliche Überlegungen wichtiger als die Außenwirkung.

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Der Bundesvorstand um Katja Kipping, der das Vorschlagsrecht hatte, stellte damals mit der Aufstellung der wenig bekannten Martin Schirdewan und Özlem Demirel seine beiden Unterstützerlager zufrieden. Der Wahlkampfstimmung hielt sich anschließend in Grenzen, Huf­eisen-Anhänger lästerten intern über die schwachen Kandidaten. Bei der Europawahl holte die Linke 5,5 Prozent – das war ihr bisher schlechtestes Ergebnis.

Quelle        :     TAZ        >>>>>        weiterlesen

—————————————————————

Grafikquellen       :

Oben      —         Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom: Katja Kipping

Autor   –  Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-59.jpg
  • Created: 2014-05-10 15:03:07

—————————————–

Unten        —         Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Bundestag, Kultur, P. DIE LINKE | Keine Kommentare »

Kurswechsel in der SPD?

Erstellt von DL-Redaktion am 8. Dezember 2019

Die Mitte tickt ökosozial

Kolumne von Ulrich Schulte

Mehr Klimaschutz und mehr staatliche Investitionen, das ist nicht links, sondern einfach nur vernünftig. Die neue SPD-Spitze hat das verstanden.

Für manche sind die neuen SPD-Vorsitzenden Saskia Esken und Norbert Walter-Borjans so etwas wie der personifizierte Weltuntergang. Die SPD gebe sich auf, urteilt etwa die Frankfurter Allgemeine Sonntagszeitung, kurz FAS. „Für Deutschland ist das ein politisches Erdbeben.“

Ein Großteil der veröffentlichten Meinungen sieht es ähnlich. Gerade liberalkonservative JournalistInnen überbieten sich mit apokalyptischen Deutungen des angeblichen Linksschwenks der Sozialdemokratie. Das sind durchschaubare Versuche, die Neuen unmöglich zu machen.

Schauen wir auf die Inhalte, die das frisch gewählte Duo vertritt. Esken und Walter-Borjans fordern engagierteren Klimaschutz mit einem höheren CO2-Preis und mehr Kompensationen für Niedrigverdiener. Sie wollen den Mindestlohn auf 12 Euro anheben und ein milliardenschweres Investi­tionsprogramm des Staats auflegen, für Brücken, Bahnstrecken oder Bildung.

Ähnliches findet sich auch bei Grünen und Linken. Und die Parteien sind nicht allein. Viele Klimaforscher, Ökonomen und Verbände raten dasselbe. Ein solches Programm ist nicht naiv oder radikalutopistisch. Es ist einfach nur vernünftig – und auf Augenhöhe mit den Herausforderungen der Zeit.

Abschied von der Scholz-Heil-Linie

Der Bundesverband der Deutschen Industrie forderte kürzlich staatliche Investitionen von 450 Milliarden Euro in den nächsten zehn Jahren, Seit’ an Seit’ mit dem Deutschen Gewerkschaftsbund. Es würde die Infrastruktur, von der alle profitieren, aufwerten – und die rezessionsbedrohte Wirtschaft ankurbeln. Beide Organisationen, BDI und DGB, sind kommunistischer Umtriebe bisher unverdächtig.

File:Gerhard Schröder, der Basta-Kanzler.png

Hier habt ihr euren Bastard – Basta

Jene, die eine linkere SPD verhindern wollen und gleichzeitig für sich in Anspruch nehmen, für die bürgerliche Mitte zu sprechen, haben das Gefühl für die wahre Mitte der Gesellschaft verloren. Sie wenden Denkschablonen der 1990er Jahre auf das 21. Jahrhundert an, was kognitiv vielleicht nachvollziehbar ist, aber scheitern muss.

Gerhard Schröder und Tony Blair unterwarfen die Sozialdemokratie der Marktgläubigkeit, als sie 1999 ihr Konzept der „Neuen Mitte“ propagierten. Die darauf folgende Agendapolitik, dieser Verrat an ihrer Wählerschaft, verfolgt die SPD bis heute, trotz vieler, oft kleinteiliger Reparaturen in den Großen Koalitionen unter Merkel.

Quelle        :         TAZ       >>>>>         weiterlesen

—————————————————————–

Grafikquellen       :

Oben      —        Michel trying to make a revolution in 1848

Abgelegt unter Berlin, P.CDU / CSU, P.SPD, Regierung | Keine Kommentare »

Bürger, keine »Kunden«!

Erstellt von DL-Redaktion am 7. Dezember 2019

Hartz IV: Im Dschungel der Kompetenzen

Schroemuentekunz.jpg

Piraten auf der Flucht ?

von Michael Kanert

 „Der Bundesregierung liegen hierzu keine Erkenntnisse vor.“ Diese Antwort erhalten Bundestagsabgeordnete häufiger, wenn sie nachfragen, wie es denn so läuft mit der Umsetzung von Hartz IV in den Jobcentern. Und wer zu viel fragt, der wird bei Frage 2 auch mal „auf die Antwort zu Frage 1 verwiesen“. Und die lautet? Siehe oben.[1]

Ein schwacher Trost für die Abgeordneten: Auch das Bundesverfassungsgericht wurde jetzt auf eine vergleichbare Weise abgefertigt. Das Gericht musste prüfen, ob die Sanktionen gegen Hartz-IV-Empfänger mit dem Grundgesetz vereinbar sind. Seit Jahren kritisieren Sozialverbände, dass die Leistungskürzungen meistens die Falschen treffen. Die Betroffenen seien oft psychisch krank und gar nicht in der Lage, sich auf eine Stelle zu bewerben. Also fragte das Bundesverfassungsgericht ganz schlicht bei der Bundesregierung nach: Welche Belege gibt es dafür, dass eine vollumfängliche Sanktion „wirkt“? Findet ein Mensch wieder Arbeit, nachdem seine Leistungen vollständig gestrichen worden sind?

Diese Frage hätte die Bundesregierung eigentlich aus dem Stand beantworten müssen. Sie ist kraft Gesetz verpflichtet, die Wirkungen von Hartz IV „regelmäßig und zeitnah zu untersuchen“.[2] Und immerhin werden nun schon 14 Jahre lang solche Sanktionen verhängt. Aber die Verfassungsrichter mussten in ihrem Urteil erstaunt notieren, dass ihnen keine „tragfähigen Erkenntnisse“ vorgelegt wurden. Deshalb – aber nur deshalb – erklärte das Bundesverfassungsgericht die von ihm geprüften Sanktionen für verfassungswidrig, sofern mehr als 30 Prozent der Leistung gekürzt werden.[3]

Keine Belege für Sinn und Zweck

Die ersten Meldungen und Kommentare über das Urteil hatten bei Anhängern eines bedingungslosen Grundeinkommens falsche Hoffnungen geweckt. Doch der vollständige Urteilstext macht klar: Das Bundesverfassungsgericht entschied nicht, dass die Jobcenter künftig bedingungslos Geld auszahlen müssen. Ganz im Gegenteil: Als „Ausgangspunkt“ seiner Entscheidung schreibt das Bundesverfassungsgericht ausdrücklich: „Es steht mit den Anforderungen des Grundgesetzes in Einklang, existenzsichernde Geldleistungen zu mindern oder ganz zu entziehen, um Mitwirkungspflichten durchzusetzen.“[4] Das bedeutet: Wer sich grundlos weigert, eine neue Arbeit zu suchen, darf durch eine „spürbar belastende Reaktion motiviert werden, [seinen] Pflichten nachzukommen.“

File:2013-09-22 Bundestagswahl 2013 Wahlparty SPD 11.jpg

Wenn aber jemand tatsächlich bedürftig ist, dann muss der Staat handeln: „Das Sozialstaatsprinzip verlangt staatliche Vor- und Fürsorge auch für jene, die aufgrund persönlicher Schwäche oder Schuld, Unfähigkeit oder gesellschaftlicher Benachteiligung in ihrer persönlichen und sozialen Entfaltung behindert sind.“[5]

Zwischen beiden Positionen besteht ein „unübersehbares Spannungsverhältnis“, heißt es trocken in dem Urteil. Die Lösung der Verfassungsrichter: Jedenfalls für die besonders scharfen Kürzungen muss konkret belegt sein, dass sie auch wirklich ihren Zweck erfüllen – dass sie nicht mehr Schaden verursachen als Nutzen. Doch weil die Bundesregierung nicht in der Lage war, diesen Beleg zu liefern, hob das Gericht die schärfsten Regelungen auf. Diese Entscheidung erging ausdrücklich „auf der Grundlage der derzeitigen Erkenntnisse“.[6]

Warum hat die Bundesregierung keine „tragfähigen Erkenntnisse“ zu den Sanktionen liefern können? Ist das ein Einzelfall? Eher nicht. Seit 14 Jahren schaut jede Bundesregierung weg beim Thema Hartz IV. Sie duckt sich weg, müsste man besser sagen. „Wir sind doch nicht lebensmüde“, raunte mancher Fachpolitiker schon vor zehn Jahren. Keiner wollte und will als „Hartz-Politiker“ in den Abwärtsstrudel geraten, in den die SPD wegen dieses Themas gekommen war.

Was von der »schlanken Verwaltung« übrig blieb

Dabei hatte es Anfang der 2000er Jahre Anlass genug für eine Verwaltungsreform gegeben. In den alten Arbeitsämtern beschäftigten sich nicht einmal zehn Prozent der Mitarbeiter mit der eigentlichen Arbeitsvermittlung.[7]

Mit diesem Behördendschungel sollte Schluss sein, versprach der damalige Bundeskanzler Gerhard Schröder. Alle Leistungen sollten „aus einer Hand“ kommen. Eine „schlanke“ Verwaltung sollte einen pauschalen Geldbetrag an die Arbeitslosen auszahlen und sie dann ganz schnell „eingliedern“. Wer nicht mitmachte, sollte Sanktionen spüren. Das nannte sich „Fördern und Fordern.“

Aber wie bei jedem neuen Gesetz stellte sich die Frage: Wer soll das alles in die Tat umsetzen? Man kennt das ja aus anderen Bereichen: Was hilft ein „Pakt für Kinderschutz“ ohne Erzieher und Ärzte? Oder eine Pflegereform ohne Pfleger?

Auf die neue Behörde warteten sechs Millionen „Kunden“. Dazu brauchte es Tausende Mitarbeiter, die einen Milliarden-Geldtopf klug und effizient ausgeben sollten. Wer diese Super-Sozialbehörde befehligte, hatte enormen Einfluss im Staat. Kein Wunder, dass sich die rot-grüne Mehrheit im Bundestag und die schwarz-gelbe Mehrheit im Bundesrat ausgerechnet in diesem Punkt nicht einigen konnten – anders als bei den Einschnitten in die Sozialleistungen der Bürger. Da war man sich quer über die Parteigrenzen irgendwann einig: Geldleistungen wird es nur am „Existenzminimum“ geben, es soll bei der Arbeitsvermittlung keine Rücksicht auf die bisherige Berufsbiographie genommen, und es sollen Sanktionen für Unwillige eingeführt werden. Aber der Streit um die Macht blieb ohne Annährung: Der Bundestag wollte die Hand auf dem Geld behalten und deshalb die Bundesagentur für Arbeit beauftragen. Der Bundesrat als Länderkammer wollte eine kommunale Behörde mit dem örtlichen Bürgermeister oder dem Landrat als Chef.

File:Protest - "Hartz 4 macht nackig".JPG

Doch da weder Regierung noch Opposition an einer Verschiebung von Hartz IV schuld sein wollten, wurde ein potemkinsches Dorf gebastelt: das Jobcenter. Hinter den Kulissen blieben die Arbeitsagentur und das Sozialamt erhalten und damit die alten Machtstrukturen. Das Sozialamt blieb zuständig für schwer kranke Menschen. Die Arbeitsagentur durfte sich um die relativ leicht vermittelbaren Menschen im ersten Jahr ihrer Arbeitslosigkeit kümmern. Für alle anderen „Hilfebedürftigen“ war jetzt als dritte Hand das zusätzlich geschaffene Jobcenter zuständig. Aber auch hier sollten Arbeitsagentur und Kommunen ihren Einfluss behalten. Sie wurden als „Träger“ je zur Hälfte an den Jobcentern beteiligt. Der Machtkampf um die Hartz-IV-Verwaltung hatte inzwischen viel zu lange gedauert. Die neue „Mischverwaltung“ namens Jobcenter musste in wenigen Wochen installiert werden: mit ausrangiertem Personal der Telekom, mit Personalüberhang der „Träger“-Behörden. Das Ergebnis ist bekannt. Vor vielen Jobcentern bildeten sich deprimierende Schlangen. Langjährige Buchhalter wurden von überforderten Vermittlern in Computerkurse für Anfänger geschickt, andere Menschen sollten alte Puzzle-Spiele zusammensetzen. Die Software musste überlistet werden, wofür es eine hundertseitige „Umgehungslösung“ gab. Hartz IV wurde zum Arbeitsbeschaffungsprogramm für Juristen: Anwälte verdienten Millionen mit Massenklagen vor den Sozialgerichten. Dort wurde nahezu jeder zweite Bescheid beanstandet.

Quelle        :        Blätter         >>>>>          weiterlesen

—————————————————————–

Grafikquellen        :

Oben         —     Franz Müntefering (l.) und Gerhard Schröder (r.) bei der Abschlusskundgebung im Bundestagswahlkampf 2005 in Frankfurt am Main

——————————–

2.) von Oben         —          Noch mehr Täter     —

Description
Deutsch: Wahlparty der Bundes-SPD zur Bundestagswahl 2013.
English: The federal election party SPD for the parliamentary election in 2013
Date
Source Own work
Author Jonas Rogowski

———————————————————–

Unten       —

„Hartz macht nackig“.
Date
Source Own work
Author High Contrast
Permission
(Reusing this file)
I, the copyright holder of this work, hereby publish it under the following license:
w:en:Creative Commons
attribution

 

Abgelegt unter Deutschland, HARTZ IV, Regierungs - Werte, Wirtschaftpolitik | Keine Kommentare »

Die Müllverursacher

Erstellt von DL-Redaktion am 7. Dezember 2019

AfD – größter aller Umweltverschmutzer/in

Keine AFD 1.png

Von Stefan Weinert

Machen wir uns nichts vor. Bei all dem Streit innerhalb des Diskurs‘ „Klimawandel – Klimaerwärmung – Klimanotstand“, ja oder nein, und wie bekommen wir das in den Griff ?, übersehen wir alle womöglich den gröpßten Umweltvergifter im Land. Das nämlich ist die so genannte „Alternative für Deutschland“, die AfD!!

Wer den Bundesparteitag der AfD in Braunschweig verfolgt hat – bis hin zu dem ZDF-Interview am Sonntag-Abend mit dem neuen und verlogenen AfD – Vorsitzenden Tino Chrupalla (Umvolkung), der sich wenige Stunden zuvor bei seiner Kandidatenrede noch ganz ehrlich, seriös und zahm gab; wem klar ist, dass dieser, so wie auch Jörg Meuthen als weiterer Vorsitzender vom sogenannten völkischen Flügel des Björn Höcke mitgetragen werden und das auch bei den Stellvertreterposten sich mit dem Thüringer Stephan Brandner ebenfalls ein Höcke-Freund durchsetzen konnte, —> der/die weiß, was die Stunde geschlagen hat. 
 
Da nützt es auch nichts, wenn der halbe Saal dem Holocaust-Leugner Gedeon bei seiner Bewerbungsrede (!) zum Parteivorsitz den Rücken kehrt und/oder ihm die Rote Karte zeigt. Da nützt es ebensowenig, wenn Herr Meuthen wieder und wieder sein „Credo“ betet, das da heißt: „Ich dulde in der  AfD keine Rechtsnationalen, keine Holocaustleugner  und keine Antisemiten – für eine solche Partei stehe ich nicht zur Verfügung.“ tut er aber, und wie !! 
 
Bereits im Jahre 2016 habe ich – damals noch auf Facebook und generell im Internet – behauptet, die Afd sei die ideologische Nachfolgepartei der NSDAP von 1922 bis 1945. Die Bezeichnung NSAFD wäre – wenn schon ehrlich –  für diese Rechtsaußenpartei der passende und programmatischste Name . Was nützt dir und mir und unseren Kindern und Enkeln ein lebenswertes Ökosystem für das wir kämpf(t)en, wenn wir politisch und ideologisch im braunen Sumpf versinken. 
File:GarbageLibreville.JPG
 
Wer wirklich meint, das könnte in Deutschland nie wieder passieren, hat die Zeichen der Zeit und die Wirkkraft des faschistischen Virus nicht erkannt. Genauso, wie am 30. Januar 1933 von Papen meinte, mit Hitler leichtes Spiel zu haben und sagte: „In zwei Monaten haben wir Hitler in die Ecke gedrückt, dass er quietscht!“ Die AfD gehört verboten – nichts anderes!!
 
Im Folgenden habe ich alphabetisch die bekanntesten  Verursacher der Umweltvergiftung aufgelistet. Nicht rein zufällig steht hier die AfD an der Spitze.

Der größte Umweltverschmutzer ist/sind:

Auflistung alphabethisch

AfD

Atomkraftwerke

Benziner

Bundeswehr

Diesel

E-Mobile

Flugzeuge

Haushalte

Industriebetriebe

Kohlekraftwerke

Kreuzfahrtschiffe

Landwirtschaft

LKW

Mobilfunkstrahlung

Reisebusse

Tanker

Zigarettenraucher/innen

———————————————————–

Grafikquellen        :

Oben      —         Keine Alternative für Deutschland. Aufkleber gegen die Partei Alternative für Deutschland.

————————————–

Unten     —             Müllproblem in Libreville, der Hauptstadt des Gabun (2013)

Author Oshilumbu5 at German Wikipedia

This work has been released into the public domain by its author, Oshilumbu5 at German Wikipedia. This applies worldwide.

Abgelegt unter Baden-Württemberg, Deutschland, P.AfD, Umwelt | Keine Kommentare »

DIE LINKE. St. Johann:

Erstellt von DL-Redaktion am 7. Dezember 2019

Umbenennung der Neikesstraße muss auf die Tagesordnung des Bezirksrates Mitte

Lichtsignalanlage Busanforderung Johanneskirche Saarbrücken.jpg

Quelle        :        Scharf  —  Links

Von DIE LINKE. Saarbrücken

Der Ortsverband St. Johann der Partei DIE LINKE fordert die Umbenennung der Neikesstraße. Der Namensgeber war bis zu Machtergreifung der Faschisten an der Saar Oberbürgermeister der Landeshauptstadt.

Unabhängig davon, dass er sich massiv für den Anschluss an das nationalsozialistische Deutschland einsetzte, verlieh er 1934 Adolf Hitler die Ehrenbürgerschaft. Dies drückt in einem eindeutigen Maße die Gesinnung Hans Neikes‘ aus.

Einen Vorschlag, wer neuer Namensgeber dieser Straße werden könnte, macht DIE LINKE. St. Johann bewusst nicht. Nach Auffassung der Partei DIE LINKE gäbe es zahlreiche Saarbrücker Persönlichkeiten mit herausragenden Biographien. Wichtig ist, dass die schrecklichen Jahre der Saarbrücker Geschichte nicht verklärend als Straßenschilder herausgehoben werden.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————-

Grafikquelle        :    Lichtsignalanlage mit aktivem zusätzlichem Lichtsignal „Weißes A“ als Indikator für eine registrierte Busanforderung, mit der Johanneskirche Saarbrücken und der Saarbahnhaltestelle „Johanneskirche“ im Hintergrund

Abgelegt unter P. DIE LINKE, Positionen, Saarbrücken, Überregional | Keine Kommentare »

Geld – Fußball – Absturz

Erstellt von DL-Redaktion am 6. Dezember 2019

„Da steckt schon Sprengstoff drin“

BOMBERGERDMUELLER.JPG

Ein Interview von Ambros Waibel

Der Historiker und FC-Bayern-Sympathisant Hans Woller wollte nach seiner Pensionierung eine Biografie über seinen Lieblingskicker Gerd Müller schreiben. Herausgekommen ist eine Kriminalgeschichte des Fußballs zwischen großem Geld, Politik und privatem Absturz.

Das Gespräch mit Hans Woller findet in einem Café in der Schwabinger Clemensstraße statt. Nur ein paar Gehminuten entfernt befand sich von 1900 bis 1907 der erste Fußballplatz des FC Bayern München, an den heute eine Gedenktafel erinnert. Der Italienspezialist Woller hat das Café empfohlen, weil es da „den besten Kaffee Münchens gibt“. Seinen Cappuccino auch zu trinken, muss man Woller dann allerdings erinnern, so konzentriert, engagiert und sich Notizen machend ist er im Gespräch.

taz: Herr Woller, als Historiker haben Sie erforscht, wie das Agrarland Bayern nach 1945 zu einem Motor der westdeutschen Modernisierung wurde. Welche Rolle spielt in dieser Erfolgsstory der FC Bayern, welche sein bedeutendster Spieler Gerd Müller?

Hans Woller: Die Modernisierung des Fußballs beginnt mit der Einführung der Bundesliga zur Saison 1963/64. Die Folge ist eine Dynamisierung des Fußballs insgesamt. Davon profitieren viele junge Leute – wie Gerd Müller, Franz Beckenbauer, Paul Breitner und Uli Hoeneß –, die die Chance zum sozialen Aufstieg haben, weil der Fußball für die Wirtschaft und die Medien interessant wird und dadurch viel Geld in die Kassen kommt. Die Bayerische Staatsregierung und die dahinterstehende CSU mischen dabei kräftig mit: der Freistaat Bayern und der FC Bayern – modern, aber mit autoritärer Führung, unter konservativen Vorzeichen. Daraus ist dann eine Lebenspartnerschaft geworden.

Wie ist man seitens der CSU vorgegangen?

In einem Gespräch, das der bayerische Finanzminister Ludwig Huber um 1970 mit dem damaligen FCB-Präsidenten Wilhelm Neudecker geführt hat, wird klar ausgesprochen, dass die „bayerische Achse“ der Stars zusammengehalten werden muss, nicht nur als sportliches, sondern als ein explizit politisches Erfordernis. Und ich nenne in dem Buch eine ganze Reihe von Beispielen, wie Huber für den FC Bayern, aber auch für einzelne Spieler Vorteile herausgeschlagen hat, insbesondere für Gerd Müller. Er hat die Führung des FC Bayern zum Steuerbetrug bei den Einnahmen aus Auslandsgastspielen ermuntert. Der Großteil dieser illegalen Gelder wurde noch im Flugzeug in Briefumschlägen in bar an die Stars wie Müller weitergegeben. Huber hat Müllers Schwager eine gut dotierte Stelle bei einer Bank verschafft, er hat Gerd Müller einen Manager zur Seite gestellt und vieles andere.

Der bayerische Finanzminister als Mädchen für alles?

Er und Gerd Müller haben sich geduzt, das war schon ein enges Verhältnis.

In fünfjähriger Arbeit hat sich ihr Buch von einer Biografie des wohl bedeutendsten deutschen Fußballers zu einer Kriminalgeschichte ausgewachsen. Welche Entdeckungen waren da entscheidend?

Der Nachlass von Rainer Keßler im Hauptstaatsarchiv in München. Keßler war Leiter der Bayerischen Staatskanzlei, CSU-Mitglied und eine der prägenden Figuren im Verwaltungsbeirat des FC Bayern. In diesem Nachlass bildet sich ab, wie eng die Kooperation zwischen Politik und Verein war. Das ist aber nicht die einzige Quelle. In den nicht veröffentlichten Memoiren von Neudecker findet sich zum Teil wortwörtlich dasselbe.

Warum sind die nicht veröffentlicht – und wie kamen Sie an die dran?

Beckenbauer, Müller, Lattek.jpg

Die Memoiren fanden sich in der „FC Bayern Erlebniswelt“ in der Allianz­arena. Neudecker hat sie geschrieben, nachdem er Ende der 1970er Jahre im Streit vom FC Bayern geschieden war, eine Abrechnungsschrift, nicht zuletzt auch mit Uli Hoeneß. In meinen Augen sind diese Memoiren hoch brisant, was ich den sehr freundlichen Leuten bei der „FC Bayern Erlebniswelt“ dann auch gesagt habe: Da steckt schon Sprengstoff drin. Vermutlich sind sie deshalb unveröffentlicht geblieben.

Und hat sich die Führung des FC Bayern dazu verhalten?

Karl-Heinz Rummenigge ist wohl derjenige, der noch am ehesten ansprechbar ist für historische Fragen. Wer überhaupt keinen Sinn hat dafür, ist Uli Hoeneß. Der begegnete mir im Gespräch eher mit Misstrauen und Unverständnis; den interessierte eine Gerd-Müller-Biografie nicht, den interessiert anscheinend auch kaum, wie sich der FC Bayern im „Dritten Reich“ betragen hat. Er ist ein Mensch der Zukunft, der so viele Pokale wie möglich gewinnen will. Ein Traditionsverein wie der FC Bayern müsste aber Interesse an der eigenen Geschichte haben, zumal diese ja nicht nur negativ ist. Viele Innovationen sind mit den Bayern verbunden, auch wenn man mit Blick auf die Präsidenten seit den 1950er Jahren sagen muss: Da werden sie kaum einen finden, der nicht mit Recht und Gesetz zum Teil in massiver Form in Konflikt geraten ist.

Sie beschreiben Gerd Müller mit einer gewissen Sympathie. Gehen Sie nicht etwas zu nett mit ihm um, wo Müller sich doch auch für den Wahlkampf von CSU-Größen wie Huber und Franz Josef Strauß hat einspannen lassen?

Ich will eine gewisse Empathie für Gerd Müller nicht abstreiten. Das hat mit seinen Leistungen als Fußballspieler zu tun und mit meinem Verständnis für die Problematik des sozialen Aufsteigers. Unter diesen Problemen, zumal der Zerrissenheit, habe ich selber auch gelitten.

Wie würden Sie den Fußballer Gerd Müller beschreiben, für jemanden, der den Namen noch nie gehört hat, der ihn nie hat spielen sehen? Was hat ihn ausgezeichnet?

Zunächst, dass er außerordentlich viele Tore geschossen hat – und zwar im Gegensatz etwa zum heutigen Bayern-Stürmerstar Robert Lewandowski die entscheidenden Tore. Das andere ist, der Mann ist so unglaublich schnell in den Bewegungen, der liegt am Boden, sein Gegenspieler auch, und bevor der nur daran denken kann, wieder aufzustehen, ist Müller schon auf den Beinen und schießt irgendwie sein Tor. Und schließlich hatte Gerd Müller einfach ein Füßchen, rechts wie links gleich gut. Ein kompletter Fußballer eben, denn er war auch sehr kopfballstark.

Wereldkampioenschap voetbal 1974 in Munchen supporters omhelsen Duitse spelers, Bestanddeelnr 254-9557.jpg

Woran bemerkenswert ist, dass Gerd Müller den Spitznamen seines ersten Trainers bei Bayern nie losgeworden ist: „kleines, dickes Müller“. Dabei war er immerhin 1,76 groß, wog um die 80 Kilo. Warum hielt sich diese Zuschreibung?

Quelle           :         TAZ           >>>>>             weiterlesen

————————————————————–

GrafoOben        —      Der ehemalige Fußballnationalspieler Gerd Müller bei einem öffentlichen Auftritt in Berlin (Juni 2006).

 —————————————-

2.) von Oben       —        Franz Beckenbauer, Gerd Müller en Udo Lattek bij aankomst op Schiphol voor de wedstrijd Ajax – Bayern München

  • CC0Hinweise zur Weiternutzung
  • File:Beckenbauer, Müller, Lattek.jpg
  • Erstellt: ‎5‎. ‎März‎ ‎1973

 

———————————-

Onten       —    Wereldkampioenschap voetbal 1974 in Munchen; supporters omhelsen Duitse spelers Datum : 1974 Locatie : München Trefwoorden : sport, voetbal, wereldkampioenschappen Fotograaf : Mieremet, Rob / Anefo Auteursrechthebbende : Nationaal Archief Materiaalsoort : Dia (kleur) Nummer archiefinventaris : bekijk toegang 2.24.01.06 Bestanddeelnummer : 254-9557

Abgelegt unter Bayern, International, P.CDU / CSU, Wirtschaftpolitik | Keine Kommentare »

Wo nicht die Banane,

Erstellt von DL-Redaktion am 6. Dezember 2019

 sondern die Republik matschig ist

2017-01-09-Rainer Wendt-hart aber fair-9613.jpg

Eine Kolumne von

In Sachsen-Anhalt wollte die CDU Rainer Wendt zum Staatssekretär machen und fragte wohl nicht nach seiner Kompetenz. In Frankfurt will sie dafür alles über die Frau des Oberbürgermeisters wissen.

Compliance!

Was ist eine Bananenrepublik? Die DDR war bekanntlich keine. Metaphorisch ist eine Bananenrepublik zu Hause, wo nicht die Banane, sondern die Republik matschig ist. Das klassische Modell sieht vor, dass ein ganz normales Unternehmen der Südfrüchte-Industrie in einem warmen Land eine ausreichende Zahl von Generälen und Staatssekretären mit Luxusvillen, Luxusautos und Luxusweibern ausstattet, damit die zum Fortbestand der Welt erforderlichen Geschäfte des Obst-, Kupfer- oder Gold-Exports ohne nennenswerte Störungen durch eingeborene Veganer abgewickelt werden können. Infolge der allgemeinen Modernisierung wirken die entsprechenden Filme aus den Fünfzigern und Sechzigern allerdings inzwischen etwas verstaubt.

Im deutschen Bundesland Sachsen-Anhalt wachsen bislang aus Klimagründen keine Bananen. Da sich das schnell ändern kann, muss die Polizei vorbereitet sein, bevor es losgeht mit dem bananenrepublikmäßigen Niedergang. Genau hier setzte der mutige Plan an, Deutschlands härtesten Polizeihauptkommissar a.D., Rainer Wendt, zum für die Polizei des ganzen Bundeslandes zuständigen Innenstaatssekretär zu machen. Das wäre für den etwas überstürzt pensionierten Beamten der durch Nicht-Dienst errungenen Besoldungsgruppe A 12 (entsprechend: Amtsrat in der Verwaltung), der auf eine Verwaltungserfahrung als Dienstgruppenleiter im Schichtdienst bei der Schutzpolizei zurückblicken kann, eine schöne Herausforderung in der zwölf Stufen höheren Besoldungsgruppe B 9 gewesen.

Es stellt sich hier nicht die Frage, ob man das Herrn Wendt persönlich gönnen mochte: Auch im Lotto muss ja schließlich irgendwer gewinnen, und wenn man eigentlich jeden nehmen kann, kann’s ja auch ein pensionierter Schutzmann aus der Versicherungsbranche sein. Mit etwas Verantwortungsbewusstsein könnte einem zwar die Frage kommen, ob einem ganzen Bundesland ein oberster Verwaltungsbeamter zu gönnen ist, dessen Verwaltungskompetenz sich auf eine Dienstgruppenleitung bei der Duisburger Schutzpolizei beschränkt. Diese Frage wurde aber ausdrücklich selbst dann nicht diskutiert, als die „große Freude“ in der Staatskanzlei verebbt war. Man wandte sich vielmehr der Frage zu, ob PHK Wendt als Innenstaatssekretär eher eine Lachnummer oder ein Appetithäppchen für die AfD hätte sein sollen. Und ob sich ein großmächtiger Innenminister in seine durchdachte Personalpolitik hereinreden lassen mögen darf.

Dienst-Bananen!

Szenenwechsel: Auf der Suche nach dem Bananenunwesen in der Metropole Frankfurt am Main hat der Kolumnist einer dortigen Zeitung am 30.11. den ortsansässigen „Marxismus-Feminismus“ in den Fokus genommen, womit er selbstverständlich nicht die hessische CDU meinte, sondern die Brutstätte des Nepotismus im proletarisch-türkischen Sumpf, wie er seit jeher im Schatten des blitzsauberen Bankenviertels gedeiht. Während sich die Rest-SPD hinter ihren neuen Speerspitzen versammelt, behauptet nämlich ein ihr angehörender 61-jähriger Wahlbeamter der Besoldungsstufe B 11, er wisse nicht, wieviel seine 32-jährige Ehefrau als Kita-Leiterin bei der Arbeiter(!)-Wohlfahrt verdient: Es handelt sich, wie „FAZ“, „Welt“ und „Bild“ erfahren haben, um die unerhörte Summe von monatlich etwa 4200 Euro brutto (in Lohnsteuerklasse V kommen ca. 2200 Euro netto heraus). Solche Ahnungslosigkeit kann nur glauben, wer es auch nicht verdächtig findet, dass der Altersunterschied bei Bürgermeisters größer als bei Macrons ist, der Vorname der Frau türkisch und die von ihr geleitete Kita „deutsch-türkisch“, wie wir lesen durften. Und so blöd ist man weder bei diesen Zeitungen noch in der Frankfurter CDU.

Die Sozialdezernentin (CDU) der Stadt Frankfurt hat angesichts des Abgrunds gleich mal die „Zuschüsse eingefroren“ (die an die AWO), und im Halbtagesrhythmus lesen wir, dass sich „die Affäre ausweitet“ („FAZ“). Es fehlt nicht mehr viel, und „Bild“, „Welt“, „FAZ“ und HR rufen gemeinsam die Schlecker-Frauen oder die Bewohner des Ostends gegen den Feldmannschen Dienstwagen (Ford Focus!) in den Straßenkampf: Hongkong ist überall! Der Baudezernent (CDU) macht sich Sorgen um das Klima, weil der Dienst-Ford, wie er herausgefunden hat, CO2 ausstößt. Und die „FAZ“ fragt zum ersten Advent basisdemokratisch ihre Leser: „Wie soll es weiter gehen mit Peter Feldmann?“.

Wie die „Bunte“ zu der Sache steht, ist noch offen, da Frau Feldmann vor noch nicht langer Zeit dort als „wunderschöne Braut“ lief, was vermutlich die alten Säcke bei der „FAZ“ und der CDU echt neidisch gemacht hat. Wir würden natürlich gern wissen, wie sich das Gehalts- und Dienstwagengefüge bei ihren eigenen Bräuten darstellt, aber das ist super geheim und nur den Eliteforschern von der AfD bekannt.

Ja, es geht bergab in der Bananenrepublik! Der Herr Professor Meuthen und die Frau Doktor Weidel haben es schon immer gesagt, und die verstehen etwas davon. An dem ganzen Desaster ist aber die CDU Sachsen-Anhalt völlig unschuldig. Schuld sind ist erstens und im Allgemeinen das Kanzleramt, zweitens und im Besonderen der Duzfreund des Innenministers, Terminator Wendt, der bei seinem Anstellungsgespräch glatt vergessen hat zu erwähnen, dass eine Disziplinarmaßnahme gegen ihn verhängt wurde, weswegen er leider gar nicht eingestellt werden dürfte. So etwas Geheimes konnte natürlich ein Innenminister weder wissen noch ahnen!

Wäre Herr Wendt ein Volkspolizei-Kommissar in der DDR gewesen und hätte er sich im Jahr 1990 ähnlich schusselig um eine Anstellung als Staatssekretär (die Hoffnung stirbt zuletzt) oder Schichtleiter bei der Schutzpolizei Wernigerode beworben, hätte man ihn vermutlich wegen versuchten Anstellungsbetrugs verfolgt oder wegen Geschäftsunfähigkeit unter Betreuung gestellt. Aber das ist lange her. Die Mauer ist verschwunden und mit ihr die Arbeiterklasse, die jetzt „die Menschen“ heißt. Die Linke hat zwar gegen den Versicherungs-Fachmann Strafanzeige erstattet, aber wir ahnen, dass der Kommissar a.D. sich im berufstypisch unvermeidlichen Verbotsirrtum befunden haben könnte.

Wiederaufnahme!

Apropos DDR: Geschichte wiederholt sich nicht. Deshalb ist es auch ziemlich egal, ob man Herrn Höcke „Faschist“ nennen darf, was jetzt manche Antifaschisten gerne tun, vor allem im Fernsehen, in der kindlichen Hoffnung, dann würden „die Menschen“ sagen: Ja wenn das so ist!, und wieder SPD wählen oder wenigstens AKK. Dabei übersehen sie, dass Herr Höcke nicht gewählt wird, obwohl er Faschist ist, sondern weil er es ist. Und dass Herr Höcke sich nicht wie Rumpelstilzchen in der Luft zerreißt, wenn man seinen geheimen Namen herausgefunden hat. Die heutige Jugend jeden Alters glaubt leider an Zauberwörter und denkt, „Faschismus“ sei, wenn man Juden hasst, albern spricht und Antifaschisten zusammenschlägt. Das täuscht.

Quelle     :          Spiegel-online            >>>>>             weiterlesen

———————————————————–

Grafikquellen         :

Oben         —          Rainer Wendt in der WDR-Sendung „hart aber fair“ am 9. Januar 2017

Autor    —     „© Superbass / CC-BY-SA-4.0 (via Wikimedia Commons)“

File:2017-01-09-Rainer Wendt-hart aber fair-9613.jpg

———————————–

Unten           —        Systemkritische Protestfahne „BananenRepublik Deutschland“

Abgelegt unter Hessen, Justiz-Kommentare, Sachsen-Anhalt, Überregional | Keine Kommentare »

Linke lässt Mandat prüfen

Erstellt von DL-Redaktion am 6. Dezember 2019

Linke-laesst-Doppelmandat-von-Ex-CDU-Landeschefin-pruefen

Gruppenbild der Kandidat*innen Landesliste für die Landtagswahl 2019

Von dpa

Die Brandenburger Linke hat das von Ex-CDU-Landeschefin Saskia Ludwig beabsichtigte Doppelmandat in Bundestag und Landtag prüfen lassen. Der Parlamentarische Beratungsdienst (PBD) sei in seinem Gutachten zu dem Ergebnis gekommen, dass die Funktionsfähigkeit des Landtages durch die beiden Mandate beeinträchtigt sein könne, da nach Bundesrecht die Ausübung des Mandates im Mittelpunkt der Tätigkeit des Bundestagsmitgliedes stehe, zitierten die Linken am Dienstag aus dem Gutachten. Halte sich das Mitglied daran, könne das Landtagsmandat nur noch „am Rande“ ausgeübt werden, hieß es weiter.

Ludwig will für Brandenburgs Innenminister Michael Stübgen (CDU) als Abgeordnete in den Bundestag nachrücken. Stübgen hatte sein Mandat wegen seines Ministerpostens niedergelegt. Ludwig kündigte an, vorerst parallel auch Landtagsabgeordnete bleiben zu wollen.

Portrait saskia ludwig.jpg

„Wir halten dieses Doppelmandat und auch das, was Frau Ludwig hier verkündet hat, für einen handfesten Skandal“, sagte Linken-Fraktionschef Sebastian Walter. Die Linken wollen kommende Woche einen Änderungsantrag einbringen, der Doppelmandate in Zukunft ausschließt.

Quelle         :      Berliner – Morgenpost          >>>>>       weiterlesen

————————————————————————-

Grafikquellen        :

Oben       —         Die Linke LV Brandenburg

—————————-

Unten       —           Offizielles Portraitfoto der Politikerin Saskia Ludwig.

Abgelegt unter Brandenburg, P. DIE LINKE, P.CDU / CSU, Überregional | Keine Kommentare »

„Jetzt reden wir – 2.0“

Erstellt von DL-Redaktion am 5. Dezember 2019

Erster flüchtlingspolitischer Kongress war erfolgreich!

File:Alassa Mfouapon mit Adelheid Gruber.jpg

Alassa Mfouapon mit Adelheid-Gruber.

Quelle    :     Scharf  —  Links

Von Adelheid Gruber

180 Teilnehmer aus 20 Nationen folgten am vergangenen Samstag der Einladung von Alassa Mfouapon, seinem Rechtsanwalt Roland Meister und dem Freundeskreis Alassa & Friends zu einem Flüchtlingspolitischen Kongress, der wohl der erste seiner Art war.

Alassa Mfouapon war bundesweit bekannt geworden als Sprecher der Flüchtlinge in Ellwangen, die sich 2018 gegen Abschiebung und Kriminalisierung wehrten. „Das Vorhaben, den engen Schulterschluss zwischen der Selbstorganisation der Flüchtlinge mit anderen demokratischen, humanistischen bis hin zu revolutionären Kräften zu organisieren ging auf und begeisterte die Teilnehmer, die von München bis Hamburg angereist waren und für eine große Bandbreite von gesellschaftlichen Gruppen, Initiativen und Organisationen standen.

Einzigartig, wie hier die Erfahrungen der Flüchtlinge über Fluchtbedingungen, Ankommen in Deutschland und dem Leben hier, wie ihre kompetenten Kenntnisse über die Fluchtursachen, ihr konkreter Kampf gegen Diskriminierung, gegen die Angst vor Abschiebung, die tagtägliche Erfahrung, als Menschen zweiter und dritter Klasse behandelt zu werden, zusammen kamen mit Berichten flüchtlingssolidarischer Menschen, die selbst auch die Erfahrung von Kriminalisierung und Diffamierung machen und nach Auswegen und Lösungen suchen“, so Adelheid Gruber, eine der Sprecher*innen des Freundeskreises.

Vier Impulsreferate zu den Themen „Über die Flüchtlingspolitik der EU und der BRD“, „Weltweite Fluchtursachen und Gegenstrategien“, „Die Lage der Geflüchteten und Proteste dagegen“ und „Handlungsperspektiven“ boten viel Stoff zu Diskussion und Erfahrungsaustausch. Das Referat eines Aktivisten aus Togo über Fluchtgründe und Diskussionsbeiträge über Kamerun und seine Geschichte wiesen nach: Europa und die westliche Welt haben mit ihrer Sklaverei- und Kolonialherrenvergangenheit Afrika um Jahrhunderte zurückgeworfen und entscheidend zur heutigen dramatischen Lage der Jugend in afrikanischen Ländern beigetragen. „Die Unterdrücker haben nur die Hautfarbe gewechselt“ so der Referent aus Togo, denn den Reichtum Afrikas beuten heute internationale Monopolkonzerne aus – mit Wissen und Zustimmung korrupter afrikanischer Regierungen.

Widerstand dagegen wird nicht zuletzt mit militärischer Hilfe aus Europa unterdrückt. „Die massive Rechtsentwicklung der Regierung, die die EU abschottet vor den Menschen, die vor den Folgen der neokolonialen und imperialistischen Politik fliehen, fordert uns heraus: wir wollen keine einzige Diskriminierung, keinen behördlichen Rassismus, keine ungerechte Abschiebung unwidersprochen lassen! Wir stehen ein für ein Recht auf Flucht! Mit einer gemeinsam beschlossenen Erklärung bringen wir zum Ausdruck: Die Angst, die nach der unerhörten Kriminalisierung der Ellwanger Flüchtlinge wirkte, kann durch den engen Schulterschluss und wachsende Zusammenarbeit der Flüchtlings- Bleiberechts-, antirassistischen, demokratischen und revolutionären Bewegung überwunden werden“ so Adelheid Gruber über das Ergebnis des Kongresses. „Jetzt reden wir! hat mit diesem Kongress eine neue Etappe 2.0 eröffnet. Die Ellwanger Schule wird weiter Schule machen.“

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

————————————————————

Grafikquelle       :          Alassa_Mfouapon_mit_Adelheid_Gruber.jpg

Alle unsere eigenen Veröffentlichungen, Werke, Fotos, Grafiken unterliegen keinem Copyright und können frei unter Nennung der Quelle verwendet werden.

Quelle    :       Arbeit  –  Zukunft-online

Abgelegt unter Baden-Württemberg, Flucht und Zuwanderung, Kultur, Mensch | Keine Kommentare »

Richternd

Erstellt von DL-Redaktion am 3. Dezember 2019

Schöffe am Amtsgericht in Euskirchen

File:1031616 Amtsgericht Euskirchen.jpg

Quelle       :         untergrund-blättle     CH.

Von   Richard Albrecht

Im letzten Jahrzehnt war ich vor einigen Jahren einige Jahre lang ehrenamtlicher Richter. Genauer: (Hilfs-) Schöffe an einem Amtsgericht in der Rheineifel.

Euskirchen, historisch Oiskirchn, ist das Tor der Eifel. Aber nicht alle Euskirchner sind Eifler Toren. Es hat auch dort einige Autoren.

Das dortige Amtsgericht ist baulich neu und liegt zentral für alle, die mit dem Zug oder dem Auto anreisen. In den Kleinen Saal wurde in Handschellen reingebracht ein Angeklagter, den ich gut ein Jahrzehnt vor der Verhandlung einmal beobachtete wie er am Bach Frösche fing und mit dem ich über die Jahre auch zwei, drei Sätze irgendwas sprach.

Was er getan haben sollte Jahre bevor er als Angeklagter befragt wurde fiel unters Jugendstrafrecht.

Merkwürdig war, dass Monate vergingen bevor er nach erster polizeilicher Auffälligkeit vor seinen ersten Richter kam. Ich fragte nach. Der Berufsrichter am Amtsgericht war lange Jahre lang Direktor des nahegelegenen Hauses, in dem ich später 15 Tage als Busse für die angebliche „Beleidigung“ eines Rechtsadvokaten abbüssen sollte. Er liess als Vorsitzender pausieren und erklärte im Beratungsraum wortreich, warum´s so war damit das wirken konnte, was Pädagogik genannt wird.

Ob der – nun – junge Mann, den ich – wieder´n paar Jahre später – noch einmal zwischen Regalen in einem Supermarkt sah und den ich an seinen so hellen wie wachen Augen wiedererkannte, nun schlussendlich wegen seines ersten Altdelikts verurteilt wurde oder auch nicht, kann ich nicht wissen.

Die Verhandlung, an der ich laienrichterlich teilnahm, musste aus formalen Gründen vertagt werden.

Die letzte Gerichtsverhandlung, an der ich, ehrenamtlich überhöht sitzend, teilnahm, war geheim: „aus Gründen“ des Jugendschutzes wurde was „die Öffentlichkeit“ heisst ausgeschlossen.

Der alte Mann war das erste Mal in seinem Leben öffentlich angeklagt. Er fühlte sich unschuldig und schämte sich nicht. Sondern hatte Angst vor seiner Frau. Denn er sollte, so staatsanwaltschaftliche Ermittlungen, von hinten eine Minderjährige begrapscht haben.

Diese erschien gross und prall. Die Gutachterin wissend und eifernd.

Der Mann war nicht nur ein alter, sondern auch ein kleiner Mann. Würde er wie allseits beredt behauptet die Titten nicht nur von hinten, sondern auch von oben begrabscht haben, hätte er auf einer kleinen Leiter oder auf einigen Telefonbüchern der Kreise Bergheim-Düren-Euskirchen stehen müssen.

Als ich dies, ehrenamtlich-richternd und gutachterlich-kritisch, anmerkte – herrschte sekundenlang so kundiges wie beredtes Schweigen.

Was den Vorsitzenden trotz Advokatenprotest nicht hinderte, wie Basta durchzuziehen. Und den kleinen alten Mann, der seine Unschuld beteuerte und den die Angst vor seiner Frau schwitzen machte, zu einer milden Geldstrafe zu verurteilen.

Die Verhandlung wurde weder zur Beratung unterbrochen noch später ausgesetzt.

Diesen Berufsrichter sah ich erst Monate später in anderem Zusammenhang im selben Amtsgericht während meines eigenen, von ihm beförderten, Prozesses wegen angeblicher „Beleidigung“ eines Bonner Rechtsadvokaten ebendort wieder – in der Gerichtskantine, nachdem der gegen mich als Angeklagten veranlasste Prozess wegen Besorgnis berufsrichterlicher Befangenheit vertagt wurde.

Seitdem ward er von mir nimmer gesehen.

Und das war und das ist auch nur gut so.

Diese Kurzerzählung erschien zuerst im Sammelband des Autors HELDENTOD. Kurze Texte aus Langen Jahren (Aachen: Shaker Media, 2011).

—————————————————————-

Grafikquelle          :         Amtsgericht Euskirchen, Sept. 2007

Author Wikoli       —        Source  :  Own work

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

Abgelegt unter Justiz-Kommentare, Nordrhein-Westfalen, Schicksale, Überregional | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 3. Dezember 2019

Die Welt als Wunder

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ariane Lemme

Dialektik der Aufklärung 2.0. Die Woche hat mal wieder gezeit, wie eng Diskurse geführt werden. Eine gute Party funktioniert anders.

Ein bisschen befremdlich finde ich es ja immer, wenn Erwachsene andere Erwachsene (meist auf Buchrücken oder in schlecht geschriebenen Rezensionen) dafür loben, „noch staunen zu können wie ein Kind“. Der Welt nicht gleichgültig, sondern mit Liebe und Aufmerksamkeit begegnen kann man auch, ohne dass man fallenden Blättern hinterhertaumelt und bei jeder Äußerung, die nicht dem eigenen Weltbild entspricht, die Kinnlade fallen lässt. Diese Woche aber war die Welt mal wieder derart Freakshow, dass ich, trotz déformation professionelle, sprich: zum Zynismus erzogen, aus dem Staunen nicht herausgekommen bin.

Dabei fing alles ganz harmlos an. Ich war nach Hannover gefahren, um mal etwas Schönes zu machen. Ein Baby angucken. Über Babys, das gebe ich zu, konnte ich schon immer staunen, so viel Persönlichkeit auf so wenig Kubikzentimetern zusammengefaltet.

Dann aber ging’s los: Massen an Polizisten, die meisten zu Pferd, als wollten sie Game of Thrones reenacten. Tatsächlich aber wollten sie 120 NPD­lern (Sie erinnern sich – diese Partei, die zu irrelevant war, um sie zu verbieten) ihr Recht auf Demonstrationsfreiheit sichern. Na gut, dachte ich, der Rechtsstaat funktioniert, wer nicht verboten ist, darf eben demonstrieren. Auch wenn er, anerkanntermaßen, verfassungsfeindlich ist. Bitte sehr.

Über genau diesen funktionierenden Rechtsstaat hab ich mich dann aber, kaum zurück in Berlin, doch sehr gewundert. Nämlich als er dem Verein VVN-BdA, kurz für Vereinigung der Verfolgten des Naziregimes – Bund der Antifaschistinnen und Antifaschisten, die Gemeinnützigkeit aberkannte.

Grund: Der Landesverband in Bayern sei im bayerischen Verfassungsschutzbericht wiederholt als „linksextremistisch beeinflusst“ bewertet worden. Eigentlich ist zu dem Thema alles gesagt, namentlich hier in dieser Zeitung von ­Jagoda Marinić.

Sprachlos bin ich trotzdem noch angesichts der kognitiven Dissonanz, die bei denen grassieren muss, die nach dem antisemitischen Anschlag in Halle gerade erst allerlei Dinge im Kampf gegen den Antisemitismus gefordert haben. Mehr Gesetze, mehr Zivilgesellschaft, mehr Blabla. Ganz nach dem Motto: Wie soll ich wissen, was ich denke, bevor ich höre, was ich sage?

Quelle         :          TAZ         >>>>>       weiterlesen

———————————————————————

Grafikquellen       :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Berlin, Kultur, Positionen, Überregional | Keine Kommentare »

Vom Erfolg überrumpelt

Erstellt von DL-Redaktion am 2. Dezember 2019

Zerknitterte Verlierer, überraschte Sieger:

2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg

Aus Berlin von Stefan Reinecke

Mit der neuen SPD-Spitze bahnt sich ein Machtkampf um den Verbleib in der Großen Koalition an.

m Samstagabend um 18.08 Uhr ist klar, dass Olaf Scholz und Klara Geywitz nicht neue SPD-Chefs werden. Lars Klingbeil, für unverwüstlichen Frohsinn bekannt, schaut ziemlich betreten drein. Er hatte den langwierigen Wahlprozess gemanagt – jetzt wackelt der Job des Seeheimers als Generalsekretär. Die SPD hat zum ersten Mal seit sehr langer Zeit eine linke Parteiführung. Bei der versammelten Hauptstadtpresse im Willy-Brandt-Haus herrscht ratloses Erstaunen. Auf allzu viele Sympathien werden Saskia Esken und Norbert Walter-Borjans bei den Leitmedien eher nicht rechnen können.

Fast die gesamte Parteispitze, Ministerpräsidenten wie Stephan Weil, die BundesministerInnen, die überwältigende Mehrheit der Bundestagsfraktion hatten Scholz und Geywitz unterstützt. Das Basisvotum sollte Scholz mit besonderer Legitimität ausstatten. Das war der Plan der SPD-Spitze.

Geywitz versichert tapfer, dass sie die Sieger unterstützen wird, und verlässt danach schnell das Willy-Brandt-Haus. Olaf Scholz trägt einen schwarzen Anzug und sagt, er wünsche der neuen Führung alles Gute. Es ist für den Vizekanzler, der Kanzlerkandidat der SPD werden wollte, eine herbe Niederlage. 53 Prozent zu 45 – es ist nicht einmal der befürchtete ganz knappe Ausgang geworden.

Es gibt bei dieser Wahl viel Einmaliges. Die Basis stimmt gegen die SPD-Führung. Die neuen Chefs kommen nicht aus der Parteielite. Sie waren nicht zuvor im Vorstand – und sind auch sonst untypisch für SPD-Spitzenfunktionäre. Norbert Walter-Borjans war nie Parlamentarier und hatte nie ein Parteiamt inne. Saskia Esken, erst seit ein paar Jahrenim Bundestag, spielte dort keine herausragende Rolle. Die SPD-Führung rekrutiert sich aus Juristen und Politikwissenschaftlern. Die Parteilinke Esken hat ein Studium abgebrochen, als Kellnerin, Schreibkraft und Fahrerin gejobbt, drei Kinder großgezogen, ehe sie sich als Informatikerin weiterbildete und spät in die Politik ging. Recht ungewöhnlich für eine SPD-Chefin.

Zerknitterte Verlierer, überraschte Sieger. Es ist ein Abend inniger Wünsche und beklommener Hoffnungen. Als Walter-Borjans und Esken auf dem Podium die unerwartete Siegerpose geübt und Daumen in die Höhe gereckt haben, geben sie eineinhalb Stunden lang Interviews. „Wir reichen allen, die nicht für uns gestimmt haben, beide Hände“, sagt SaskiaEsken. Die neue Führung sendet Friedensbotschaften. Nein, man werde nicht automatisch die Große Koalition beenden. Ja, Olaf Scholz werde Finanzminister bleiben. Und ja, man wisse, dass 45 Prozent nicht für sie gestimmt haben.

Aber was genau jetzt passieren wird, liegt im Nebel. Am Freitag beginnt der Parteitag in Berlin. Endet die Große Koalition? Oder geht es nur darum: Wann? Die neue SPD-Führung will mit der Union nachverhandeln. Sie hat vorab einen Katalog vorgelegt, der nach Wunschtraum klingt: 12 Euro Mindestlohn sofort, ein großes Investitionsprogramm und das Ende der schwarzen Null, ein neues Klimapaket. Alles richtig, aber mit der Union nicht ­machbar.

Manchmal klingt Esken und noch mehr Walter-Borjans auch elastischer. Man wisse ja, dass man mit der Union nicht das SPD-Programm durchsetzen werde, so Esken. Das seien erst mal die Forderungen, sagt Walter-Borjans. Dies war ein immer wieder wiederholtes Argument der beiden im internen SPD-Wahlkampf: Die SPD nehme den Kompromiss immer schon vorweg, statt allen klarzumachen, was sie fundamental von der Union unterscheidet. Angesichts der nahenden Rezession müsse sich doch auch die Union bewegen, hofft Walter-Borjans.

Muss sie? CDU-Chefin Annegret Kramp-Karrenbauer und andere Unionspolitiker haben Verhandlungen bereits ausgeschlossen. Das war vielleicht etwas vorschnell. Gesprächsblockaden wirken wenig souverän.

2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2562.jpg

Vom SPD-Parteitag erwartet Walter-Borjans eine „heftige Debatte um die schwarze Null“. In den paar Tagen bis Nikolaus wird es mit der Union keine Verhandlungen geben. Der Parteitag wird einen Forderungskatalog für Verhandlungen beschließen. Wie hart oder weich der ausfällt, wird der entscheidende Streitpunkt. Der Leitantrag wird auch die Blaupause sein, die anzeigt, wie das neue Machtgefüge aussieht (siehe Interview mit Karl Lauterbach).

Die SPD-Bundestagsfraktion hat angesichts von Umfragewerten bei 13 Prozent wenig Lust auf Neuwahlen. Bricht also jetzt ein Krieg zwischen Parteispitze und Fraktion aus? Walter-Borjans äußert sich da sibyllinisch: „Zwischen Partei und Fraktion ist ein Spannungsfeld nötig und richtig. Die Fraktion muss wissen, wo ihre Loyalitäten liegen“. Wenn die Partei aber den Ausstieg aus der Groko beschließe, müsse die Fraktion folgen.

Quelle          :       TAZ        >>>>>           weiterlesen

Große Koalition und Neuwahlen

Zwischen Partei und Regierung

Maischberger - 2019-03-06-6426.jpg

Kommentar von Ulrike Herrmann

Gerade die SPD ist jetzt besser aufgestellt, um noch zwei weitere Jahre in der Groko zu überleben. Mit einer Arbeitsteilung, von der alle profitieren.

Totgesagte leben länger: Dieses banale Sprichwort passt bestens, um die Zukunft der Großen Koalition zu beschreiben. Auf den ersten Blick scheint die Diagnose klar, die ein Arzt für parteipolitische Krankheiten stellen muss: Die Groko hat keine Chance mehr. Die künftigen SPD-Spitzen Walter-Borjans und Esken wollen neu über die Koalition verhandeln, während die Union genau dies ablehnt.

Trotzdem wäre es verfrüht, mit Neuwahlen zu rechnen. So angeschlagen der Patient Groko wirkt: Für Union und SPD wäre es unerfreulich, wenn es zu einem Urnengang käme. Denn beiden Parteien fehlt eine geeignete KanzlerkandidatIn.

Die Karriere von Olaf Scholz hat sich an diesem Samstag erledigt. Nach seiner SPD-internen Niederlage kann er zwar Finanzminister bleiben, aber mehr ist nicht mehr drin. CDU-Chefin Kramp-Karrenbauer wiederum ist bei den WählerInnen so unbeliebt, dass parteiintern längst nach Alternativen gesucht wird.

Noch schlimmer: Beide Regierungsparteien sind in Flügel zerfallen. Bei der SPD verläuft die Front horizontal zwischen Fraktion und Basis, wenn es um die Frage geht, wie „links“ die Partei sein soll. Bei der Union hingegen geht die Spaltung vertikal durch die Partei. Auf jeder Ebene wird um den richtigen Kurs gekämpft, und dieser Dauerstreit beginnt schon ganz oben – mit Schäuble gegen Merkel. Was „konservativ“ sein soll, ist strategisch schwer zu definieren. Rückt man zu sehr nach rechts, könnten viele Unionswähler zu den Grünen überlaufen. Ist man zu mittig, könnte die Union an die AfD verlieren.

Gerade die SPD ist jetzt besser aufgestellt

SPD und Union benötigen Zeit, um ihre Flügelstreitigkeiten auszutragen, an ihren Programmen zu feilen und KanzlerkandidatInnen zu finden. Da wäre es höchst unüberlegt, die Groko enden zu lassen. So paradox es wirken mag: Gerade die SPD ist jetzt besser aufgestellt, um noch zwei weitere Jahre in der Groko zu überleben. Denn es könnte zu einer Arbeitsteilung kommen, von der alle profitieren. Das neue Spitzenduo sorgt fürs linke Programm – während die SPD-Minister pragmatisch regieren.

Quelle        :           TAZ        >>>>>        weiterlesen

——————————————————————–

Grafikquellen         :

Oben       —         Team Saskia Esken und Norbert Walter-Borjans bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg
  • Erstellt: 2019-09-10 18:00:40

——————————-

2.) von Oben     —         Team Klara Geywitz und Olaf Scholz bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2565.jpg
  • Erstellt: 2019-09-10 18:54:20

————————————

Unten         —        MAISCHBERGER am 6. März 2019 in Köln. Produziert vom WDR. Thema der Sendung: „Attacke auf die Reichen: Beschimpfen, besteuern, enteignen?“ Foto: Ulrike Herrmann, Journalistin

Abgelegt unter Berlin, P.SPD, Regierung, Sozialpolitik | Keine Kommentare »

NRW / Sagel verläßt Linke

Erstellt von DL-Redaktion am 2. Dezember 2019

NRW – Leitlinien und ein Austritt in Bielefeld

Rüdiger Sagel.jpg

Von Sebastian Weiermann, Bielefeld

Der Landesparteitag der LINKEN in Nordrhein-Westfalen hat die Kommunalwahl 2020 vorbereitet.

Für die Linkspartei in Nordrhein-Westfalen ist es nicht leicht, auf sich aufmerksam zu machen. Zwar kommen zu ihrem Parteitag am Wochenende in Bielefeld prominente Bundestagsabgeordnete aus dem Bundesland und mit Özlem Alev Demirel sitzt nun eine fest in der nordrhein-westfälischen LINKEN verankerte Politikerin im Bundestag, aber der Partei fehlt die Präsenz im Landtag.

Ein bisschen Glanz brachte der Parteivorsitzende Bernd Riexinger in den Parteitag. In seiner Rede sprach er sich gegen die AfD und für Solidarität mit der antifaschistischen Organisation VVN-BdA aus. Das neue Vorsitzendenduo der SPD aus Esken und Walter-Borjans kommentierte Riexinger wohlwollend. Es sei zwar fraglich, ob es wirklich eine Erneuerung der SPD gäbe, aber die abstimmenden Mitglieder hätten sich für eine »sozialdemokratischere« Partei ausgesprochen. Das sei kein Grund, von Zusammenschlüssen zu träumen. Die LINKE habe ihren Platz links von der SPD. Sie kämpfe für »demokratischen Sozialismus«. Über Saskia Esken wusste Riexinger noch zu berichten, dass er sie im Jugendzentrum »zum Teil mit politisiert« habe. Das habe offensichtlich nur für die SPD gereicht – aber »immerhin linker Flügel«, wie er anmerkte.

Zentrales Thema des Parteitags war allerdings nicht die SPD, sondern die Vorbereitung auf die Kommunalwahlen, die im September 2020 stattfinden. Dass die Themen dafür in den Städten gesetzt werden, war den Delegierten klar. Aber man wollte mit den »Kommunalpolitischen Leitlinien« einen »Steinbruch« entwickeln, aus dem die Kreisverbände sich bedienen können, wie Landessprecher Christian Leye erklärte. Es sei wichtig, sich auf Landesebene über gewisse Positionen verständige. Man sende damit ein »Signal«, wo man stehe. Die Leitlinien, die er Parteitag beschlossen hat, umfassen mehr als 100 Seiten und bilden das ganze Spektrum der Politik ab. Darin geht es sowohl um größere Fragen, wie der Positionierung der LINKEN gegen Hartz-IV-Sanktionen, als auch um Details, etwa ob man für oder gegen Kunstrasenplätze sei. Diskutiert wurde, ob in den Leitlinien von »Arbeitslosigkeit« oder »Erwerbslosigkeit« die Rede sein solle. Für den ersten Begriff spreche dessen Allgemeingültigkeit, für den zweiten, dass Lohnarbeit damit nicht überhöht würde, worauf die Delegierten sich dann einigten.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Laut und leidenschaftlich wurde es nur selten. Etwa bei der Frage danach, ob der Energiekonzern RWE »verstaatlicht« oder »zerschlagen« werden sollte oder beim Thema Prostitution, bei dem es eine Bandbreite an Positionen gibt, die von einer Liberalisierung bis zum Sexkaufverbot reicht. Man einigte sich auf Grundsätzliches wie Beratungsangebote und die Stärkung von Hilfsmöglichkeiten für die Menschen in der Branche.

Quelle          :          ND         >>>>>           weiterlesen

—————————————————————–

Grafikquellen       :

Oben       —         Rüdiger Sagel

—————————-

Unten        —       Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Überregional | Keine Kommentare »

Thüringen als Menetekel:

Erstellt von DL-Redaktion am 2. Dezember 2019

Wie man aus Rechtsradikalen Bürgerliche macht

2019-10-27 Wahlabend Thüringen by Sandro Halank–81.jpg

von Albrecht von Lucke

Am Anfang war Thüringen: Vor bald 90 Jahren, am 23. Januar 1930, konnten die Nationalsozialisten dort ihre erste Beteiligung an einer deutschen Landesregierung feiern. Und zwar mit einem Staatsminister für Inneres und Volksbildung namens Wilhelm Frick, der nur drei Jahre später zum Reichsminister des Innern im Kabinett des frisch gekürten Reichkanzlers Adolf Hitler ernannt wurde. Dahinter steckte bekanntlich das Kalkül des (neben Hindenburg zweiten) Kanzlermachers, Franz von Papen, dem die wohl fatalste Fehleinschätzung der deutschen Geschichte zugeschrieben wird: „In zwei Monaten haben wir Hitler in die Ecke gedrückt, dass er quietscht!“[1]

Ausgerechnet in Thüringen kann man dieser Tage erleben, wie es wieder einmal „quietscht“ – und eine in erheblichen Teilen rechtsradikale Partei durch eine bürgerliche Partei hoffähig gemacht wird. Ausgangspunkt dafür war das Patt bei den jüngsten Landtagswahlen, das weder die Fortsetzung des rot-rot-grünen Bündnisses unter Bodo Ramelow ermöglichte, noch einen Machtwechsel zugunsten seines Herausforderers, des CDU-Spitzenkandidaten Mike Mohring. Im Gegenteil: Da die CDU von 33,5 Prozent auf nur noch 21,7 Prozent der Stimmen regelrecht abstürzte, erwog Mohring – auch um sich durch eine Regierungsbeteiligung vor den innerparteilichen Attacken zu retten – Gespräche mit dem Wahlsieger Ramelow. Was folgte, war ein Aufschrei in fast der gesamten Union: Mit der „Partei der Mauerschützen“ könne man nicht reden oder gar Koalitionen bilden.

Noch bezeichnender war allerdings etwas anderes: Kaum hatte Mohring diese Überlegung angestellt, befand der stellvertretende Thüringer CDU-Fraktionschef Michael Heym, es gebe ja in diesem neu gewählten Landtag „eine bürgerliche Mehrheit rechts“, nämlich CDU, FDP und AfD. Und in der AfD sehe er ohnehin eine konservative Partei. Das einzige Problem sei deren Landeschef Björn Höcke, der Umgang mit allen anderen Abgeordneten hingegen gut. Auch wenn eine Zusammenarbeit ja nicht gleich in einen Koalitionsvertrag münden müsse, hätte er, Heym, kein Problem damit, wenn die AfD ein Bündnis mit einem CDU-Ministerpräsidenten toleriere.[2]

Was für ein Tabubruch! Ein bürgerliches Bündnis unter Einbeziehung der AfD: Noch vor Kurzem hätte man sich dergleichen nicht vorstellen können. Doch Thüringen macht das Undenkbare vorstellbar. Denn mit einer Tolerierung durch die AfD ist diese indirekt an der Regierung beteiligt. Und zugleich ist dies, wie die Geschichte lehrt, der Einstieg in zukünftige Koalitionen. Damit wird die Abgrenzung der Union nach rechts aufgehoben. Doch Konsequenzen? Fehlanzeige. Im Gegenteil: Am Anfang war es „nur“ der stellvertretende Fraktionschef Heym, aber kurz darauf plädierten bereits 17 Thüringer CDU-Funktionäre für „ergebnisoffene“ Gespräche mit der AfD. CDU-Generalsekretär Paul Ziemiak bezeichnete diese Überlegungen zwar als „irre“, schließlich gebe es einen klaren Unvereinbarkeitsbeschluss, der Koalitionen mit der AfD wie mit der Linkspartei auf Bundes-, aber auch auf Landesebene ausschließt. Doch anstatt ihn abzustrafen, wurde Heym umgehend als stellvertretender Fraktionschef wiedergewählt, auf Vorschlag von Mike Mohring.

Hier zeigen sich der enorme Autoritätsverlust der CDU-Bundesspitze wie auch die Eigenwilligkeit der ostdeutschen Landesverbände, die offensichtlich große Nähe zur AfD empfinden und einen immensen Willen zur Macht haben. Das aber wirft die Frage auf, wie lange noch die Bundes-CDU diesem wird etwas entgegensetzen können – oder ob wir es tatsächlich schon in Kürze mit Koalitionen zwischen CDU und AfD zu tun bekommen.

Relativierung des Rechtsradikalismus

Denn hier liegt das grundlegende strategische Dilemma der CDU: Bereits mit der Eurokrise 2013, aber mehr noch seit der Fluchtkrise von 2015 ist die AfD als rechte Konkurrenz in das bürgerliche Lager eingebrochen und hat es durch die eigene Selbstradikalisierung tief und nachhaltig gespalten. „Bürgerliche Mehrheiten“ sind damit auch in vormals klassischen CDU-Ländern – wie Sachsen, Thüringen, aber auch Baden-Württemberg – auf unabsehbare Zeit ausgeschlossen. Und zugleich steigt die Versuchung der Union, die Stimmen für die AfD in das demokratische Spektrum zurückzuholen, indem man die AfD als bürgerliche Partei etikettiert, um so wieder zu Mehrheiten zu kommen. Die fatale Konsequenz liegt auf der Hand: Wer der AfD ein bürgerliches Mäntelchen umhängt, macht sie hoffähig.

Insofern hat die Thüringer CDU die Büchse der Pandora geöffnet. Denn wer den Eindruck erweckt, man habe es bei der AfD mit einer bürgerlichen Partei zu tun, relativiert zugleich deren Rechtsradikalismus. Michael Heym erklärt denn auch prompt die AfD in Thüringen für in Gänze ungefährlich, mit einer Ausnahme: Björn Höcke. „Und“, so Heym weiter, „den immer gleichlautenden Reflex, dass das [die Wählerinnen und Wähler] alles Nazis wären, den teile ich so nicht“.

So richtig es ist, dass auch massive Versäumnisse der anderen Parteien zur Wahl der AfD führen: Die Argumentation Heyms bagatellisiert die Tatsache, dass von den Wählerinnen und Wählern der Thüringer AfD auch deren Spitzenkandidat Höcke gewählt wurde – ein dezidierter Rechtsradikaler, der bewusst den Schulterschluss mit dem antisemitischen Anführer von Pegida sucht.[3] Wer sich mit einer solchen Partei einlässt, gibt klar zu verstehen, dass er nicht bürgerlich, sondern rechts wählt. Zugleich stellt sich die Frage, ab wann das, was manche Wählerinnen und Wähler nur als Protestwahl deklarieren, auch ein klares rechtsradikales Bekenntnis ist.

2019-10-27 Wahlabend Thüringen by Sandro Halank–60.jpg

Zugespitzt gefragt: Würden wir die Wählerinnen und Wähler, die Hitler „aus Protest“ gegen die „System“-Parteien – damals NS-, heute AfD-Jargon – gewählt haben, heute nicht auch Nazis nennen? Ab wann also wird ein Wähler einer rechtsradikalen Partei selbst zum Rechtsradikalen? Diese Frage muss gestellt werden. Denn die Behauptung, dass es sich nur um eine Protestwahl gehandelt habe, ist eine Exkulpation der AfD-Wählerinnen und Wähler, von denen 72 Prozent erklären, dass das AfD-Wahlprogramm wichtig für ihre Wahlentscheidung war.[4] Heyms Argumentation – alle bürgerlich, außer Höcke – verkennt zudem völlig, dass unter Höcke eine rechtsradikale Parteibasis existiert, die ihn immer wieder fast per Akklamation zum unangefochtenen Führer der Thüringer AfD gewählt hat. Durch die Behauptung, eigentlich gehe es nur um die Personalie Höcke, ansonsten wäre die AfD problemlos, werden seine massenhaften Anhänger in der Partei wie in der Wählerschaft zum Verschwinden gebracht – und so die AfD akzeptabel gemacht. Das Ziel ist klar: Indem die AfD ins bürgerliche Lager eingemeindet wird, soll sie koalitionstauglich und die CDU damit wieder mehrheitsfähig gemacht werden. Faktisch aber ist es eine Strategie der bewussten Verharmlosung einer rechtsradikalen Partei, die sich in Thüringen dezidiert für den Führer Höcke und dessen Programm entschieden hat.[5]

Die Lebenslüge der CDU

Quelle        :        Blätter         >>>>>         weiterlesen

——————————————————————-

Graqfikquellen          :

Oben        —      Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke), Christian Müller (MDR)

Abgelegt unter L. Thüringen, Medien, Positionen, Regierung | Keine Kommentare »

Eine Schifffahrt, die ist …

Erstellt von DL-Redaktion am 1. Dezember 2019

Die Binnenschifffahrt könnte dabei helfen die Klimaziele zu retten

SophienhafenHalle WSA.JPG

Von Annette Jensen

Die Binnenschifffahrt könnte dabei helfen, die deutschen Klimaziele zu erreichen. Doch die marode Infrastruktur und der Trend zu immer schnelleren Lieferungen erschweren das.

Warten. Am Kai nebenan quietscht seit Stunden ein Kran, der Getreide in ein Schiff schaufelt. Auf der „MS Catharina“ aber ist es still. Ab und zu fegt eine Sturmböe über das flache Schiff und das eingezäunte Gelände im Magdeburger Hafen, auf dem plastikverpackte Rotoren und andere Bauteile für Windräder lagern. Bei diesem Wetter ist es zu gefährlich, 68 Meter lange Flügel zu verladen.

Für Kapitän Klaus Hohenbild, seinen Bruder Karl Georg und seinen Sohn Christoph war das Wochenende am Sonntag schon vorbei. Da sind sie knapp fünf Stunden mit dem Auto von ihrer Heimatstadt Emmerich am Rhein nach Magdeburg an der Elbe gefahren. Sie wollten unbedingt rechtzeitig auf ihrem Schiff sein, wenn der Lkw mit ihrer Ladung eintrifft. Doch jetzt müssen sie erst mal warten.

Zweimal hat Klaus Hohenbild oben am Kai schon nachgefragt. Dann kam der Anruf: Heute nicht. Morgen, vielleicht. Der 65-Jährige brummt und schaut aus dem Fenster. Das Schiff bewegt sich kaum. Vom Sturm merkt man im Bauch der 100 Meter langen „MS Catharina“ so gut wie nichts.

Wenn es nach der Bundesregierung geht, sollen Familie Hohenbild und ihr Schiff dabei helfen, die deutschen Klimaziele zu erreichen. Sie will den Gütertransport von der Straße auf Schienen und Flüsse verlagern. Das Bundesverkehrsministerium unter Andreas Scheuer will die „Attraktivität für Industrie und Logistik steigern“, heißt es im Klimaschutzprogramm.

Denn der Transport auf dem Wasser ist deutlich klimafreundlicher als mit dem Lkw, die in Deutschland gegenwärtig über 70 Prozent des Transports abwickeln. Die Binnenschifffahrt dümpelt bei gerade mal 8 Prozent vor sich hin. Laut Umweltbundesamt werden bei Gütertransporten mit dem Lkw Treib­haus­gase der Menge 103 Gramm pro Tonnenkilometer ausgestoßen, mit der Binnenschifffahrt sind es nur 32 Gramm. Noch in den 1960er Jahren teilten sich Bahn, Laster und Schiff die Transporte zu etwa gleichen Teilen – danach ging es mit der Schifffahrt ab- und mit dem Straßentransport aufwärts. Wie kam die Schifffahrt in die Krise? Und kann man das Ruder wieder rumreißen?

Karl Georg will jetzt etwas tun, um die Wartezeit zu überbrücken. Bekleidet mit Blaumann und ausgebleichtem Stoffhütchen steigt er die steile Treppe in den Maschinenraum hinunter, um dort ein bisschen aufzuräumen und Werkzeuge und Farbtöpfe zu sortieren. Alles ist gut ausgeleuchtet hier, Boden und Bleche sind rot und gelb lackiert, die Rohre grün. Es riecht nach Diesel, obwohl nirgendwo ein Tröpfchen Öl zu sehen ist. Nach einem Kohletransport schrubben sie den Frachtraum sechs bis sieben Stunden lang, bis dort bedenkenlos die nächste Ladung Korn, Dünger, Streusalz oder Windradflügel gelagert werden können. „Schrott transportieren wir nicht. Das gibt zu viele Beulen“, erzählt Karl Georg.

Die drei Hohenbilds hoffen, dass die Fahrt nach Bremen am nächsten Tag beginnen kann. Am Freitag sollen sie dort abladen, anschließend werden die Windradflügel in die Türkei verschifft. Jetzt ist es ist Montag. Sie haben also fünf Tage Zeit, um von Magdeburg nach Bremen zu kommen. Fünf Tage für 385 Kilometer. Das sollte schaffbar sein – oder?

Die Probleme der Schifffahrt

Wartezeiten gehören für Binnenschiffer zum Geschäft. Lade- und Löschzeiten sind Teil der Verträge. Und so werden die Hohenbilds auch für die Verzögerung in Magdeburg ein Ausfallgeld vom Auftraggeber bekommen. Das decke die laufenden Kosten aber kaum, sagt Klaus Hohenbild. Seine Familie ist auch Mitglied in einem Netzwerk, in dem er und seine Kollegen anonym ihre Frachtpreise einstellen, um einem Unterbietungswettbewerb entgegenzuwirken.

„Als ich anfing, war es eine Sensation, wenn eine Schleuse mal zwei Wochen lang nicht funktionierte“, erinnert sich Klaus Hohenbild, während er es sich auf dem Steuer­mannsitz im Führerhaus bequem macht und die Füße hochlegt. Fast 50 Jahre liegt seine Lehrzeit zurück; genau wie sein Sohn Christoph sein Azubi war, so hat auch er auf dem Schiff seines Vaters gelernt.

Klaus Hohenbild holt sein Handy raus, er möchte zeigen, was in der Binnenschifffahrt schief läuft. Auf einem Foto sieht man einen Mann in einem neongelben Anzug, der sich an einem Betonklotz festgekettet hat und an einem Seil zieht. „Das ist im Weser-Datteln-Kanal. Da setzen sie jetzt sogenannte Festmacher ein“, empört er sich. Sein Bruder Karl Georg kichert. Die Innenwände dieser Schleusen sind so marode, dass die Schiffe ihre Taue nicht mehr um die Poller legen dürfen. Obwohl es sich um eine der am meisten befahrenen Wasserstraßen handelt, erließ das Amt vergangenes Jahr auch die Anweisung, dass immer nur ein Schiff auf einmal einfahren darf.

Hohenbild wischt über den Bildschirm und zeigt eine unscharfe Aufnahme: ein winziges Sportboot, das in die über hundert Meter lange Schleusenkammer tuckert. Es ist klein genug, um gemeinsam mit anderen Schiffen durchgeschleust zu werden. Das geht aber nicht – wegen der Anweisung. So entstehen lange Warteschlangen. „Vier, fünf, sechs, sieben Stunden Wartezeit“, sagt Kapitän Hohenbild. Weil die verladende Industrie protestierte, setzt die Schifffahrtsverwaltung jetzt Männer im Dreischichtbetrieb ein, die den Schiffen beim Festmachen helfen. Wie lange dieses Provisorium weitergehen soll? „Weiß keiner. Wir wissen es jedenfalls nicht.“

Auf dem Weg bis nach Bremen müssen sie elfmal in eine Schleuse einfahren, um Staustufen zu überwinden. Auch hier heißt es häufig warten. Da ist die Schleuse Drakenburg, die seit Monaten klemmt. In Minden gibt es seit zwei Jahren eine neue Anlage, die aber nur von großen Schiffen genutzt werden darf. „Sie soll wohl geschont werden“, mutmaßt Kapitän Klaus Hohenbild. Die „MS Catharina“ muss hier oft stundenlang an der Anlage für kleinere Schiffe ausharren. Beide Schleusen werden aus der Ferne gesteuert – und eine parallele Bedienung ist offenbar nicht möglich oder vorgesehen. „Behörde“, stöhnt der sonst so gelassen wirkende Mann.

Zuständig für den Zustand der Schleusen und der Binnenschifffahrt ist die Wasser- und Schifffahrtsverwaltung (WSV). „Da ist kein Zug drin, das System ist krank, keiner will da die Verantwortung übernehmen“, sagt der Kapitän. Jeder Anruf bei der WSV sei schwierig. Oft erreiche er dort niemanden oder er müsse betteln, um zu einer zuständigen Person durchgestellt zu werden.

Erst ein paar Tage alt ist die Meldung, dass der Nord-Ostsee-Kanal für große Schiffe vorübergehend nicht passierbar ist, weil eine Schleuse in Brunsbüttel gewartet wird und sich die andere nicht vollständig öffnen lässt. In der Nische des Schleusentors hat sich Schlick angesammelt. Angesichts solcher Zustände findet es Klaus Hohenbild „zum Lachen“, dass dauernd von Digitalisierung und selbstfahrenden Binnenschiffen als Zukunftsvision die Rede ist.

Ruhrmündung Duisburg Luftaufnahme 2014.jpg

Doch lustig finden die Hohenbilds die Lage der Binnenschifffahrt nicht. Es hapert überall. Und seit Frühjahr nehmen die Frachtanfragen auch wieder ab, die Preise geraten unter Druck. „Die Kohle ist seit Langem auf dem absteigenden Ast, auch Sand und Kies sind rückläufig“, benennt Hohenbild ganz nüchtern die Probleme seiner Branche. Aufgeben aber ist für die Familie Hohenbild keine Option – und auch der 29-jährige Christoph geht fest davon aus, dass er sein gesamtes Berufsleben auf Flüssen und Kanälen verbringen wird. Seit mindestens 1850 gehört die Schifffahrt zur Familientradition der Hohenbilds.

Hört man den Männern zu, könnte man den Eindruck bekommen, dass die Krise der Binnenschifffahrt vor allem ein Ergebnis mangelnder Finanzierung von Schleusen und Technik ist. Die Bundesregierung will das mit einer Verdopplung ihrer Investitionen ändern. Aber die Probleme liegen gerade für das Familienunternehmen Hohenbild tiefer, oder besser: flacher. Fuhr der Vater von Klaus und Karl Georg noch mit einem 300-Tonnen-Frachter, so kann die „MS Catharina“ sechsmal so viel laden. „Das entspricht 74 Lkw“, rechnet Klaus Hohenbild vor. Damit gehört das Schiff heute eher zu den Kleinen: Fast alle neuen Schiffe sind inzwischen 135 Meter lang und für 3.500 Tonnen Last oder Containertransport vorgesehen – sie schippern fast ausschließlich auf dem tiefen Rhein, wo acht von zehn Transporten auf Flüssen stattfinden.

Quelle          :          TAZ          >>>>>          weiterlesen

——————————————————————-

Grafikquellen        :

Oben        —         Einfahrt zum Sophienhafen, Gebäude des Wasserstraßen- und Schifffahrtsamtes Magdeburg, Halle (Saale)

——————————-

Unten           —       Aerial shot of mouth of the Ruhr (River) River at Duisburg-Ruhrort into the Rhine

Abgelegt unter Nordrhein-Westfalen, Sachsen-Anhalt, Überregional, Wirtschaftpolitik | Keine Kommentare »

Bis heute ungeklärt :

Erstellt von DL-Redaktion am 1. Dezember 2019

Der Mord an Alfred Herrhausen

Gewerbegebiet Süd Eschborn 09.JPG

Quelle      :     Scharf  —   Links

Von Ernst Wolff

Vor dreißig Jahren, am 30. November 1989, wurde Alfred Herrhausen, Chef der Deutschen Bank, durch einen Bombenanschlag getötet. Auf Grund eines nicht verifizierten Bekennerschreibens und vager Indizien wurde der Anschlag der terroristischen Untergrundorganisation Rote Armee Fraktion (RAF) zugeschrieben. Die Mörder wurden jedoch nie ermittelt und mittlerweile gibt es zahlreiche Hinweise, die an der Täterschaft der RAF zweifeln lassen.

Trotzdem haben die Mainstream-Medien und die Behörden bis heute nicht die Frage gestellt, wer ein Interesse an Herrhausens Tod gehabt haben könnte. Zudem beschreiben sie ihn nach wie vor fälschlicherweise als Kapitalismuskritiker und als Träumer, der für eine Utopie sein Leben riskierte.

Tatsächlich war Herrhausen ein von der Marktwirtschaft überzeugter Banker, dessen erklärtes Ziel darin bestand, die Deutsche Bank an die Weltspitze zu führen und der als einer der ersten Europäer die Chancen erkannte, die der Umbruch im Finanzwesen den Großbanken in den Siebziger und Achtziger Jahren eröffnete. Vor allem aber war er ein Mann, der seine Ziele kompromisslos und mit großer Konsequenz und Härte verfolgte und der kein Problem damit hatte, sich viele Feinde zu machen.

Herrhausen erkannte früh die Chancen der Deregulierung

Nach dem Ende des Nachkriegsbooms, der die Deutsche Bank zum größten deutschen Finanzinstitut hatte aufsteigen lassen, suchten die Banken wegen des nachlassenden Kreditgeschäftes nach neuen Einnahmequellen und drängten die Politik, das Finanzwesen zu deregulieren und ihnen zu ermöglichen, das eigene Geschäft zu globalisieren.

Bereits im Anfangsstadium dieser Entwicklung nutzte Herrhausen die Möglichkeiten, die sich dadurch vor allem im Bereich des Investmentbankings ergaben und trieb die Neuausrichtung der Deutschen Bank ab Mitte der Achtziger Jahre energisch voran. Dabei zog er sich wegen seiner rigorosen Personalpolitik den Zorn großer Teile der traditionell konservativen Führung des Geldhauses zu.

Das aber hinderte ihn nicht daran, das Tempo des Umbaus sogar noch zu forcieren. Unter seiner Führung übernahm die Deutsche Bank zwischen 1986 und 1989 diverse Banken und  Wertpapier-Broker in Italien, den Niederlanden, Portugal, Spanien, Österreich, Kanada und Australien.

Eintreten für den Schuldenschnitt – kühle Kalkulation zum eigenen Vorteil

Im Herbst 1987 unterbrach Herrhausen die Jahrestagung des IWF in Washington für einen Kurzbesuch beim Präsidenten des hoch verschuldeten Mexikos. Am Tag darauf forderte er auf einer Pressekonferenz zum ersten Mal einen umfassenden Schuldenerlass für die Entwicklungsländer – ein Vorstoß, der weltweit Aufsehen erregte.

Es handelte sich dabei aber keineswegs um die Utopien eines Visionärs, sondern um ein in doppelter Weise kalkuliertes Manöver: Einerseits schwamm Herrhausen auf der populären Welle des damals weltweiten Protestes gegen die Politik von IWF und Weltbank, andererseits brachte er die Deutsche Bank so im internationalen Wettbewerb in eine besonders günstige Lage: Während ein solcher Schuldenschnitt mehrere amerikanische Banken in große Schwierigkeiten gebracht hätte, hätte die Deutsche Bank ihn weitgehend problemlos überstanden – weil Herrhausen sie zuvor ganz bewusst gegen einen solchen Schock abgesichert hatte.

Kein Wunder also, dass eine mächtige Front aus Wall Street, IWF und Weltbank Herrhausens Pläne samt und sonders empört zurückwies. Als er dann auch noch so weit ging, seine Ideen den Mitgliedern amerikanischer Banken zu präsentieren, wurde er anschließend so massiv bedroht, dass er sich gezwungen sah, auf der Weltbankkonferenz 1989 eine schusssichere Weste zu tragen.

Herrhausens hervorragende Beziehungen zur Politik

Der Schuldenschnitt aber war nicht die einzige Front, an der Herrhausen seine Gegner herausforderte. Neben seiner Tätigkeit als Bankchef beriet er auch noch Bundeskanzler Helmut Kohl und war maßgeblich an dem 10-Punkte-Programm zur deutschen Wiedervereinigung beteiligt, das Kohl am 28. November 1989 verkündete, und zwar ohne vorherige Absprache mit den Alliierten.

Außerdem ging die Deutsche Bank dank Herrhausens Beziehungen als einer der ganz großen Gewinner aus der deutschen Wiedervereinigung hervor. Ihr wurden bei der Abwicklung der DDR-Staatsbank und der Neugründung der Deutschen Kreditbank 49 % ihrer Anteile und 122 Bankfilialen in bester Lage übertragen – ein Macht- und Vermögenszuwachs, der hervorragend in Herrhausens Pläne passte, die Deutsche Bank zu einem „Global Player“ und so zum Konkurrenten der Wall-Street-Banken zu machen.

Der ganz große Coup

Mit einem derartigen Machtzuwachs ausgestattet, blies Herrhausen 1989 zum ganz großen Angriff auf die Wall Street und die City of London: Die in den Jahren zuvor sorgfältig vorbereitete Übernahme der britischen Investmentbank Morgan Grenfell für 2,7 Milliarden DM sollte der Deutschen Bank mit einem Paukenschlag den Einstieg ins internationale Derivategeschäft bescheren.

Damit aber warf Herrhausen nicht nur den weltweit größten Bankhäusern den Fehdehandschuh hin, sondern auch den eigenen Kollegen: Als er sie am 28. November 1989 bei einer Vorstandssitzung in München aufforderte, den Chef von Morgan Grenfell in den Vorstand der Deutschen Bank aufzunehmen, kam es zu einem Aufstand, den sein Nachfolger Hilmar Kopper als „Palastrevolution“ beschrieb.

Den letzten Höhepunkt in der Auseinandersetzung mit seinen Gegnern setzte Herrhausen schließlich in einem Interview mit dem ‚Wallstreet Journal’, in dem er erklärte, dass er Polen mit Hilfe einer eigenen Bank und unter Umgehung der „strukturellen Anpassungen“ von IWF und Weltbank wirtschaftlich voranbringen wolle – ein weiterer Affront gegen beide Organisationen, den sich bis dahin kein führender Banker geleistet hatte.

Die Fragen, die bleiben

Ein nüchterner Blick auf Herrhausens Karriere zeigt, dass er nicht nur einer der ersten war, der die Chancen für das Finanzgewerbe im Investmentbanking erkannte und zum Vorteil der Deutschen Bank nutzte, sondern dass er zur Erreichung seiner Ziele auch mit eiserner Härte und letzter Konsequenz vorging und nie davor zurückscheute, sich Feinde zu machen.

Heute, dreißig Jahre später, muss man sich daher fragen, warum die Ermittlungen sich so lange fast ausschließlich um eine Terrororganisation drehten, die sich damals im Zustand der fortgeschrittenen Auflösung befand und an deren Täterschaft immer größere Zweifel aufkamen. Warum haben die zuständigen Behörden im Zusammenhang mit dem Attentat niemals die alles entscheidende Frage „Wer hätte ein Motiv gehabt?“ gestellt?

Bad Homburg Herrhausen-Stelen.jpg

Aufschlussreich ist in diesem Zusammenhang die Tatsache, dass Herrhausens Nachfolger Hilmar Kopper die Idee eines Schuldenschnittes für die Dritte Welt sofort fallen ließ und dass kein Deutsche-Bank-Chef nach Herrhausen je wieder öffentliche Kritik am IWF oder an der Weltbank geäußert hat.

Es ist gut möglich, dass wir nie erfahren werden, wer hinter dem Anschlag vom 30. November 1989 gesteckt hat. Je mehr Fakten man jedoch über seine Vorgeschichte aneinanderreiht und miteinander verknüpft, umso weniger wahrscheinlich erscheint die Version vom RAF-Attentat, die heute noch von den deutschen Behörden und der Mehrheit der Mainstream-Medien verbreitet wird.

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

—————————————————————

Grafikquellen      :

Oben   —        Stahlskulptur (2002) im Kreisverkehr an der Kreuzung der Frankfurter Straße mit der Mergenthalerallee und der Alfred-Herrhausen-Allee

———————————

Unten   —       Memorial for the assassination of Deutsche Bank CEO Alfred Herrhausen in 1989, Bad Homburg, Germany. The memorial indicates the position of the car bomb which killed Herrhausen. A 3rd stele on the other side of the road is not shown.

Abgelegt unter Deutschland, Finanzpolitik, Hessen, Regierung | Keine Kommentare »

Die Anti-Groko-Spitze

Erstellt von DL-Redaktion am 1. Dezember 2019

SPD wählt Esken und Walter-Borjans

2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg

Von  dpa/taz

Beim SPD-Mitgliederentscheid gewinnt überraschend das linke Duo Saskia Esken und Norbert Walter-Borjans. Sie liegen deutlich vor Scholz und Geywitz.

Die GroKo-Kritiker Norbert Walter-Borjans und Saskia Esken sollen nach dem Willen der Parteimitglieder Vorsitzende der SPD werden. Der frühere nordrhein-westfälische Finanzminister und die Bundestagsabgeordnete aus Baden-Württemberg gewannen die Stichwahl des Mitgliederentscheids mit 53,06 Prozent der Stimmen, wie die SPD am Samstag mitteilte. Ihre Konkurrenten, Vizekanzler Olaf Scholz und die Brandenburger Politikerin Klara Geywitz, kamen lediglich auf 45,33 Prozent.

Scholz und Geywitz haben den neuen Parteichefs ihre Unterstützung zugesagt. Die SPD habe mit Norbert Walter-Borjans und Saskia Esken nun eine neue Parteiführung und hinter dieser müssten sich alle versammeln, sagte beide nach der Verkündung des Ergebnisses im Willy-Brandt-Haus. Ziel bleibe, die SPD wieder stark zu machen, das sei gemeinsame Sache.

Olaf Scholz will trotz der Niederlage beim Mitgliederentscheid um den SPD-Vorsitz Bundesfinanzminister bleiben. Er werde nicht zurücktreten, erfuhr die Deutschen Presse-Agentur aus Parteikreisen.

Die Wahlbeteiligung lag bei rund 54 Prozent. Offiziell gewählt ist die neue Doppelspitze damit aber noch nicht. Der Parteitag in der kommenden Woche muss sie noch bestätigen, was allerdings als sicher gilt.

Quelle        :        TAZ         >>>>>          weiterlesen

Die neue SPD-Spitze ist links

Versöhnen statt spalten

2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2562.jpg

Kommentar von Stefan Reinecke

Die Wahl von Esken und Walter-Borjans ist ein historischer Einschnitt. Der SPD drohen Turbulenzen, wenn sie irreale Forderungen durchprügeln.

Das Votum für Saskia Esken und Norbert Walter-Borjans ist ein historischer Einschnitt. Denn es gehört zur DNA der Sozialdemokratie, dass die Basis am Ende immer murrend der Führung folgt. Doch die SPD-Basis glaubt den Glaubenssätzen des Weiter-so und den rituellen Beschwörungen der Verantwortungsethik nicht mehr.

Diese Wahl ist aber weniger eine für Esken und Nowabo und deren besonders glanzvolle Performance. Sie ist ein deftiges Misstrauensvotum gegen das Parteiestablishment, das komplett Scholz & Geywitz stützte. Dass die Wahlbeteiligung bescheiden war, zeigt, wie erschöpft die Partei ist.

Aber das verblasst angesichts der zentralen Frage: Es ist klar, was die SPD-Basis nicht mehr will, aber schwer zu erkennen, was sie will. Was kommt jetzt

Quelle         :         TAZ            >>>>>          weiterlesen

—————————————————————–

Grafikquellen       :

Oben       —         Team Saskia Esken und Norbert Walter-Borjans bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Esken Walter-Borjans by OlafKosinsky MG 0453.jpg
  • Erstellt: 2019-09-10 18:00:40

 

——————————-

Unten      —         Team Klara Geywitz und Olaf Scholz bei der SPD Regionalkonferenz zur Wahl des SPD-Vorsitzes am 10. September 2019 in Nieder-Olm.

  • CC BY-SA 3.0 de
  • File:2019-09-10 SPD Regionalkonferenz Team Geywitz Scholz by OlafKosinsky MG 2565.jpg
  • Erstellt: 2019-09-10 18:54:20

Abgelegt unter Berlin, P.SPD, Positionen, Regierung | Keine Kommentare »

DIE STEILE THESE

Erstellt von DL-Redaktion am 30. November 2019

In Deutschland kann man alles sagen,
was man möchte

Aminata Touré.jpg

Von Aminata Touré

as darf man heutzutage noch sagen? Ein Zeit-Artikel in der vergangenen Woche begann mit der Überschrift: „Wie war noch mal das korrekte Wort?“ Darunter stand: „Immer mehr Menschen sind unsicher, was sie noch sagen dürfen und was nicht. Kein Wunder, sagt Eva Marie Stegmann. Unsere Debattenkultur ist elitär und schließt viele aus.“ Das Ganze wurde mit einem Bild eines Schokokusses garniert, der angematscht war.

Ich, Schwarz, 27 Jahre Rassismuserfahrungen, erste afrodeutsche Vizepräsidentin des schleswig-holsteinischen Landtags, Abgeordnete für die ­Grünen und unter anderem zuständig für das Thema Antirassismus muss erst einmal tief durchatmen bei dieser Kombination aus Bild und Überschrift.

Debatten darüber, was man tatsächlich noch sagen darf und was nicht, verkennen, dass Rechts­extremismus, Rassismus, Antisemitismus und viele weitere menschenverachtende Ideologien, die oft ineinandergreifen, da sind. Sie sind ein sehr hör- und sichtbares Problem. Organisiert in Parteien wie der AfD, aber – unorganisiert – leider auch in der Mitte der Gesellschaft.

In Deutschland kann man alles sagen, was man möchte. Es gibt aber Kontra, wenn es rassistisch wird. Das ist Teil der Meinungsfreiheit. Dass der Widerspruch zu rassistischen Aussagen zunehmend hör- und sichtbarer wird, ist eine extrem gute Entwicklung. Das hängt damit zusammen, dass wir, die wir von Rassismus betroffen sind, lauter werden.

Aber fangen wir von vorn an. Es gibt diskriminierungsfreie Begriffe, die nicht alle Menschen kennen. Das ist der einzige Punkt, dem ich in dem Zeit-Artikel zustimmen kann. Es gibt akademische Begriffe. Sie müssen an Orten erklärt werden, an denen sie nicht tagtäglich benutzt werden. Ich erlebe es oft bei Veranstaltungen, dass eine gute Moderation unbekannte Begriffe erklärt. Online sieht es anders aus. Jemand benutzt Begriffe wie „PoC“ oder „BIPoC“ – Black/Indigenous/People of Color. Es bedeutet Schwarze, Indigene und Menschen, die nicht weiß sind.

Wie ich es herausgefunden habe, als ich die Begriffe noch nicht kannte? Ich habe den Browser geöffnet, Google angeschmissen, die Wörter eingegeben, und gleich das erste Suchergebnis hat mir erklärt, was es bedeutet.

Sprache ist kompliziert und sagt oft etwas über den Status einer Person innerhalb einer Gesellschaft aus. Das haben wir allerdings nicht nur bei Antirassismus, sondern überall.

Viele Menschen setzen voraus, dass ihr Umfeld sich genauso gut mit ihrem Expert*innenwissen auskennt, wie sie selbst. Wer kennt das nicht? So verhält es sich auch bei diskriminierungsfreier Sprache. Viele Menschen, die sich zu diesen Themen äußern, sind Expert*innen, auch in ihrer Sprache.

Es geht aber um viel mehr als um Sprache. Sie ist ein Teil der Forderung im Kampf gegen Rassismus. Wir wollen, dass Menschen nicht mehr auf Grund ihrer Herkunft, Religion oder Hautfarbe Nachteile in allen relevanten Lebensbereichen haben.

Aminata Toure.jpg

Dieses Jahr habe ich eine Antirassismuskonferenz veranstaltet, an der über 500 wissende und unwissende Personen teilgenommen haben. Die Workshops waren von Expert*innen, zum Schluss gab es eine Diskussion mit allen Teilnehmenden. Da wurden die unterschiedlichsten Fragen gestellt, und wir haben sie gemeinsam diskutiert.

Anderes Beispiel: Bei uns im Parlament ist Tag der offenen Tür und Tausende sind zu Besuch. Irgendwann entsteht eine Traube von Menschen um mich herum. Ein 70-jähriger Mann fragt, was am N-Wort problematisch sei. Ich erkläre ihm Kolonialismus, Rassismus gegenüber Schwarzen Menschen und dass daher auch dieser Begriff stammt. Dass es nicht nur um das lateinische Wort „schwarz“ geht. Dass der historische Kontext entscheidend ist. Er guckt mich an, nickt langsam und beginnt zu verstehen. Viele stellen Fragen, ich beantwortete sie.

Quelle         :          TAZ            >>>>>          weiterlesen

—————————————————————————

Grafikquellen          :

Oben       —       Aminata Touré

————————-

Unten       —        Interview de Aminata Touré

Abgelegt unter Flucht und Zuwanderung, P.Die Grünen, Regierung, Schleswig-Holstein | Keine Kommentare »

Der Linke PV v. 23./24.11.19

Erstellt von DL-Redaktion am 30. November 2019

Bericht von der Sitzung

Mitglieder des Parteivorstands der LINKEN halten ein Transparent mit dem Text: Für Frieden und Demokratie in der Türkei. Solidarität mit der HDP. DIE LINKE.

Quelle         :       AKL

Von Lucy Redler und Thies Gleiss
Mitglieder des Bundessprecher*innenrates der Antikapitalistischen Linken in der LINKEN im Parteivorstand.

DER NEUGEWÄHLTE FRAKTIONSVORSTAND WAR DA

Am 23. und 24. November kam der Parteivorstand der LINKEN zu seiner letzten Sitzung in 2019 zusammen. Die Sitzung war mit bis zu 36 (von noch 43 gewählten PV-Mitgliedern) Teilnehmenden einer der bestbesuchten. Als Gäste wurden am Samstag die neu gewählten Vorsitzenden der Fraktion der LINKEN im Bundestag, Amira Mohamed Ali und Dietmar Bartsch, begrüßt. Am Samstag waren zudem Martina Michels von der Fraktion GUE-NGL im Europaparlament und Heinz Bierbaum vom Vorstand der Europäischen Linken zu Besuch. Am Sonntag waren eine Delegation der Jugendorganisation Linksjugend-Solid und des Studierendenverbandes SDS sowie die Sprecherin für Gleichstellung in der Fraktion der LINKEN, Doris Achelwilm, als Gäste anwesend.

1. Aussprache mit den neu gewählten Fraktionsvorsitzenden

Es sollte ja eine Selbstverständlichkeit sein, dass die Vorsitzenden der Fraktion der LINKEN im Bundestag an den Sitzungen des Vorstandes der Partei beratend teilnehmen, deren Arbeit und deren Wahlkämpfen sie ihre privilegierte Stellung als Berufspolitiker*innen verdanken und deren Beschlüsse und Ideen sie in der Bundestagsarbeit umsetzen sollen. Leider ist das in der LINKEN nicht selbstverständlich und wir von der AKL fordern dies immer wieder – auch zu dieser Sitzung – ein.

Die Aussprache mit den Fraktionsvorsitzenden wurde durch die Parteivorsitzende Katja Kipping eingeleitet. Ihr Redebeitrag ist mittlerweile veröffentlicht (https://www.katja-kipping.de/de/article/1639.das-richtige-nicht-nur-sagen-sondern-auch-umsetzen.html).
Im Zentrum ihrer Ausführungen stand die Aufforderung, dass die LINKE sich zu einer „linken Mehrheit“ und dem Auftrag zum Regieren bekennen müsse. Das wäre kein einfaches „Rot-Rot-Grün“, sondern ein umfängliches Programm der Umsetzung linker Forderungen. Die LINKE müsse den GRÜNEN und der SPD deutlich machen, dass ein „Großteil der politischen Vorhaben“, die sie aktuell diskutieren und auf Parteitagen beschließen, nicht in einer Regierungsallianz mit der CDU/CSU, sondern nur mit der LINKEN umsetzbar wären.

Amira Mohamed Ali skizzierte als Input kurz ihre Zielsetzung als neue Fraktionsvorsitzende. Die Fraktion hat die Aufgabe, dass die LINKE in den gesellschaftlichen Auseinandersetzungen mehr vorkomme. Das wäre heute leider nicht der Fall, sondern die öffentliche Debatte finde fast ohne die LINKE statt. Um das zu ändern müsse sich die Fraktion besser aufstellen und ihre Inhalte, vor allem die erfolgreichen, überzeugender darstellen.
Der in seinem Amt als Fraktionsvorsitzender bestätigte Dietmar Bartsch unterstützte dies. Die Erfolge der LINKEN und ihrer Fraktion müssten besser vermarktet und verbreitet werden. Es fehle ein positives Selbstverständnis der Fraktion, stattdessen dominiere eine Kultur der gegenseitigen Auf- und Abrechnung.
Er griff die Aufforderungen von Katja Kipping, neue linke Mehrheiten zu organisieren, ausdrücklich auf und forderte eine neue „Mitte-Links-Regierung“ auch auf Bundesebene.

In der Aussprache wurde überwiegend deutlich, dass die These, mit SPD und GRÜNEN (oder auch nur mit aus ihnen rausgebrochenen nennenswerten Teilen) wären jetzt verbesserte Möglichkeiten einer Regierungsbildung aufgekommen, auch weil die „GroKo“ an ihrem Ende angelangt sei, arg steil und wirklichkeitsfremd ist. Gerade der Parteitag der GRÜNEN hat noch einmal das Hauptanliegen der GRÜNEN aufgeführt, neue Hoffnungen in den Kapitalismus und seine ökologische Modernisierung zu schüren, jenseits aller realen Erfahrungen. Auch die inhaltslose und trotz immensen Aufwandes nicht einmal die Hälfte der eigenen Mitglieder mobilisierende Inszenierung der SPD, um neue Parteivorsitzende zu finden, zeigt, dass es gerade keinen neuen linken Aufbruch in der SPD gibt.
Richtig ist es aber, dass die Fraktion der LINKEN kein gutes Bild abgegeben hat und abgibt. Sie ist ein Ensemble von Einzelteams der jeweiligen Abgeordneten, die sich einen von Egoismus und Konkurrenz geprägten Stellungskampf leisten.
Lucy Redler und Thies Gleiss verwiesen vor allem auf die deprimierende Kluft zwischen den realen Möglichkeiten einer oppositionellen, auch antikapitalistischen Bewegung und dem, was die Fraktion als Ganzes daraus macht. Die Bewegung für Klimagerechtigkeit, aber auch die Mieterkämpfe und andere Proteste, zeigen, wie unendlich viel wirksamer die außerparlamentarische Opposition ist. Eine Fraktion der LINKEN müsste ihre Kräfte auf die Verbreitung der Forderungen dieser Bewegungen – aktuell vor allem zum Mietendeckel und Mietsenkung – konzentrieren, anstatt diese sozialen Aufbrüche zu Gunsten irgendwelcher sowieso nicht kommender Regierungsallianzen zu kanalisieren und auf eigenes linkes Profil zu verzichten.

2. Aktuelle politische Situation

Die Vorbereitungen für die „Strategiekonferenz der LINKEN“ am 29.2./01.3. 2020 in Kassel laufen. Eine Reihe von Diskussionsbeiträgen ist bereits auf der Website veröffentlicht worden (https://strategiedebatte.die-linke.de/start/). Es sind bisher mehrere regionale Vorbereitungskonferenzen geplant: 19.1. in Ulm; 18.1. in Bremen; 18.1. in Mecklenburg-Vorpommern; 08.2. in Frankfurt.
Die Beiträge von Thies Gleiss und Lucy Redler zur Strategiedebatte sind hier https://www.antikapitalistische-linke.de/?p=3267 und https://www.antikapitalistische-linke.de/?p=3265 hier zu finden.

Der PV beschloss eine Solidaritätserklärung mit der Vereinigung der Verfolgten des Nazi-Regimes – Bund der Antifaschist*innen (VVN-BdA), denen die Finanzbehörden die Gemeinnützigkeit aberkannt haben. Politische Unterstützungs-Eintritte unserer Mitglieder in die VVN-BdA sind sinnvoll.
Einer der nächsten PV-Sitzungen wird sich umfassender mit der Gemeinnützigkeit und den als Steuermaßnahme verschleierten politischen Angriffen auf kritische Organisationen befassen.
Solidaritätserklärungen gab es auch für die Aktivist*innen, die in Italien seit Jahren gegen eine umweltzerstörende und überflüssige Bahnhochgeschwindigkeitstrasse (No-TAV) kämpfen und gerade zu drakonischen Geld- und Haftstrafen verurteilt wurden. Der geschäftsführende PV wird den genauen Wortlaut der Erklärung gemäß den Vorgaben aus dem PV formulieren und veröffentlichen.
Eine Solidaritäts- und Grußadresse wurden für die Sozialist*innen in Seattle/USA um Kshama Sawant) verabschiedet, die sich bei den Stadtratswahlen erfolgreich gegen eine gigantische und weltweit beachtete Kampagne von Amazon gegen die Sozialist*innen und ihre Forderung nach einer Amazon-Steuer zur Finanzierung lokaler Sozialpolitik durchgesetzt haben.
Am Sonntag wurde zudem eine Protesterklärung gegen den Putsch in Bolivien beschlossen.
Alle Beschlüsse sind demnächst auf den Online-Seiten der LINKEN nachzulesen.

3. Hamburg und Sachsen
Der PV hatte auf der letzten Sitzung beschlossen, im Rahmen der Debatte zur aktuellen Lage, jeweils ein oder zwei ausführlichere Berichte aus den Landesverbänden zu diskutieren.
Aus Sachsen wurde in diesem Rahmen über die Aufarbeitung der bitteren Wahlergebnisse berichtet. Auf dem Landesparteitag wurde ein neuer Landesvorstand – diesmal mit einer Doppelspitze – gewählt (https://www.dielinke-sachsen.de/2019/11/die-linke-sachsen-beendet-landesparteitag-und-will-digitalpolitische-leitlinien/)
Im Kontrast dazu wird sich in Hamburg auf die kommenden Bürgerschaftswahlen im Februar 2020 vorbereitet, zu der die aktuellen Umfragen für die LINKE ein erfreuliches, zweistelliges Ergebnis vorhersagen. (https://www.die-linke-hamburg.de/fileadmin/lv/lpt/06_04/Beschluesse/Beschluss_BuewaProgramm_191019.pdf)

4. Zukunft des Sozialstaats

Die Etablierung der „Hartz-Gesetze“ zur Reform der Arbeitsmarktpolitik, die von der letzten SPD-GRÜNEN-Bundesregierung beschlossen wurde, und von denen vor allem das vierte Gesetz (Hartz IV) Eingang in alle Wörterbücher gefunden hat, als Beispiel roher und verrohender Sozialpolitik, erlebt ihren fünfzehnten Jahrestag. Die LINKE wird das zum Anlass nehmen, zum Jahresanfang 2020 eine politische Initiative zur „Zukunft des Sozialstaats“ zu ergreifen. Dazu gab es im PV eine erste Debatte.
Katja Kipping eröffnete die Debatte mit einer Präsentation zu „Hartz IV – Armut per Gesetz“. Alle Kritikpunkte aus linker Sicht haben sich in diesen 15 Jahren bitter bestätigt: Die Armut nahm zu; das Lohngefüge wurde für alle nach unten gedrückt; die Dauererwerbslosigkeit wurde verfestigt; die Hartz-Gesetze und die Sanktionen haben ein furchtbares Regime der Entwürdigung und Abwertung der Menschen verursacht.

Thies Gleiss verwies in der Debatte darauf, dass „Hartz IV“ auch als eine Niederlage der Gewerkschaften bilanziert werden muss, zu der sie leider auch noch zugestimmt und die Einfallstore geöffnet haben. Politisch ist der Widerstand gegen Hartz IV aber auch einer der wesentlichen Gründungsimpulse für die LINKE gewesen, der immer wieder neu belebt werden muss. Der Begriff „Sozialstaat“ drückt deswegen nur unzureichend aus, um was es heute geht und ist historisch erfunden worden, um der Idee des Sozialismus etwas entgegen zu setzen. Er ist ein Ausdruck für ein spezifisches Kräfteverhältnis zwischen Kapital und Arbeiter*innenklasse, das beide Seiten permanent zu verändern suchen.
Andere betonten in der Diskussion, dass die LINKE klar machen muss, worin sie sich „von der Diakonie unterscheidet“.
Lucy Redler betonte, dass sich eine solche Initiative ins Verhältnis zu den heutigen gesellschaftlichen Bewegungen und Tarifrunden 2020 setzen müsste, damit sie nicht im luftleeren Raum verbleibt.

Wie genau die „Zukunft des Sozialstaats“ aus linker Perspektive aussehen muss, blieb noch unklar. Bis Weihnachten 2019 wird den Mitgliedern des PV von der Arbeitsgruppe „Zukunft des Sozialstaats“ und dem gfPV ein Konzept für die entsprechende Initiative in 2020 vorgelegt, an dem dann noch Änderungen möglich sind.

5. Fraktion im Europäischen Parlament und Situation der EL
Die Gäste Martina Michels und Heinz Bierbaum, dazu die PV-Mitglieder Martin Schirdewan, Claudia Haydt und Judith Benda berichteten zur Lage der linken Fraktion GUE-NGL im Europaparlament und zur Lage der EL.
Die Fraktion ist mit 41 Mitglieder geschrumpft gegenüber der Vorperiode und die kleinste Fraktion im Europaparlament. Die Aufgaben sind aber nicht geringer geworden. Die formale Konstituierung der Fraktion ist so gut wie abgeschlossen. In 2020 beginnt die Ratspräsidentschaft der BRD und damit wahrscheinlich auch eine erhöhte Aufmerksamkeit für das Wirken der Abgeordneten in dem sonst doch sehr vergessenen goldenen Käfig in Brüssel und Straßburg. Die Tatsache, dass drei gewählte Abgeordnete aus Katalonien nicht erkannt werden, bleibt ein Skandal und beweist, dass dieses Parlament offenkundig kein wirkliches Parlament mit den gängigen Rechten ist.

Die Situation in der Europäischen Linken ist kritisch zu bewerten. Die großen linken Organisationen Podemos in Spanien, Parti de Gauche in Frankreich, Partei der Arbeit in Belgien und Sozialistische Partei in den Niederlanden sind nicht oder nicht mehr dabei. Die 24 Mitgliedsparteien sind sehr unterschiedlich in Größe und politischer Ausrichtung und stehen sich teilweise sehr misstrauisch gegenüber. Die innere Struktur ist nicht handlungsfähig, zwischen dem Vorstand und dem „Rat der Vorsitzenden“ läuft kaum etwas zusammen. Die LINKE finanziert die EL jährlich mit 280.000 Euro (dazu kommen noch projektgebundene Einmalausgaben). Das ist sehr viel Geld für wenig Ergebnis. Es gibt keine gemeinsame politische Linie – insbesondere zur EU-Thematik, wobei nicht vergessen werden darf, dass die EL auch Mitgliedsgruppen außerhalb der EU hat.
Zusammengefasst: Es gibt auf diesem Feld noch sehr viel, fast alles zu tun.

6. Bericht von Ältestenrat und Bundesausschuss

Diese regelmäßigen Tagesordnungspunkte bringen auch regelmäßig die gleichen Diskussionen auf, weil insbesondere der Bundesausschuss immer noch keinen allseits respektierten Platz im Aufbau der LINKEN hat. Diesmal war der Streit etwas länger und lauter als sonst, weil der BA sich beschwerte – nach unserer Meinung: zurecht – nicht genügend in die Strategiekonferenz einbezogen und seine Vorschläge nicht genügend in der Gesamtmitgliedschaft kommuniziert werden.
Es gibt in der LINKEN – wir haben das von der AKL schon mehrfach detailliert kritisiert – die Tendenz, dass nicht nur die Fraktionen in den Parlamenten zu viel Einfluss bekommen, sondern auch der Parteiapparat und der geschäftsführende Vorstand zu viel Verselbstständigung gegenüber der Mitgliedschaft erhalten. Der Bundesausschuss ist das wichtigste Gremium, das neben den Delegierten zum Parteitag direkt in den Landesverbänden gewählt wird und viel näher an der Mitgliedschaft ist. Es wäre wichtig, dass dieses Gremium ernst genommen wird. Seine Beschlüsse sollten genau wie die von Parteitagen seriös veröffentlicht werden, auch auf Pressekonferenzen und im Rahmen unserer Kampagnen.

7. Bericht Linksjugend-Solid und SDS

Die beiden Jugendorganisationen berichten von erfreulichem Zuwachsen und vielen Projekten im Zusammenhang mit den neuen sozialen Bewegungen zum Thema Klima, Wohnen usw. Die Berichte dazu wurden schon auf der letzten Sitzung vorgestellt, diesmal wurden sie diskutiert.

8. Finanzplan

Der Schatzmeister Harald Wolf stellte die Grundzüge seiner Schätze vor. Die LINKE hat viel Geld – 14 Millionen Euro jährliche Einnahmen nur bei der Bundeskasse, davon 11 Millionen Staatsknete – aber dennoch wird es knapper, weil die schlechteren Wahlergebnisse weniger Zuflüsse zur Folge haben. Es war die „erste Lesung“ des Haushaltsplans 2020. Wir werden von der AKL auf die Finanzfrage ausführlicher eingehen, wenn die nächste Lesung ansteht.
Es wurde ein Richtungsbeschluss gefasst, die Zeitschrift „Disput“, die offiziell ein Mitgliedsorgan sein soll, aber nur 2800 Exemplare Auflage hat, in dieser Form nicht fortzuführen, sondern ein elektronisches und teilweise gedrucktes Zeitschriftenprojekt zu konzipieren, das breitere Verteilung erfährt und trotzdem finanziell günstiger ist.

9. Parité-Gesetz

Der Gesetzentwurf aus der Bundestagsfraktion der LINKEN zur Pflicht auf paritätische Zusammensetzung der Wahllisten und der Wahlkreisbewerberinnen aus Männern und Frauen wurde bereits auf der letzten PV-Sitzung vorgestellt. Es folgte jetzt eine weitere Diskussion. Dazu war Doris Achelwilm aus der Fraktion zu Gast und stellte das Projekt vor.
Das Problem ist die Aufstellung von Wahlkreis-Bewerber*innen als Doppelspitze (was entweder zu einer Verringerung der Anzahl Wahlkreise oder zu einer Verdoppelung der Direktmandate führt) oder die Abschaffung der Direktmandate zugunsten eines reinen Verhältniswahlrechts.
Die Diskussion war kontrovers, auch über die Frage, warum eine Zehnprozent-Fraktion sich überhaupt die viele Arbeit machen muss, dazu einen ausgefeilten Gesetzesentwurf vorzulegen. Aber über die Zielsetzung gab es keinen Dissens.
Es wurde beschlossen, dass sowohl eine Wahlkreis-Vergrößerung mit Doppelsitz als auch ein reines Verhältniswahlrecht von der LINKEN akzeptiert werden kann. Der Gesetzentwurf, der vorliegt, wurde nicht ausdrücklich abgestimmt.

10. Sonstige Beschlüsse und Berichte

– Die Debatte über die Berichte zur Feministischen Offensive und das Projekt „Feministisches Labor“ wurden verschoben.
– Die LINKE wird auch in 2020 wieder Kampagnenmaterial zum Frauentag herstellen und verbreiten sowie die Initiative zum Frauenstreik 2020 unterstützen.
– Die LINKE beteiligt sich wie jedes Jahr am Gedenken an Luxemburg und Liebknecht, diesmal am 12. Januar 2020
– Der Antrag, die Veranstaltungsreihe „Gedrucktes“ finanziell zu unterstützen, wurde abgelehnt. Es ist eine reine Berliner Angelegenheit, die auch von den Berliner Abgeordneten und dem Landesverband finanziert werden kann und sollte.
– Der Antrag zur „Privatisierung von Bürgerportalen“ wurde ein weiteres Mal verschoben, weil nicht so dringend.
– Es gab einen Zwischenstandsbericht zu den geplanten Aktivitäten anlässlich des 75. Jahrestages der Befreiung vom Faschismus (8. Mai 2020).
– Es gab einen Bericht zu den Vorbereitungen zum gemeinsamen Jahresauftakt von Partei und Fraktion am 10. Januar (der Beschluss dazu wurde bereits im Oktober gefasst).
– Zum „Fest der Linken“ am 20. Juni 2020 beschloss der PV ein Budget von 30.000 Euro. Der PV wird über das genaue Programm rechtzeitig informiert und befinden, damit nicht wieder so ein Unglück passieren kann, wie der Auftritt von Jens Spahn im letzten Jahr.
– Die LINKE unterstützt die Proteste gegen den AfD-Bundesparteitag in Braunschweig am 30. November 2020.
– Anträge zur Unterstützung von Protestaktivitäten gegen Nato-Manöver in der Lausitz und zur Prozessbeobachtung in der Türkei wurden vertagt.

akl - Antikapitalistische Linke

————————————————————–

Grafikquelle      :         Twitter – DIE: LINKE

Abgelegt unter Arbeitspolitik, Berlin, Deutschland, P. DIE LINKE | Keine Kommentare »

Maas macht mobil

Erstellt von DL-Redaktion am 30. November 2019

Beim Krieg der Sterne gern dabei

File:Baluschek Der Krieg Tafel 10 Bild.jpg

Da waren sich Religionen und Politiker immer schnell einig. Wir schicken die Dümmsten in dier Kriege !

Quelle           :          Scharf  —  Links

Von U. Gellermann

Im deutschen Sandkasten hauen sie sich die Schüppchen auf den Kopf: Ätsch, sagt die kleine Annegret, ich bastle aber jetzt einen „Nationalen Sicherheitsrat“, da könnt ihr alle mal gucken!

Bäh-Bäh, antwortet Heiko, der Kurze, ein wenig später, ich bau jetzt mal ne „Experten-Gruppe“ für die NATO, dann nimmt mir keiner mehr die Förmchen weg, und der Russe hat dann sowas von auf Sand gebaut!

Kramp-Karrenbauer und Maas, die beiden Schein-Blüten der GROKO, schwätzen über Krieg und Kriegsvorbereitung, als wäre es ein Spiel. Und der Chor deutscher Medien singt Sätze wie, die NATO sei die „Lebensversicherung“ Europas oder trällern das Lied von der deutschen Verantwortung, die man übernehmen müsse, gern auch im „Indo-Pazifischen Raum“.

Die von den beiden verantwortungslosen deutschen Politikern angeschleimte NATO ist schon auf dem nächsten Kriegsschauplatz: Die 29 Bündnisstaaten haben jüngst beschlossen, das Welt-All zu einem eigenständigen Operationsgebiet zu erklären.

Und wenn die Operation meinen, dann ist der letale Ausgang des chirurgischen Eingriffs schon eingeplant. Ein paar Flecken von Eingeweiden und spritzendem Hirn sind einkalkuliert. Denn die NATO war und ist der lange und schreckliche Arm der USA. Von Afghanistan über Libyen bis nach Syrien: Wenn die USA billige Mörder in ihrem Interesse brauchen, haben sie ja die NATO.

Nun gibt es Gottgläubige bis in die Reihen deutscher Alternativos hinein, die meinen der gute Donald Trump habe ja noch keinen eigenen Krieg zu verantworten, mit ihm begönne jetzt endlich eine glückliche und irgendwie friedliche Zeit.

Nicht einmal erinnern können sich diese alternden Naivos:

Das von den USA gewollte und geführte Bombardement Syriens im April 2018 zählen sie nicht. Noch weniger können sie augenscheinlich jene 963 Milliarden Dollar zählen, die von den NATO Staaten gemeinsam jährlich ausgegeben werden, um die Völker zu bedrohen und die Rüstungsindustrie zu schmieren: Das größte Mord-und Totschlag-Geschäft des Jahrhunderts, powered by USA.

Skurril ist auch die Begründung für König Donalds Nähe zur Rüstungsindustrie: Er sei vom „Tiefen Staat“ in seinen „friedenspolitischen Initiativen“ ausgebremst.

Der arme Donald, eigentlich will er gar nicht mit den mörderischen Saudis kooperieren und die Palästinenser den guten israelischen Kunden der Waffenindustrie ausliefern. Zwar haben die gläubigen Donaldisten nicht einen Beleg für jenen tiefen Staat, der die einzige Hürde für den echten Friedens-Trump sein soll. Aber Gläubige brauchen keine Beweise.

Ohne Beweise kommen auch Kramp-Karrenbauer und Maas aus, wenn sie die NATO loben und die deutschen Kriegseinsätze preisen. Doch für sie sind jene 963 Milliarden Dollar Rüstungsumsatz, die von der NATO generiert werden, ein zentraler Glaubenssatz. Denn von diesen Milliarden bleiben jede Menge Anteile bei der deutschen Kriegsindustrie hängen.

USNCYBERFOR.gif

Die Frühstücksgabel des Teufel

Auch beweisen die beiden Saarländer im Rang von Bundesministern eine schöne Nähe zu Donald Trump. Der hat schon im Dezember 2018 die Bildung des „United States Space Command“ angeordnet und dem neuen Krieg der Sterne eine gefährliche Basis gegeben. Das allein die Konstellation aus 960 Satelliten fast 300 Milliarden US-Dollar kosten wird, belegt eine Studie des „Institute for Defense Analyses“.

Dass der „Tiefe Staat“ von diesen Milliarden lebt, dass unterhalb staatlicher Oberfläche, ob in den USA oder in Deutschland, die Stollen der Profite die offizielle Demokratie längst untergraben haben und das eigentliche Wesen der Staaten sind, scheint den Gläubigen entgangen zu sein.

Der deutsche Sandkasten wird einen atomaren Krieg der Sterne nicht überleben. Vom Saarland wird ein ziemlich tiefes Loch bleiben. Von Deutschland etwas mehr. Den Gläubigen aller Art bleibt das Gebet.

https://www.rationalgalerie.de/home/maas-macht-mobil.html

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————–

Grafikquuellen         :

Oben         —          Hans Baluschek, Prof. Dr. Graf du Moulin-Eckart: „Der Krieg 1914-1916. Hugo Bermühler Verlag, Berlin-Lichterfelde 1915.

Author Hans Baluschek, Richard Graf Du Moulin Eckart
Permission
(Reusing this file)
Public Domain

————————-

Unten      —        U.S. Navy Cyber Forces

Abgelegt unter Deutschland, International, Kriegspolitik, Regierung, Wirtschaftpolitik | Keine Kommentare »

Dorf Mühlrose geht unter

Erstellt von DL-Redaktion am 28. November 2019

Mühlrose soll der Braunkohle weichen

File:Wochožanska jama 2.jpg

Aus Mühlrose und Schleife Sabine Seifert

Mühlrose, ganz im Osten der Republik gelegen, soll weg, der Braunkohle wegen. Else und Günter Zech wollen nicht fort. Bei den Noacks war der Umzugs­wagen schon da. Wie sich eine Dorfgemeinschaft schon vor dem Verschwinden auflöst.

as Dorf hat eine Straße, die hinein- und wieder hinausführt: in die selbe Richtung, aus der man gekommen ist. Wer in die andere Richtung fährt, landet nach wenigen Metern im Tagebaugebiet Nochten, wo die Lausitz Energie Bergbau AG (LEAG) möglichst lange Braunkohle zu fördern hofft. Auch die 150 Millionen Tonnen, die unter Mühlrose liegen sollen, will sie noch erschließen. Es könnte das letzte Dorf der Lausitz sein, das den Kohlebaggern weichen muss.

Seit sechs Jahrzehnten knabbert die Kohle an Mühlrose. Das Dorf ist ein Sonderfall. Denn noch steht nicht fest, ob die Kohle überhaupt gebraucht wird und ob abgebaggert werden darf. Dennoch wurde im Frühjahr diesen Jahres ein Umsiedlungsvertrag für die Einwohner unterzeichnet. Ein Großteil möchte umsiedeln. Aber längst nicht alle. Die Dorfgemeinschaft ist gespalten, der Dorffrieden dahin. Die einen kämpfen für ihren Wegzug, die anderen für ihren Verbleib. Die einen sind lauter, die anderen hartnäckig. „Die Seele des Ortes geht verloren“, sagt die Pfarrerin.

200 Einwohner zählt Mühlrose heute, im ostsächsischen Landkreis Görlitz gelegen. Ein hübsches Dorf, umgebaute Drei- oder Viertseithöfe, die typisch sind für das einst sorbische Siedlungsgebiet. Landwirtschaft wird hier schon lange nicht mehr betrieben. „Wo ich geboren bin, das ist schon weggebaggert“, sagt Else Zech. Die 80-Jährige lebt heute nur ein paar Dorfstraßen weiter. Es ist das Elternhaus ihres Mannes Günter, in dem das Paar mit seinem erwachsenen Enkel unter einem Dach lebt.

Günter Zech, der am Silvestertag 81 Jahre alt werden wird, ist in diesem Haus geboren. Er hat ein gelbes X darauf angebracht, ein öffentliches Bekenntnis, dass seine Bewohner bleiben wollen, wie zu hören ist. Nur zwei Häuser im Ort zeigen dieses X, obwohl es acht Höfe sein sollen, die nicht umsiedeln wollen. Zech schätzt die Zahl der Bleibewilligen, der Verunsicherten und Zögernden auf insgesamt 20. „Die Leute sind verängstigt“, sagt er. „Viele trauen sich nicht, die Goschen aufzumachen.“ Im Fall einer späteren Enteignung könnten sie ja schlechter wegkommen. Davor hat er keine Angst – „die wollen doch was von mir“. Kaum einer im Dorf, der nicht jemanden in der Familie hat, der bei der LEAG arbeitet oder gearbeitet hat.

Günter Zech war nie im Tagebau, er fuhr Lastwagen, schon zu DDR-Zeiten. Else Zech hat als Verkäuferin gearbeitet. „Wir haben alles ertragen“, sagt sie. „Dreißig Jahre Kohledreck. Damals konnte man keine Wäsche aufhängen.“ Denn damals führte die Kohleverladebahn noch direkt am Dorf vorbei. Schmutz und Lärm stellen heute kein Problem mehr da, sagen die beiden. Günter und Else Zech, er in blauer Arbeitshose, sie im türkisfarbenen Haushaltskittel, haben im Vorraum des Hauses Platz genommen. Ein Wintergarten ohne Grün, hinter ihnen der orange Heizkessel, auf dem Tisch lehnt eine gerahmte Luftaufnahme von Mühlrose.

Er: „Niemand hat uns gefragt: Und wer will bleiben? Man hat uns mundtot gemacht.“ Sie: „Wir sind nicht einmal zum Reden gekommen.“ Er: „Ich habe nichts dagegen, wenn die, die wegziehen wollen, wegziehen. Dann kommt endlich wieder Ruhe ins Dorf. Aber warum soll man das hier aufgeben?“ Sie: „Wir waren nicht einmal im Urlaub, wir haben alles ins Haus gesteckt. Jetzt sind wir über 80 und haben nie die Welt gesehen.“

Es gibt Fotos vom Mühlroser Gasthof „Zur Erholung“, der nur noch zu besonderen Gelegenheiten öffnet. Der 28. März 2019 war so ein Tag, der Vorstandsvorsitzende der LEAG war da, die Bürgermeister von Trebendorf und Schleife kamen, sogar Sachsens Ministerpräsident Michael Kretschmer von der CDU. Der Umsiedlungsvertrag für Mühlrose wurde unterzeichnet, der Energiekonzern kommt für die Neuansiedlung der Haushalte im Nachbarort Schleife auf, wo am Ortsrand ein Areal für etwa 40 Grundstücke der Neu-Mühlroser erschlossen wird. Auch Einzelumsiedlungen oder ein Umzug in Mietwohnungen werden finanziert, ebenso wie die Umsetzung von Kriegerdenkmal, Glockenturm und Friedhof.

„Wer wohin kommt, das ist alles schon geregelt“, erklärt Enrico Kliemann. Der 44-Jährige ist kommissarischer Ortsvorsteher von Mühlrose, das seit 1999 zur Gemeinde Trebendorf gehört, und er ist Mitglied im Beirat für die Umsiedlung. Kliemann hat einen Raum im Vereinshaus aufgeschlossen, an den Wänden Skizzen von Neu-Mühlrose. Die Bestandsaufnahmen seien fast abgeschlossen. „Wie man’s hat, kriegt man’s wieder.“ Aus Alt wird Neu. Aus einem historischen Dorf eine Neubausiedlung auf dem flachen Acker.

Wie erklärt sich Kliemann, dass von ihm geschätzte 90 Prozent aus Mühlrose wegwollen, wo noch nichts endgültig klar ist? Jahrelang sei nichts investiert worden, sagt Kliemann, nicht bei der Stromversorgung, nicht beim Abwasser, und auch das Internet stagniert bei 2G. Manche Häuser im Dorf hätten Risse wegen der Grundwasserabsenkung durch den Tagebau. „Und selbst wenn das Sonderfeld nicht mehr genehmigt wird, ist Mühlrose von drei Seiten umschlossen.“

Unsicherheit und Verzögerung hätten vielen zugesetzt, da Mühlrose vor ein paar Jahren schon einmal umgesiedelt werden sollte. Damals kam der bereits ausgehandelte Vertrag nicht zustande, weil der schwedische Energiekonzern Vattenfall aus dem Energiegeschäft in der Lausitz ausstieg. Die Mühlroser hatten lange Zeit, sich an den Gedanken eines Umzugs zu gewöhnen. Und mancher mag auch geglaubt haben, dass er materiell etwas hinzugewinnt. Oder sich um Altlasten nicht mehr kümmern muss. „Neue Chancen“, formuliert Kliemann neutral, „die sich woanders auftun.“

Dataja:Mühlrose Tagebau Nochten Kraftwerk Boxberg 2008-05-11.jpg

Waldemar Locke ist der Mann, der am 28. März seine Unterschrift unter den Umsiedlungsvertrag gesetzt hat. Schweren Herzens, das ist selbst am Telefon noch zu hören. Ein Treffen klappt nicht, der Bürgermeister von Trebendorf und Mühlrose, 57 Jahre alt, CDU-Mitglied und seit zwei Jahren im Amt, ist unter der Woche berufstätig. Bei der LEAG. „Es handelt sich um einen rein privatrechtlichen Vertrag“, erklärt er. „Wer umsiedeln will, kann umsiedeln. Wer bleiben will, kann bleiben.“ Fünf Parteien sollen den Vertrag bisher unterschrieben haben. Was passiert mit deren Häusern? Die, so hatte es Kliemann erklärt, sollen bald abgerissen werden. Das Dorf würde also in sich zusammenfallen. Ein Tod auf Raten.

Der Bürgermeister hat Verständnis dafür, dass die Älteren im Dorf nicht entwurzelt werden wollen. „Günter Zech spricht für sich“, sagt er anerkennend, „nicht für das ganze Dorf. Ich akzeptiere nicht, wenn man sagt: Alle wollen umsiedeln. Jeder soll für sich sprechen.“ Locke sagt, seine Unterschrift unter den Vertrag habe er gesetzt, damit die Umzugswilligen „ihre Ruhe haben“.

Qielle        :         TAZ         >>>>>         weiterlesen

————————————————————————

Grafikquellen           :

Unten         —          Blick auf den Tagebau Nochten vom Aussichtsturm bei Weißwasser.

Author Julian Nyča      /       Source       :  Own work
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
No Facebook.svg This file has been released under a license which is incompatible with Facebook’s licensing terms. It is not permitted to upload this file to Facebook.

——————————–

Unten     —        Mühlrose in Sachsen: Blick vom Schutzdamm über einen ausgekohlten Bereich des Tagebaus Nochten zum Kraftwerk Boxberg mit dem Neubaublock R (links), dem Werk 4 (900 MW), dem Werk 3 in der Mitte (2×500 MW) und dem still gelegten alten Kraftwerksteilen (rechts).

žórło Swójske dźěło
awtor René Mettke
Tuta dataja je pod licencu Creative Commons Attribution 3.0 Unported licencowana

Abgelegt unter Regierung, Sachsen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Rebellisch und sozialistisch

Erstellt von DL-Redaktion am 28. November 2019

Meine Vision der LINKEN 2020

Redler.jpg

Quelle      :    AKL

von Lucy Redler, Berlin

Lucy Redler ist aktiv im Kampf für mehr Personal im Krankenhaus und für die Enteignung von Deutsche Wohnen & Co, Mitglied des Parteivorstands, Bundessprecherin der AKL, aktiv im Bezirksverband DIE LINKE Neukölln und in der SAV.

Wer Visionen hat, sollte zum Arzt gehen, meinte Helmut Schmidt. Churchill wird das Zitat zugeschrieben, demzufolge jemand, der mit vierzig noch Sozialist*in sei, keinen Verstand habe. 2019 bin ich vierzig geworden, erfreue mich geistiger Gesundheit als Sozialistin und sehe darin einen guten Anlass, meine Vorstellungen im Rahmen der bundesweiten Strategiedebatte zu formulieren. Was kann DIE LINKE 2020 tun? Ein paar – unvollständige – Gedanken und Anregungen zur gemeinsamen Revolutionierung der Partei.

Januar

DIE LINKE startet mit einem gemeinsamen Neujahrsauftakt von Partei und Fraktion, bei dem Aktivist*innen von Aufständen aus Chile, Iran, Irak, Hongkong und Bolivien zu Wort kommen und mit ihnen eine internationale Strategie gegen Kapital und Repression diskutiert wird. Das eingesparte Geld für den Extra-Jahresauftakt der Fraktion wird den Bewegungen in diesen Ländern gespendet.
DIE LINKE beteiligt sich am Treffen der Initiative zur Vernetzung einer kämpferischen Gewerkschaftslinken am 25./26. Januar in Frankfurt/Main.

Februar

Die Landesverbände organisieren Ratschläge zum Mietendeckel und zur Enteignung von Vonovia und Co. DIE LINKE Hamburg und Bayern integrieren dies in bewegungsorientierte Wahlkämpfe. DIE LINKE Berlin startet eine große Aufklärungskampagne zum Mietendeckel und den Lügen der Immobilienkonzerne.
Beim politischen Aschermittwoch der LINKEN in Bayern steht die Maut-Korruption von Verkehrsminister Scheuer (CSU) im Zentrum. Die Redner*innen fordern Scheuers sofortigen Rücktritt und seine persönliche Haftung. Sie präsentieren die Eckpunkte einer grün-sozialistischen Verkehrspolitik und verbinden dies mit einer Kundgebung vor der CSU-Zentrale.
DIE LINKE bringt zur Strategiekonferenz 29.2./1.3. 400 Mitglieder der Basis zusammen und diskutiert über die politische, ökonomische und ökologische Krise, innerimperialistische Spannungen, neue Kriege, den Zulauf für die AfD, mögliche Angriffe im Rahmen einer nächsten Krise und die daraus abgeleiteten Aufgaben der LINKEN. Sie lädt Aktive aus Kliniken, Mieteninis, Klimabewegung,  antirassistischen Bündnissen, Frauen*kampftag und Gewerkschaften ein. Aus diesen Diskussionen leitet sie ab, welche Aufgaben der LINKEN, ihren Abgeordneten und dem Apparat zukommen. Sie bespricht, wie sie diese Kampagnen nutzt, um sozialistisches Bewusstsein in der Gesellschaft zu verankern. Konkretes Ergebnis der Konferenz ist, dass jeder Kreisverband die Kampagnen zu Wohnen und Pflege vor Ort umsetzt.
Ein weiteres zentrales Thema ist die Stärkung der innerparteiliche Demokratie und die Herstellung des Primats der Partei gegenüber der Fraktion.

März

DIE LINKE beteiligt sich an der Mobilisierung zum Frauen*streiktag. Sie erklärt, warum der Kampf für Frauen*rechte auch im Interesse von Männern aus der Arbeiter*innenklasse und warum der Antisexismus der LINKEN antikapitalistisch ist. DIE LINKE ist mit eigenen Lautsprecherwagen vor Ort und lässt Frauen aus Rojava, Betrieben, Gewerkschaften und sozialen Bewegungen zu Wort kommen.
Die Zeichen in der Autoindustrie und bei den Zulieferern stehen auf Stellenabbau und Werksschließung. DIE LINKE nimmt die Tarifrunde der Kolleg*innen in der Metall- und Elektroindustrie zum Anlass, um die Forderungen und Aktionen der Kolleg*innen zu unterstützen und offensiv die Konversion und Vergesellschaftung der Autoindustrie bei Erhalt aller Arbeitsplätze und geltenden Tarife zu fordern.

April

Bei der bundesweiten Kreisvorsitzenden- und Aktionskonferenz werden die Erfahrungen der Ratschläge zur Mietenpolitik in eine bundesweite Strategie gegossen. Unter Beteiligung von Beschäftigten in Krankenhaus und Altenheimen wird diskutiert, an welchem Punkt die ver.di-Entlastungskampagne steht, welche Erfahrungen mit den Deep Organizing- und Whole-Worker-Ansätzen gemacht wurden, welche politischen Vorschläge DIE LINKE unterbreitet und wie eine starke gewerkschaftliche Linke aufgebaut werden kann. Ein bundesweiter Pflegeratschlag wird für Oktober vorbereitet.
Die neuen Fraktionsvorsitzenden besuchen die politischen Gefangenen in Katalonien und der Türkei und beteiligen sich an mehrtägigen Kundgebungen vor den Gefängnissen und dem Flüchtlingslager Moria auf der griechischen Insel Lesbos.

Mai

DIE LINKE nutzt den Maifeiertag, um in einer Pressemitteilung anzukündigen, dass der Parteivorstand dem Parteitag vorschlägt, alle Abgeordnetengehälter auf ein Gehalt der mittleren Entgeltstufe im öffentlichen Dienst bzw. von Automobil-Facharbeiter*innen zu begrenzen. Dieser Vorschlag dominiert die politischen Debatten unter Kolleg*innen bei den DGB-Demos.
DIE LINKE beteiligt sich im Rahmen der Pflegekampagne mit Aktionen am Tag der Inklusion am 5. Mai und/oder dem Tag der Pflege am 12. Mai.
Die Bundestagsfraktion führt am 23. Mai, dem Tag des Grundgesetzes, eine Veranstaltung zu Artikel 15 durch und stellt die Vorschläge der LINKEN zur Enteignung von Vonovia und Co vor.

Juni

DIE LINKE mobilisiert an der Seite der Bündnisse für mehr Personal im Krankenhaus zu den Protesten gegen die Gesundheitsministerkonferenz und Spahns Politik in Berlin.
Der Bundesparteitag beschließt Eckpunkte für die Arbeit der Bundestagsfraktion: Alle Mandatsträger*innen erhalten neben der Erstattung ihrer sich aus dem Mandat ergebenden Extra-Ausgaben als Gehalt „nur noch“ einen durchschnittlichen Facharbeiter*innenlohn. Die darüber hinausgehenden Beträge werden an soziale Bewegungen, internationale Bündnispartner*innen und den Parteiaufbau gespendet.
Dazu folgt eine Plakatkampagne unter dem Motto: „DIE LINKE: Die einzige nicht käufliche Partei. Unsere Abgeordneten verdienen nicht mehr als ein durchschnittliches Arbeitnehmer*innen-Gehalt.” In Umfragen gewinnt DIE LINKE drei Prozentpunkte dazu.
Die neu gewählten Parteivorsitzenden kündigen an, 2021 nicht für den Bundestag zu kandidieren und schließen sich der Forderung von Trennung von Amt und Mandat für den neuen Parteivorstand an.
Der Parteitag diskutiert unter Ausschluss der Medien eine Bilanz der Arbeit der rot-rot-grünen Landesregierungen und beschließt Eckpunkte, zu denen die Arbeit zugespitzt fortgesetzt oder perspektivisch beendet werden soll. Dies wird durch Landesparteitage in den betreffenden Ländern konkretisiert. Die Eckpunkte sind u.a.: Die Weigerung, die Schuldenbremse umzusetzen, Ablehnung jeglicher Privatisierungen und Kürzungen, Rekommunalisierung privatisierter Betriebe der öffentlichen Daseinsvorsorge, Stopp aller Abschiebungen, Gesetze zur bedarfsgerechten landesweiten Personalbemessung im Krankenhaus, Gesetze zu Mietendeckel, Mietsenkung und Enteignung der Immobilienkonzerne, Einführung der 35-Stunden-Woche im Öffentlichen Dienst bei vollem Lohn und Personalausgleich, Einführung des Nulltarifs im ÖPNV, Auflösung der Landesämter für Verfassungsschutz.
Der Parteitag diskutiert über Programm und Strategie der Partei zum sozial-ökologischen Umbau der Wirtschaft, der Vergesellschaftung und Konversion der Autoindustrie und beschließt ein Tempolimit von 30/80/120, ein Konzept für den Nulltarif im Nahverkehr, eine Kampagne zur Enteignung der Klimakiller und entwirft eine Vision einer sozialistischen, ökologischen Demokratie. Der Parteitag erteilt dem Konzept einer CO2-Steuer eine Absage und richtet eine Arbeitsgruppe aus Kolleg*innen aus der Autoindustrie, linken Gewerkschafter*innen der IGM, Naturwissenschaftler*innen und Umweltverbänden ein, um über Alternativen zu Verbrennungsmotor und E-Auto zu diskutieren.
Die Beschlüsse bestimmen tagelang die öffentliche Debatte und Talkshows. Claus Wagner und Max Uthoff rufen öffentlich dazu auf, in DIE LINKE einzutreten

Juli

Im Juli startet die Tarifrunde TV-N (Nahverkehr). DIE LINKE unterstützt die Forderungen der Kolleg*innen und bringt die Forderung nach Nulltarif im ÖPNV prominent in die Debatte ein. Die Fraktionen bringen Anträge in ihren Landesparlamenten ein mit dem Ziel, Kommunen die Erhebung einer Nahverkehrsabgabe von Unternehmen zu ermöglichen. Die Partei beteiligt sich an lokalen Bündnissen für den Nulltarif und ruft die Mitglieder auf, sich an gemeinsamen Schwarzfahr-Aktionen zu beteiligen (massenhaft in Wellen, vernetzt über Social Media). Für den Fernverkehr schlägt DIE LINKE vor: Die BahnCard 100 soll es nicht nur für Bundestagsabgeordnete, sondern kostengünstig für alle geben. Statt den Kauf eines E-Autos durch Bund und Hersteller mit 4000 Euro zu subventionieren, wird dieses Geld für eine kostengünstige BahnCard 100 bereitgestellt.

August

Eine Senatorin der LINKEN geht für einen Monat ins Gefängnis, weil sie einen Abschiebeflug blockiert hat.

September

Zum Start der Tarifrunde Bund und Kommunen ist jeder Kreisverband aktiv beim Warnstreik dabei. Die BAG Betrieb und Gewerkschaft gibt eine Zeitung für Kolleg*innen von Kolleg*innen im Streik heraus. DIE LINKE NRW verbindet ihren Kommunalwahlkampf mit der Auseinandersetzung.

Zum 20. Jahrestag des ersten Mordes des NSU an Enver Simsek unterstützt DIE LINKE antirassistische Initiativen, Organisationen von Migrant*innen und Gewerkschaften dabei, einen öffentlichen und demokratischen Untersuchungsausschuss einzurichten, um die bis dato nicht erfolgte Aufklärung zu erzwingen. Als erste Zeugen werden der ehemalige hessische Innenminister Bouffier, alle Spitzenbeamten des hessischen Verfassungsschutzes und Andreas Temme vorgeladen. Die Verhandlungen werden live gestreamt.

Oktober

Fraktion und Partei führen einen bundesweiten Ratschlag mit dreihundert Kolleg*innen aus Krankenhäusern, Altenheimen und häuslicher Assistenzpflege zur Pflegekampagne durch. Die Ergebnisse des Ratschlags werden in allen Landes- und Kreisverbänden in Bezug auf ihre konkrete Umsetzung diskutiert.

November

Der Bundesausschuss beschließt Kriterien zur Aufstellung der Landeslisten zur Bundestagswahl. Neben der Frauenquote wird als Vorschlag an die Vertreter*innenversammlung 2021 eine Lohnabhängigen-Quote beschlossen, um in der  Fraktion die eigene Klasse stärker abzubilden.

Dezember

DIE LINKE verteilt Wiederaneignungs-Adventskalender: Hinter jedem Türchen wird ein konkretes Projekt der Wiederaneignung von Zeit, Würde, Rechten und Eigentum der Arbeiter*innen und ihrer Familien präsentiert.
Zusammen mit unabhängigen linken Medienschaffenden startet DIE LINKE einen Youtube-Nachrichten-Kanal, der zunächst wöchentlich und später täglich über soziale Kämpfe im In- und Ausland berichtet.

Feedback erwünscht: Ihr seid der Meinung, dass sei alles zu viel auf einmal? Es geht in meinem Vorschlag weniger darum, all dies genau so umzusetzen, sondern um eine Vision, was die Partei mit einer anderen Strategie erreichen könnte. Wie sähe die Arbeit einer Partei aus, für die der Kampf für eine sozialistische Gesellschaft ein in täglichen Kämpfen verankertes Ziel ist und nicht nur ein papiernes Bekenntnis?
Anregungen, Ideen und Kritik an: lucy.redler@die-linke.de

akl - Antikapitalistische Linke

———————————————————————–

Grafikquelle          :        Lucy Redler, * 17. awgusta 1979, Hann. Münden

CC BY-SA 2.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms

  • File:Redler.jpg
  • Created: ‎24‎ ‎March‎ ‎2007

Abgelegt unter Berlin, P. DIE LINKE, Sozialpolitik, Überregional | Keine Kommentare »

Stadtgespräch aus München

Erstellt von DL-Redaktion am 28. November 2019

Mir san Sommer –
Änderung des Ferienbeginns in Bayern

Fitxer:Starnberger See mit Steg und Alpenblick.jpg

Von Ambros Waibel

Früher in die Ferien? Markus Söder will die Ferienzeiten bewahren. Das ist identitätspolitisch clever, preußisches Rumgenöle wirkt da eher kontraproduktiv.

„Das bayerische Abitur bleibt bayerisch“, hat Bayerns Ministerpräsident Söder den Ausstieg Bayerns und Baden-Württembergs aus dem geplanten nationalen Bildungsrat kommentiert – „übrigens genauso, wie die Ferienzeiten bleiben, wir wollen auch die nicht angleichen.“

Das sind gleich zwei inhaltliche Nullaussagen. Denn dass ein bayerisches Abitur einen im Leben irgendwie weiter brächte als ein beliebiges anderes, ist genauso Unsinn – ich kann hier mitreden – wie das trotzige Bestehen auf dem späten Sommerferientermin in Zeiten des Klimawandels; der ja insbesondere den Juli auch in Nürnberg oder in München zu einem Monat macht, in dem sinnvoller Unterricht in den zumeist nicht klimatisierten Lehranstalten kaum mehr möglich ist.

Politisch, also identitätspolitisch hingegen sind beide Aussagen wirkmächtig. Ich brauchte mindestens zehn Jahre, um mich daran zu gewöhnen, dass die Sommerferien in nördlichen Gefilden nicht mehr oder weniger am 1. August beginnen und am 15. September enden. Es erschien mir grausam, ein Kind, wie in diesem Jahr in Berlin, am 5. August nicht in die Sonne, sondern in die Schule zu schicken.

Logisch lässt sich das nicht begründen. Dem Kind ist es auch wurscht. Pfingstferien, die als Argument für den späten süddeutschen Sommerferienbeginn inzwischen vorgeschoben werden, sind etwas sehr Schönes – insbesondere weil da oft noch Vorsaisonpreise gelten und keine Preußen am Gardasee rumhängen. Aber auch sie taugen letztlich nicht zur Rechtfertigung der bajuwarischen Reservat­rechte. Und wer im Sommer und damit eben auch im September schlicht kein Geld übrig hat, um in den Süden zu fahren, der kann in Bayern die letzten beiden Ferienwochen oft genug damit verbringen, in einen zähen Landregen zu schauen.

Das ganze folkloristische Repertoire

Nehmen wir mal eine andere Perspektive ein. In seinem leider nicht auf Deutsch vorliegenden Reisebuch „La leggenda dei monti naviganti“ (etwa „Die Legende der reisenden Berge“, 2007) erkundet der italienische Journalist Paolo Rumiz die Alpen und macht dabei auch einen Abstecher nach München.

Veitshöchheim Haus der Fastnacht 06.jpg

Seine Gesprächspartner klären ihn darüber auf, dass die CSU in Bayern für immer regieren werde, weil letztlich niemand ein anderes Bayern wolle, auch die CSU-Gegner nicht. Die Gleichsetzung von Staat, Partei und Heimat überlebt jeden CSU-Skandal und konnte bislang nur von der CSU selbst beziehungsweise von noch rechteren Gruppierungen – mit noch mehr „Mir san mir“ – herausgefordert werden: wie aktuell von den „Freien Wählern“.

Quelle             :         TAZ       >>>>>         weiterlesen

——————————————————————-

Grafikquellen        :

Oben          —            Starnberger See: Steg mit Ausflüglern und Alpenblick von Starnberg aus

Font Treball propi
Autor MAx59

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

———————————-

Unten         —         Veitshöchheim, Haus der Fränkischen Fastnacht, Fassadenmalerei (2015) mit Motiven aus der Fernsehsendung „Fastnacht in Franken“: Links im Gefängnis Markus Söder, der sich 2014 für die Fernsehsitzung als Shrek verkleidet hatte.

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 Deutschland“ lizenziert.

Abgelegt unter Bayern, Kommunalpolitik, P.CDU / CSU, Überregional | Keine Kommentare »

Debatte der LINKEN 2020

Erstellt von DL-Redaktion am 27. November 2019

ÖKO-SOZIALIMUS ALS PROGRAMM

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Wo bleibt das Personal hierfür ?

Quelle      :       AKL

Von Thies Gleiss.

POLITIK IN DER ERSTEN PERSON ALS STRATEGIE – MITGLIEDER-AKTIVEN-PARTEI ALS FORM.

Gegensätze können aufbauen und vorantreiben, aber auch verwirren. Es liegt ein wenig an uns selber, was letztlich herauskommt:

Dreizehn Jahre die Partei DIE LINKE, 63.000 Mitglieder und beharrlich knapp 10 Prozent bundesweite Unterstützung bei Wahlen ist doch eher etwas zu feiern. Die kapitalistische Gesellschaft in Deutschland ist uns trotz aller Bemühungen nicht losgeworden und auch trotz vieler Leute in den eigenen Reihen, die in dieser kapitalistischen Gesellschaft lieber an- als von ihr wegkommen wollen – und dennoch kommt das Gefühl auf, es geht nicht weiter, sondern eher zurück. Was läuft da schief im Selbstverständnis der LINKEN?

Die größten Demonstrationen der gesellschaftlichen Opposition seit dem zweiten Weltkrieg: Millionen folgen einem Aufruf von Kindern und Jugendlichen, an einem normalen Arbeitstag in der Woche, kurzerhand zu streiken, um die Herrschenden ein wenig in Panik geraten zu lassen, ob deren Unfähigkeit, die Klimakatastrophe zu verhindern. Und selbst wenn es manchmal nur ein paar Minuten, ein Gespräch in der Kantine waren, so bleiben es doch eine Mut machende Verweigerung, die selbst den notorisch konservativen Bürokraten in deutschen Gewerkschaften Feuer unterm Hintern bereitet.
Hunderttausende gehen für unteilbare Solidarität, Menschenrechte und humanen Umgang mit Geflüchteten auf die Straße und widersetzen sich dem gnadenlosen Funktionieren des deutschen und des EU-Staates.
Ja, auch wenn es Leute in den eigenen Reihen, und bei den Rechten sowieso, anders behaupten: Der Staat hat in der Geflüchtetenfrage nicht versagt, sondern fast immer eher zu gut funktioniert. Die EU-Maschinerie mordet am Mittelmeer und in der Sahara.
Zehntausende stellen sich Woche für Woche dem rechten Spuk von AfD und anderen faschistischen und halbfaschistischen Kräften entgegen.
Hunderttausende protestieren gegen Freihandelsverträge und den neoliberalen Anspruch, sich die ganze Welt untertan zu machen. Sie stellen die Legitimation der kapitalistischen Herrschaft in Frage – auch wenn es noch keine linken, sozialistischen Alternativen sind, die dem entgegengehalten werden. In zahlreichen Ländern auf allen Kontinenten erhebt sich gleichzeitig die Bevölkerung, weil die brutale Umsetzung des kapitalistischen Anspruchs, die Welt zu beherrschen, zu schlimmen Verschlechterungen des täglichen Lebens führt: In Frankreich die Proteste der Gelbwesten; im Iran, im Irak, in Chile, in Ecuador, in Kolumbien, im Sudan, im Libanon und vielen Ländern mehr.
Tausende gehen in allen großen Städten Deutschlands gegen die hohen Mieten und die Macht der Immobilienkonzerne auf die Straße. Sie stellen in einer Weise die Eigentumsfrage, einschließlich der Forderung nach Wiederaneignung der Häuser und Enteignung der Konzerne, wie es tausende von klugen Bücherschreiber*innen und hunderte von parlamentarischen Expert*innen mit ihren Eingaben nicht geschafft haben oder sich gar nicht erst trauen.
Hunderttausende sind heute bereit, für betriebliche und gewerkschaftliche Forderungen zu streiken. Die leider so gesichts- und geschichtslose Zahl der durch Streiks verlorenen Arbeitstage steigt auch in Deutschland wieder – dem Land, wo Streiks eigentlich nur noch in den Erzählungen der Groß- und Urgroßeltern vorkamen. Es tauchen dabei qualitative Forderungen auf – neue Formen der Arbeitszeitverkürzung, Mindestpersonalbesetzung, generelle Aufwertung von Berufen – die seit 1985 nicht mehr in so radikaler Weise die gewerkschaftlichen Kämpfe prägten. Die Idee eines Frauenstreiks, der in Spanien und der Schweiz wieder zu den herausragenden Ereignissen des Jahres zählte, findet auch in Deutschland neuen Zulauf.
Zehntausende gehen für mehr Bürgerrechte, gegen neue Polizeigesetze, gegen Überwachung und Datenmissbrauch auf die Straße. Sie demonstrieren für gesunde Nahrungsmittel und gegen Tierversuche.
Und selbst ein enger Blick auf die politisch radikalen und erklärtermaßen sozialistischen oder antikapitalistischen Mobilisierungen der Linken zeigt: Es kommen so viele wie lange nicht mehr.
Allein die klassische „Friedensbewegung“ hat sich nach den Jahren des Untergangs der bipolaren Weltordnung und dem daraus folgenden Verlust an strategischer Perspektive noch nicht wieder erholt. Leider. Denn die Bedrohungen durch Kriege – schmutzige und konventionelle, staatliche und bandenmäßige – durch diktatorische Regimes, die allesamt durch ökonomische und militärische Alimentierung der imperialistischen Großmächte am Leben gehalten werden, und durch neue Aufrüstungsorgien mit Massenvernichtungswaffen, von denen jede einzelne die Welt auslöschen kann, nehmen nach wenigen Jahren ganz leichter Entspannung wieder massiv zu.

Und trotz alledem versinkt die LINKE eher in Selbstmitleid. Sie scheint vor dem Vormarsch
der Rechten zu kapitulieren und sieht nur noch den „Rechtsruck“. Die nicht wenigen Kräfte in der LINKEN, die von einer friedlichen Gemeinschaft der Klassenzusammenarbeit träumen, die in sozialdemokratischer Weise „Versöhnen“ wollen, wo Unversöhnlichkeit auf der Tagesordnung steht, sind ratlos und verfallen fast in Esoterik, wenn sie immer wieder rufen „Rot-Rot-Grün!“, um ein schnödes Bündnis mit den in den Kapitalismus vernarrten GRÜNEN und der SPD zu fordern.
Tausende von parlamentarisch tätigen LINKEN oder solchen Mitgliedern zuarbeitende Genoss*innen rufen verzweifelt „LINKS wirkt“, ohne zu sehen, dass 13 Monate außerparlamentarische Bewegung „Fridays for Future“ und deren Begleitkommandos zigfach mehr wirken als 13 Jahre LINKE in den Parlamenten. Das Verhältnis zwischen außerparlamentarischer und parlamentarischer Arbeit der LINKEN ist in schwerer Schieflage, und deshalb sind es auch die Perspektiven und Erwartungen der LINKEN, wie es weiter gehen könnte.

Die Stellvertreter*innenpolitik beenden.

Um der gesellschaftlichen Situation ein wenig gerechter zu werden, ist die wichtigste Aufgabe einer linken Partei, diese oben umrissenen realen gesellschaftlichen Konflikte und Bewegungen politisch zusammenzuführen. Dazu ist es selbstverständlich erforderlich, dass die LINKE praktisch Teil dieser Kämpfe wird, dass sich jedes einzelne Mitglied daran beteiligt. Das ist längst nicht der Fall. Im Gegenteil sieht die Wirklichkeit heute so aus: Der Großteil der Mitglieder bleibt diesen realen Bewegungen und Kämpfen fern und sieht sie entsprechend nur im Fernsehen oder auf dem Handy. Viele der in der Parlamentsarbeit verstrickten Genoss*innen haben schon aus Zeitgründen, aber teilweise auch als Selbstverständnis, nur die Absicht, kurz aufzukreuzen, ein Bild mit sich und den Aktiven für die Homepage zu knipsen und dann zur nächsten Sitzung abzurauschen. Ein solches Verhalten wird zurecht „Elend der Stellvertreter*innenpolitik“ genannt. Das muss ein Ende haben. Wenn sich die LINKE nicht vorrangig als aktive Bewegungspartei versteht und weiterhin so viel Energie, Personal, Ressourcen und Zeit in parlamentarische Spielerei (oder sogar in die Erledigung der Regierungsgeschäfte des Kapitals) steckt, dann wird das alles nichts mehr.

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Aber die organische und dauerhafte Mitarbeit in realen außerparlamentarischen Bewegungen durch die Mitglieder ist nur die erste Hälfte.
Die andere besteht in der politischen Zusammenführung all dieser Bewegungen und Widerstände. Der Kapitalismus lebt davon, als engmaschig vernetztes System all seinen Gegner*innen Angst und Zurückhaltung dadurch einzujagen, dass er ihnen einbläut, alles hängt mit allem zusammen; wenn du nicht das ganze System änderst, dann bleibst du ohnmächtig. So richtig die Systemfrage ist, so falsch ist die Schlussfolgerung, dann machen wir eben nur die Politik der kleinen Schritte und Teilerfolge, alles andere blenden wir aus (oder, wenn wir Spitzenfunktionär*in sind: Reden nur noch in den Sonntagsreden davon). Die richtige Schlussfolgerung ist, in den täglichen Auseinandersetzungen die Systemfrage zu entdecken und zu stellen; dem System des Kapitalismus das eigene, alternative System entgegenzustellen. Für die LINKE ist diese Alternative tausendfach aufgeschrieben worden: Sie heißt Sozialismus, das heißt eine Gesellschaft ohne Privateigentum an Produktionsmitteln; ohne Lohn- und andere Zwangsarbeit und Ausbeutung des Menschen durch den Menschen; mit umfänglichen Freiheitsrechten, umfänglicher als jede kapitalistische Gesellschaft zuvor, ohne Diskriminierung und mit gleichen Rechten für alle; eine Gesellschaft ohne Krieg und industrielle Gewalt und Gewaltmittel.
Die großen Jahrhundertthemen „Soziale Gerechtigkeit“ und „Frieden und Gewaltlosigkeit“ hat der Sozialismus ziemlich überzeugend und wissenschaftlich mit seiner Strategie der Überwindung des Kapitalismus als weltweite Produktionsweise beantwortet. Schon lange.
Dennoch scheut sich die LINKE fast pathologisch, eine fröhlich-empathische, freche und selbstbewusste Partei für den Sozialismus zu werden. In dreizehn Jahren gab es gerademal ein Plakat mit dem Ruf nach Sozialismus – und das dieses Jahr ausgerechnet in Sachsen, wo die LINKE ein gutes Jahrzehnt lang alles gemacht hat, sich vor den großen Fragen und den sozialistischen Lösungsvorschlägen zu drücken, um bürgerliche Regierung in Wartestellung zu spielen. Da konnte so ein Plakat nur als missglückte Selbstironie verstanden werden.
Viele meinen, diese Zurückhaltung läge daran, dass der Sozialismus nach Stalin, DDR und alldem ein schlechtes, ein Loser-Image hat. Das ist richtig, das liegt aber nicht am Sozialismus, sondern eben an Stalin, DDR und alldem. Aber das lässt sich doch konkret erläutern und diskutieren – wenn mensch will. Und wichtiger noch: Das schlechte Image des Sozialismus bestimmt schon lange nicht mehr so sehr das Bewusstsein der Vielen, wie es das taktische Verhalten, das Zaudern und Verzweifeln der linken Funktionäre von heute noch prägt. Alles hausgemachtes Elend also: Die Stellvertreter*innenpolitik und die Angst vor dem Sozialismus.

Trotzdem reicht der Sozialismus heute nicht aus, um all die widerständigen Bewegungen gegen den Kapitalismus politisch zusammenzufassen. Es ist ein neues Jahrhundertthema dazugekommen, dessen zerstörerisches Potenzial ähnlich groß ist wie das von Krieg oder das von ökonomischer Ausbeutung und Ungleichheit: Die Zerstörung der Biosphäre – Klima, Boden, Luft, Wasser, Artenvielfalt – durch die normale kapitalistische Produktion. Der Zwang zum Wachstum der Profite, die Konkurrenz und die unaufhaltsame Tendenz des Kapitalismus, vorgefundene natürliche, historische, kulturelle Zusammenhänge zu parzellieren und sie unter dem Diktat des Privateigentums neu zu zentralisieren und zu konzentrieren, wobei alle nicht für den Profit verwertbaren Dinge externalisiert werden – all das ist der kapitalistischen Produktionsweise innewohnend und kann nicht wegverhandelt werden. Auch nicht mit einem grünen New Deal. Was früher nur vereinzelt thematisiert wurde, haben die letzten fünfzig Jahre weltweit offenbart: Der Kapitalismus tötet, vertreibt, erzeugt Ungleichheiten und schafft neue Kriegsgründe auch durch die Zerstörung der Biosphäre. Sieben und mehr Milliarden Menschen auf der Welt sind in jeder Produktionsweise die größte Bedrohung für einen Erhalt der Biosphäre. Unter kapitalistischen Bedingungen ist diese Bedrohung aber halt- und grenzenlos. Und immer gilt: Die von sozialer Ungleichheit und Ausbeutung Betroffenen sind auch die ersten und zahlreichsten Opfer vom Krieg und von der Zerstörung der Biosphäre.

Wenn Marx, Engels und ihre Zeitgenoss*innen mit bis heute gültiger wissenschaftlicher Genauigkeit analysiert haben, wie die soziale Ungleichheit und Ausbeutung im Kapitalismus funktionieren und als organisatorisch-politische Antwort die Bildung einer sozialistischen oder kommunistischen Internationale in Angriff genommen haben; wenn Lenin, Luxemburg und ihre Zeitgenoss*innen den furchtbaren Ersten Weltkrieg und Kriege allgemein als systemisches und bis heute gültiges Ergebnis des Kapitalismus analysierten und eine Neubegründung der kommunistischen Internationale als Friedensinternationale forderten und organisierten; so können wir heute die Klimakatastrophe und die Zerstörung der Biosphäre als systemisches Ergebnis des Kapitalismus analysieren und die Basis für eine weitere neue Begründung der sozialistischen oder kommunistischen Internationale liefern. Nach Sozialismus und Kommunismus bietet sich auch dafür ein neuer Begriff an, um die neue Qualität des zerstörerischen Potenzials des Kapitalismus und die Notwendigkeit einer weltweiten koordinierten Antwort der Arbeiter*innenklasse zu demonstrieren. Der Begriff Ökosozialismus ist dafür ein guter Vorschlag. Mit diesem Begriff müssen die politischen Debatten und strategischen Ausrichtungen in den sozialen Bewegungen vorangetrieben werden.

Bewegungspartei – bewegte Partei, aber richtig

Wenn die LINKE oder ihre Landes- und Kreisverbände eine Kampagne zur Mitgliederentwicklung machen, dann heißt die zentrale Parole stets: „Komm zu uns, wir brauchen dich“. Das ist die Ansprache einer auf Wahlkämpfe und Parlamentsarbeit fixierten Partei, die ihre Mitgliedschaft nur als Kulisse für Parlaments- und -Sonntagsreden benötigt, und als Verteiler*innen für bunte Hochglanzbroschüren, die in einer imaginierten Konkurrenzschlacht zu anderen papierproduzierenden Parlamentsparteien erzeugt werden. Diese Ansprache ist im besten Fall moralisch und immer nicht links.
Der umgekehrte Anspruch kommt einer linken Politik schon viel näher: „Komm zu uns, du brauchst die linke Partei“. Es ist die große Aufgabe linker Politik diese Realität jeden Tag zu begründen und zu belegen – in der Praxis. Jedem einzelnen der 63.000 Mitglieder muss die Partei als nützliches Instrument in seinem oder ihrem eigenen Umfeld und den daraus abgeleiteten Interessen und Erwartungen vermittelt werden.
Das ist „Politik in der ersten Person“. Die LINKE hat – wie es schon im Kommunistischen Manifest heißt – keine besonderen Interessen gegenüber den Vielen. Sie organisiert deren Interessen und bereitet Widerständigkeit und Kämpfe darum vor. Deshalb muss sich die LINKE nicht in „Mittwochskreisen“ (oder wie immer sie heißen) zur Unterstützung der parlamentarischen Arbeit und Fraktionen organisieren, sondern dort, wo die Menschen leben und arbeiten: Im Stadtteil, in Betrieben, Schulen und Universitäten. Die gesamte Politik einschließlich der parlamentarischen Initiativen und der bunten Flyer müssen eng an diesen lokalen Notwendigkeiten ausgerichtet werden. Deshalb liegt der Schwerpunkt der politischen Arbeit der LINKEN in der Kommune – nicht wegen der Bedeutung irgendwelcher Räte und Gremien der parlamentarischen Scheindemokratie auf kommunaler Ebene.

Der bürgerliche Parlamentarismus ist nicht das letzte Wort einer demokratischen Beteiligung der Vielen. Er ist sogar in vielfacher Hinsicht eine Scheindemokratie und bewusste Desorientierung der Menschen bei der Vertretung ihrer Belange. Die das tägliche Leben der Menschen bestimmenden Dinge und die kollektive Wahrnehmung ihrer Interessen kommen im Parlament nicht oder nur sehr verzerrt zum Ausdruck. Direkte Demokratie und demokratische Selbstverwaltung, dort wo die Menschen leben und arbeiten, ist eine bessere Variante. Die in der Geschichte als sozialistische Rätedemokratie bekannte Form der Selbstverwaltung sollte auch für die LINKE Richtschnur sein.

Dennoch ist es notwendig und sinnvoll, sich an den Parlamentswahlen zu beteiligen. Linke Strömungen, die das verneinten, haben große Chancen verpasst und waren zurecht nicht dauerhaft erfolgreich. Aber Vorrang müssen die Mitgliederstrukturen und deren Weiterentwicklung haben. Dort – vor allem auf kommunaler Ebene – wo die LINKE keine oder zu wenig Mitglieder hat, sollte auch nicht zu Parlamenten oder Stadträten kandidiert werden. Denn es gilt fast ausnahmslos: Mit Wahlkämpfen und parlamentarischen Erfolgen wird keine linke, antikapitalistische Kraft aufgebaut. Es können im besten Fall, die zuvor erreichten Erfolge durch Wahlkämpfe und Parlamentsarbeit gefestigt werden.

Deshalb muss die LINKE ihre wachsende und unkontrollierte Verstrickung in die Parlamentsarbeit begrenzen. Wer zehn oder mehr Jahre hauptberuflich im Parlament arbeitet, der oder die wird ein anderer Mensch als zuvor. Die politische Wahrnehmung ist eine komplett andere, die Eigeninteressen zum Erhalt dieser privilegierten Stellung nehmen immer mehr zu. Alle materiellen Privilegien von Abgeordneten müssen transparent sein und strikt auf das Niveau begrenzt werden, was auch die normalen Mitglieder haben.
Die LINKE sollte alle parlamentarischen Ämter zeitlich auf maximal zwei Legislaturperioden begrenzen, politisch gesünder wären sogar vier oder fünf Jahre von nur einer Legislaturperiode, was Regelfall sein sollte.
In der LINKEN dominieren die Mandatsträger und die Mitarbeiter*innen in den Apparaten von Fraktionen und Partei heute immer mehr die Kreisvorstände, Landesvorstände, die bundesweiten Leitungsgremien und die Delegierten zu Parteitagen. Damit muss Schluss sein. Die sich jeden Tag ehrenamtlich und in den Parteistrukturen einbringenden Mitglieder müssen die entscheidenden Kräfte in der Partei sein. Um ihre Interessen und nur um ihre muss es gehen. Eine harte Trennung von Amt und Mandat sollte für die LINKE eine Selbstverständlichkeit werden.
Ein großes Problem – gerade auf lokaler und Landesebene – ist in der LINKEN auch ein weiteres Grundübel, was zu Anpassung, Erstarrung und Bürokratisierung schon vieler linker Parteien geführt hat: Die Ämterhäufung. Auch die muss strikt begrenzt und politisch in der Erziehung der Mitglieder geächtet werden.

Die LINKE hat durchaus eine gute Zukunft auch im zweiten Jahrzehnt des 21. Jahrhunderts. Aber es muss dafür einiges getan und einiges korrigiert werden. Wann? Jetzt!

akl - Antikapitalistische Linke

—————————————————————

Grafikquelle           :

Obern          —           Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom

Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg
  • Created: 2014-05-10 13:18:56

————————-

 

Unten          —      Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg
  • Created: 2014-05-21 17:36:39

Abgelegt unter Berlin, Bundestag, Opposition, P. DIE LINKE | Keine Kommentare »

Die letzten Mieter

Erstellt von DL-Redaktion am 27. November 2019

Verkaufen, sanieren, Miete erhöhen:

Protest banner at the Karl-Marx-Allee during Mietenwahnsinn demonstration 06-04-2019 10.jpg

Eine Reportage von , München

In der Münchner Isarvorstadt wehren sich Bewohner eines Hauses gegen Gentrifizierung. Eine Künstlerin gibt auf, ein Läufer bleibt.

Der Weg zu Hausnummer 80 riecht nach toten Ratten. Nach Verwesung, nach den Abfällen des Schlachthofs, der die Straße runter liegt und seit Sommer Probleme mit der Abwasseranlage hat. Vielleicht passt dieser Geruch ganz gut zu dem vierstöckigen Altbau mit der Nummer 80 an der Thalkirchner Straße in München, der seit mehr als zwei Jahren stirbt.

Maria Ploskow läuft durch die Einfahrt vorbei am Vorderhaus, einem rostroten Altbau mit Fassadenstuck, und auf das unauffälligere Hinterhaus zu. 30 Jahre lang war das hier ihr Zuhause. Der Weg in den dritten Stock, wo ihre Wohnung und zwei Türen weiter ihr Atelier waren, ist gepflastert mit den Zeichen der Entmietung, wie es die Bewohner nennen. Auf den alten massiven Holzstufen liegen Pressspanplatten, an der Wand lehnen große Rollen Abdeckvlies.

Und es gibt Zeichen des Widerstands. Vom Geländer baumelt ein knallgelbes Banner mit der Aufschrift „ausspekuliert“, am schwarzen Brett hängen Zeitungsartikel und Flyer von Mieterdemos, eine Trophäensammlung der Gentrifizierungsgegner, die hier noch leben. Mit Blick auf die verschlossene grüne Tür ihrer alten Wohnung sagt Ploskow: „Das hat auf die Psyche gedrückt, hier zu leben.“

Die Wohnung war ihre erste. 30 Jahre lebte sie hier allein auf 40 Quadratmetern. Kinder hat sie keine, ihr Freund wohnt in der Nähe. Sie brauche ihre Freiheit, sagt Ploskow. Ihre Miene ist entschlossen, ihre Stimme fest. Umgekrempelte Jeans, Sneaker, goldene Kreolen.

Die Nummer 80 wurde verkauft. Fast drei Jahre ist das her. Die neuen Besitzer gaben bekannt, dass saniert und die Mieten erhöht werden würden. Und sie kündigten Ploskow den Pachtvertrag für ihr Atelier, genauso wie den Mietern der anderen vier Ateliers im Haus. Pächtern von Gewerbeflächen kann man leichter und ohne besonderen Grund kündigen als Mietern von Wohnungen. Die Kündigungen waren das erste Zeichen der Veränderung im Haus – und der Kampf dagegen begann.

Nirgends ist Mieten so teuer wie in München

In den vergangenen Jahren sind die Mieter der Thalkirchner Straße 80 zu den lautesten Gegnern der steigenden Mietpreise in München geworden. Im September 2018 ging von diesem Haus die größte Mieterdemonstration aus, die es in München je gegeben hat. 10.000 Menschen gingen auf die Straße. Nirgends in Deutschland ist Mieten so teuer wie in München, in manchen Vierteln zahlt man inzwischen 25 Euro kalt pro Quadratmeter – im Durchschnitt. Lange hatte die Bevölkerung die steigenden Preise geduldet, aber mittlerweile ist der Unmut groß in der Stadt.

Auch Ploskow ging anfangs in den Widerstand. Gemeinsam mit den anderen Bewohnerinnen und Bewohnern organisierte sie den Protest gegen die Luxussanierung in ihrem eigenen Haus. Sie wehrte sich. Sie demonstrierte. Aber dann kapitulierte sie doch.

Nach der Kündigung gab sie zunächst das Atelier auf, vergangenes Jahr auch die Mietwohnung. „Ich liebe das Haus und mein Viertel“, sagt sie, aber die Unsicherheit sei ihr zu groß geworden. Was, wenn die Eigentümer das Haus fertig sanieren und die Mieten, wie angekündigt, wirklich mehr als verdoppeln würden? Als freiberufliche Künstlerin und Grafikdesignerin ist schon ihr Einkommen Monat für Monat unsicher genug. Dazu noch eine unvorhersehbare Miete, das kann sie sich nicht leisten.

Goetheplatz Muenchen 01.jpg

Der Bezirk Isarvorstadt, in dem die Thalkirchner Straße liegt, hat in den vergangenen Jahren einen Mietenanstieg von über 30 Prozent erlebt. 2012 musste man dort pro Quadratmeter noch weniger als 15 Euro zahlen, 2018 lagen die Mieten im Schnitt schon bei 20 Euro netto. Dabei ist die Gegend alles andere als edel und prachtvoll. Einen Schlachthof gibt es hier und einen Friedhof, eine Krebsklinik, die Arbeitsagentur in einem ziegelroten Zweckbau und das Kafe Marat, das selbstverwaltete Zentrum der linken Szene in München. Am Beginn der Straße aber, ganz im Norden, nah am Stadtzentrum, lässt sich erkennen, warum Wohnen hier so teuer geworden ist: Hier reihen sich Burgerläden an Tapasbars an Phở-Imbisse, hier grenzt die Thalkirchner Straße an das hippe Glockenbachviertel.

Quelle        :         Zeit-online         >>>>>        weiterlesen

——————————————————————–

Grafikquellen      :

Oben       —             Protestbanner an Häusern in der Karl-Marx-Allee während der Mietenwahnsinn Demonstration am 6. April 2019 in Berlin.

————————

Unten    —      Goetheplatz München

Abgelegt unter Bayern, Opposition, Sozialpolitik, Überregional | Keine Kommentare »

Landtagswahl in Thüringen

Erstellt von DL-Redaktion am 27. November 2019

Fast eitel Sonnenschein

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Aus Erfut Michael Bartsch

So könnte eine Minderheitsregierung klappen: In der ersten Sitzung nimmt der Thüringer Landtag seine Arbeit auf – und hält gegen rechts zusammen.

Warum sollen in Thüringen nicht Regierungsmodelle jenseits klassischer Koalitionsmehrheiten möglich sein? Die konstituierende Sitzung des Landtags vier Wochen nach der Wahl jedenfalls war nicht von Konfrontationen geprägt. Die Linke Birgit Keller wurde im ersten Wahlgang zur neuen Landtagspräsidentin gewählt.

Sie erhielt zehn Stimmen mehr, als von der bisherigen rot-rot-grünen Koalition zu erwarten waren, mit hoher Wahrscheinlichkeit aus der CDU. Gegen die Änderung der Geschäftsordnung, die künftig jeder der sechs Fraktionen einen Vizepräsidenten zubilligt, stimmte nur die AfD.

Seit jeher geht es im Thüringer Landtag freundlicher und verbindlicher zu als beispielsweise in Sachsen. Angesichts der uneindeutigen Mehrheitsverhältnisse mag die Überlegung mitschwingen, dass man womöglich aufeinander angewiesen sein könnte. Alterspräsident Karlheinz Frosch von der AfD eröffnete mit dem hehren Appell, bei Meinungsverschiedenheiten „fair, sachlich und vorwurfsfrei“ miteinander umzugehen. Auch AfD-Landeschef Björn Höcke, der im Moment ohnehin Kreide gefressen hat, redete länger auf Birgit Keller ein.

Die ging über die üblichen Antrittsformeln einer Präsidentin des gesamten Landtages hinaus, als sie an den Herbst 1989 und ihre eigene Rolle als hauptamtliche Funktionärin der FDJ und der SED in der DDR erinnerte. Fast auf den Tag genau vor 30 Jahren war der Aufruf „Für unser Land“ veröffentlicht worden, der auf einen demokratischen Sozialismus zielte. Sie habe sich 1990 dennoch nicht für einen Rückzug ins Private, sondern für das Engagement entschieden, sagte die bisherige Infrastrukturministerin. „Und ich habe mich nie der Verantwortung entzogen, SED-Unrecht klar zu benennen.“

Streit um die Vizepräsident*innen

Den einzigen Dissens trug die AfD als zweitstärkste Fraktion in die Eröffnungssitzung. Der parlamentarische Geschäftsführer Stefan Möller lehnte die Erweiterung des Landtagspräsidiums auf fünf Vizepräsidenten ab. Darauf hatten sich alle anderen Fraktionen verständigt. Das Argument der Chancengleichheit für alle Fraktionen sei nur vorgeschoben, wenn zugleich die Weigerung angekündigt werde, einen AfD-Vizepräsidenten zu wählen.

Quelle           :            TAZ             >>>>>              weiterlesen

Neue Landtagspräsidentin in Thüringen

Gesellschaftliche Brückenbauerin

Birgit Keller by Stepro 01.JPG

Ein Portrait von Michael Bartsch

In Erfurt wurde am Dienstag zum bundesweit ersten Mal eine Linken-Politikerin zur Landtagspräsidentin gewählt. Wer ist Birgit Keller?

In Thüringen übernimmt die Linke einen weiteren Erbhof der CDU. Auf der konstituierenden Sitzung des am 27. Oktober neu gewählten Landtages hat die bisherige Infrastruktur- und Landwirtschaftsministerin Birgit Keller das Amt der Landtagspräsidentin von Birgit Diezel (CDU) übernommen. Das Vorschlagsrecht steht nach der bisherigen Geschäftsordnung des Thüringer Landtags der stärksten Fraktion zu, und das ist seit der Wahl mit deutlichem Vorsprung die Linke. Keller wurde nun am Dienstag mit 52 Ja-Stimmen gewählt. Das sind sechs mehr als nötig gewesen wären.

Die 60-Jährige ist die erste von der Linken gestellte Landtagspräsidentin in Deutschland. Das passt Politikern wie dem Thüringer FDP-Chef Thomas Kemmerich nicht, der an alten Feindbildern festhält und die Entwicklung der gewendeten PDS seit 1989 ignoriert. Er hatte angekündigt, seine kleine FDP-Fraktion werde sich bei der Wahl der Stimme enthalten.

Denn die gelernte Elektromonteurin Birgit Keller trat bereits 1977 als 18-Jährige der SED bei und stieg über die Jugendorganisation FDJ bis zur Mitarbeiterin der SED-Kreisleitung in Nordhausen auf. Zu allem Überfluss erwarb sie über ein Fernstudium 1988 noch ein Diplom als Gesellschaftswissenschaftlerin.

Quelle         :         TAZ         >>>>>           weiterlesen

———————————————————–

Grafikquellen        :

Oben       —          Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —       Birgit Keller

Abgelegt unter L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Das Ende linker Militanz

Erstellt von DL-Redaktion am 26. November 2019

Rebellion als Pose

Bildergebnis für Wikimedia Commons Bilder Bundeswehr in Schulen Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

Sind diese Schwachköpfe die besseren ?

Brächte ein Jeder das ein was er kann, als zivilen Ungehorsam gegenüber den regierenden politischen Weichkäse in Berlin, sähe dieses einst blühende Land, heute vielleicht besser ais ?

Von Peter Grottian

Ziviler Ungehorsam ist zur Lachnummer geworden. Einst wollten Aktivisten die Obrigkeit in die Knie zwingen, heute wollen sie es in die Tagesschau schaffen.

Vielen dreht sich der Magen um, wenn die radikaleren und die ganz radikalen Klimaschützer zu Aktionen des zivilen Ungehorsams aufrufen. Mahatma Gandhi, Martin Luther King, Joan Baez, Heinrich Böll, Walter Mossmann, die Frauen gegen das Atomkraftwerk Whyl und die Instandbesetzerbewegung würden müde lächeln, wenn sie sehen könnten, wie der zivile Ungehorsam auf den Hund gekommen ist. Während der Friedensbewegung der achtziger und neunziger Jahre war er noch intakt. Es galt, gewaltfrei die Gesellschaft zu verändern. Die Repression gegen die Anti-AKW-Bewegung in Brokdorf war zwar von staatlicher Seite martialisch angelegt, führte aber nicht zu gesellschaftspolitischen Zerreißproben.

Seit den nuller Jahren ist ein Schwinden des zivilen Ungehorsams als Notschrei für die Demokratie zu beobachten. Es mehren sich seither Großdemonstrationen ohne Biss, auch Latschdemos genannt, die am langen Arm der Regierungen fast lautlos verhungern. Der Bildungsstreik im Jahr 2007  mit seinen Rektorats- und Bankbesetzungen gehörte dazu.

Schon die »Blockupy«-Proteste waren sich des zivilen Ungehorsams unsicher und so nahmen ein paar Radika­le das Heft in die Hand. »Occupy« in Deutschland konnte überhaupt kein Verhältnis zum zivilen Ungehorsam aufbauen. Dabei ist zumindest die Reihenfolge für den ungehorsamen Protest simpel: Zuerst alle Versuche der Änderung unternehmen. Dann den kalkulierten Rechtsbruch, gewaltlos, aber einschneidend mit vielen Tausend Menschen wie in Gorleben. Und dann mutige Blockaden von Bauern und eine kluge, beharrliche Bewegung, die schließlich mit Fukushima zum Atomausstieg führten.

Inzwischen wird über zivilen Ungehorsam eher geplappert, anstatt sich ernsthaft damit auseinanderzusetzen. Bei Attac ist er nur noch eine Luftnummer und Campact will davon nichts mehr wissen. Greenpeace langweilt mit faden Aktionen; sich von Alexander Dobrindts (CSU) Haus abzuseilen, wirkt lächerlich. Die Studierenden fallen als Aktivgruppe völlig aus.

Bei den Protesten gegen »Stuttgart 21« wollten 4 000 Menschen Widerstand leisten, ganz radikal. Doch bei der ersten Polizeiaufforderung waren es nur noch 150. »Stuttgart 21« ging auch deshalb verloren, weil Heiner Geißler (CDU) als Vermittler beschwichtigte und die tapfere Bewegung plötzlich eingeschüchtert war.

Noch schlimmer sind nur die Klimaaktivisten. Die schiere Ahnungslosigkeit und der Dilettantismus quellen überall hervor. Die Hamburger Studentin Luisa Neubauer ist eine der Haupt­organisatorinnen der Bewegung »Fridays for Future« in Deutschland. Sie will einen Flughafen besetzen und hat nicht einen Schimmer davon, dass die Vorbereitungen dafür rund acht Monate benötigen. Die groß angekündigten Platzbesetzungen der Organisation »Extinction Rebellion« (XR) in Berlin waren fast alle mit der Polizei abgesprochen. Ihr Protestcamp war eine Wohlfühlwiese mit Oktoberfeststimmung.

Quelle          :      Jungle World        >>>>>          weiterlesen

————————————————————–

Grafikquelle        :

Oben           —         Autor   Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

——————–

Unten           —       Neubauer (links) mit Greta Thunberg im März 2019 bei einer Demonstration von Fridays for Future in Hamburg.

 

Abgelegt unter Deutschland, Kriegspolitik, Medien, Regierung | Keine Kommentare »

DER ROTE FADEN

Erstellt von DL-Redaktion am 26. November 2019

Von Kreuzberg über Mölln zur Nordsee

Roter Faden Hannover rote Zusatzmarkierung.jpg

Durch die Woche mit Ebru Taşdemir

Wenn ich mal rauskomme aus meinem Kreuzberger Dorf und unterwegs bin in Deutschland, denke ich oft den Satz „Ach nee, sieh an, auch das ist Deutschland“. Vor allem geschieht das, wenn ich in Gegenden bin, wo ich a) ziemlich voreingenommen hinfahre (Sachsen, Brandenburg, you name it) und überrascht bin, doch wenigstens eine coole oder zumindest freundliche Person dort zu treffen, oder b) wenn ich in Gegenden fahre, die in solch einem krassen Gegensatz zu dem stehen, was ich aus meinem Berliner Alltag kenne.

In der vergangenen Woche war ich zum ersten Mal an der Nordsee. Auf einer der größten Nordseeinseln, auf Norderney, um genau zu sein – rein beruflich. Gibt Schlimmeres, würden die Norddeutschen einen Arbeitstermin auf Norderney kommentieren, während man sich bei uns in Berlin schon mega rufend und jubelnd in die nächste Düne werfen würde. Nicht wundern also, in dieser Woche gibt es fast nur Nachrichten von der Insel.

An meinem Anreisetag bekomme ich noch über Twitter mit, dass Idil Baydar die Möllner Rede im Exil doch in Frankfurt gehalten hat, trotz konkreter Morddrohungen. Das Stresspotenzial, dass im Vorfeld durch solch eine Morddrohung aufgebaut wurde, hat die Kabarettistin durch eine enorme Entschlossenheit, diese Rede zu halten, abgebaut. Die Möllner Rede im Exil wird seit dem rechtsradikalen Brandanschlag in Mölln 1992 von Freunden und der Familie Arslan organisiert. Ayşe, Yeliz und Großmutter Bahide Arslan starben in den Flammen, viele der Familienmitglieder überlebten schwer verletzt, so wie Ibrahim Arslan. Anlässlich des Gedenkens erinnerte die Stadt Mölln jedes Jahr an den Mord, doch ab Jahr vier nach Mölln fand man es besser, nicht mehr die Familie entscheiden zu lassen, wer diese Rede hält. Die Möllner Rede wird seitdem im Exil gehalten, in diesem Jahr eben in Frankfurt, Idil Baydar sollte sie halten. Das die Comedienne Baydar schon mehrere Morddrohungen in diesem Jahr erhalten hat, macht diese Rede umso aktueller. Nun wurde sie also unter Polizeischutz gehalten. Seltsamerweise war das 1. Frankfurter Polizeirevier damit beauftragt, wie die Kollegin Ayesha Khan in der taz vom 18. 11. berichtete. Aus diesem Revier wurden die rassistischen Drohfaxe an die NSU-Opfer-Anwältin Seda Başay-Yıldız verschickt. Auch das ist Deutschland. Während ich also am Montag noch nachlese, wie die Veranstaltung war, trinken Rentnerpärchen gemütlich ihren Kaffee.

Berliner Möwenclan ?

Ich komme ja auch von einer Insel. Berlin vor dem Mauerfall. Es ist natürlich kein Vergleich zu dem Inselstatus von Norderney. Berlin verband ich mit dem Inselvolk der Linken, Arbeiter*innen und Aussteiger, Wohlstand trug man nicht auf die Berliner Straßen. Anders dagegen auf der Nordseeinsel: gediegene Boutiquen, wenige, silbern glänzende Mülleimer, aus denen nichts quillt, nirgends ein Döner und sogar die Fast-Food-Läden sind eher Bistros mit Sektchen oder Schnäppsken zum Schnitzelbrötchen.

Quelle          :          TAZ            >>>>>           weiterlesen

—————————————————————–

Grafikquellen       :

Oben      —           Roter Faden in Hannover mit beschriftetem Aufkleber als Test für einen möglichen Ersatz des auf das Pflaster gemalten roten Strichs

Abgelegt unter Berlin, Feuilleton, Mensch, Umwelt | Keine Kommentare »

CDU und die Frauenquote

Erstellt von DL-Redaktion am 25. November 2019

Dröhnendes Schweigen

2018-12-07 Annegret Kramp-Karrenbauer CDU Pateitag in Hamburg-2568.jpg

Vom schrumpfeb der  Personen in der Verantwortung

Aus Leipzig von Anja Maier

Mit ihrem Antrag für eine Quote wollte die Frauen-Union als Tiger die CDU antreiben. Sie landet als Bettvorleger. Was ist da passiert?

Am Samstagmorgen ist Kristy Augustin spät dran. „Das Taxi kam nicht“, sagt sie und eilt auf ihren schwarzen Highheels Richtung Sitzungssaal in der Leipziger Messe. Dort sitzen die Brandenburger Delegierten. Augustin ist eine unter fünf Frauen und zwölf Männern. Dieses Geschlechterverhältnis umreißt recht anschaulich ein Problem der gesamten CDU, mit dem sich der 32. Bundesparteitag in Leipzig an diesem Wochenende befassen muss: dem Frauenanteil in der Partei und deren Zugang zur Macht.

Kristy Augustin, 40 Jahre und gerade wiedergewählte Landtagsabgeordnete, ist Landesvorsitzende der Frauen-Union, sie will eine Lösung. Der Parteitag aber wird die Frage erneut vertagen. Auch weil die Frauen so nett sein werden und der direkten Debatte ausweichen. Warum? Dazu später. Aber noch ist es Samstagmorgen, noch hat Kristy Augustin, die CDU-Familienpolitikerin aus dem Oderbruch kurz vor Polen, es eilig. Noch sagt sie: „Wir brauchen hier auf dem Parteitag eine deutliche Botschaft. Die Frauen-Union muss hier zeigen, was sie will.“

Was will sie denn, die Frauen-Union mit ihren 150.000 Mitgliedern? Kurz gesagt: endlich neue Regeln, um mehr Frauen an die Schaltstellen der Politik zu bringen und so die gesamte Partei anschlussfähiger, attraktiver für Wählerinnen zu machen, für die Chancengleichheit nicht nur eine Floskel ist. Anderen ist das egal oder sie sind strikt gegen Quoten – überraschenderweise nicht nur die Männer, sondern auch der Parteinachwuchs. Sie finden, die Frauen sollten einfach mitmachen, dann würde sich das Problem schon von selbst erledigen.

Es ist das alte Henne-Ei-Problem: Erfüllt die CDU ihre selbst gesetzte, eigentlich verpflichtende 30-Prozent-Quote nicht, gerade weil oder eben obwohl Frauen fehlen, die bereit sind, mitzutun, Verantwortung zu übernehmen? Die Frauen-Union findet, erst müssten die Strukturen geschaffen werden. Ihre KritikerInnen meinen, die Partei sei offen für jeden und jede. Kristy Augustin sagt es so: „Wir sind eine Volkspartei, also brauchen wir auch eine Repräsentanz von Frauen.“

Radikale Töne für eine konservative Partei

An diesem Samstag soll der Parteitag deshalb über einen mit viel Aufmerksamkeit bedachten Antrag der Frauen-Union im Bereich Struktur- und Satzungsfragen abstimmen. Auf Seite 166 des 363 dicken Buches findet sich Antrag C63: „Mehr Frauen in der CDU, in Ämtern und Mandaten“. Der Ton des Textes klingt für diese immer noch große bürgerliche Partei erstaunlich genervt. Die CDU, steht da, habe frauenpolitisch „ein Umsetzungs- und Durchsetzungsproblem“. Allen sei das bewusst, über verbindliche Zielvorgaben für mehr Frauen in Ämtern und Mandaten werde seit anno 1985 diskutiert. Gefasste Beschlüsse wie das 30-Prozent-Quorum würden nicht umgesetzt, sondern – im Gegenteil – permanent unterlaufen. Fraktionen der CDU in Kommunen, Kreistagen und Ländern zählten regelmäßig zu denen mit dem geringsten Frauenanteil.

So weit die Problembeschreibung. Nun zu den Lösungsvorschlägen. Das Quorum, fordern die Frauen, müsse endlich verbindlich werden. Wahllisten sollen künftig nach dem Reißverschlussprinzip besetzt werden. Dies müsse „mindestens für die Anzahl der Kandidatinnen und Kandidaten gelten“, wie es der Zahl der Abgeordneten entspricht. Das hieße: Parität. Und: Über den parteiinternen Finanzausgleich sollen außerdem Verbände belohnt werden, die das Paritätsprinzip tatsächlich durchsetzen. „Das Ziel ist die Erhöhung des Frauenanteils in der Mitgliedschaft, in allen Funktionen und auf allen Ebenen bis hin zur hälftigen Teilhabe.“ Das klingt nach Revolution, jedenfalls für eine konservative Partei. Doch noch bevor es an die Debatte über den Antrag geht, gilt als ausgemacht, dass der Parteitag nicht darüber abstimmen wird.

„Wir brauchen hier eine deutliche Botschaft. Die Frauen-Union muss hier zeigen, was sie will“

Denn die Antragskommission hat einen Kompromiss gefunden: Der Vorschlag der Frauen wird in eine – noch zu bildende – Struktur- und Satzungskommission verwiesen. Annette Widmann-Mauz, die Vorsitzende der Frauen-Union und Staatsministerin für Integration im Kanzleramt, sagte vor dem Parteitag der taz: „Wir ­geben unsere Ziele nicht auf. Es gibt unterschiedliche Wege, aber es muss klar sein: Beim Parteitag 2020, da wird die CDU sich entscheiden müssen.“

Dahinter steht auch die Einsicht, dass die Frauen in der Union ihrer Spitzenfrau Annegret Kramp-Karrenbauer in schwierigen Zeiten nicht auch noch eine Geschlechterdebatte ans Bein binden wollen. Ein Thema, bei dem es um verbriefte, nicht nur freundlicherweise zugestandene Beteiligung für Frauen geht, kommt in Zeiten der aufgebrachten Jungs nicht gut an. Die Truppen gegen Kramp-Karrenbauer werden für alle sichtbar von Männern angeführt; sie heißen Friedrich Merz, Tilman Kuban, Carsten Linnemann. Eine Fokussierung auf ihr Geschlecht, gar eine gönnerhafte Erzählung kann Annegret Kramp-Karrenbauer in Leipzig gar nicht gebrauchen. Die Abstimmung darüber würden ihre Gegner sie mit Freuden verlieren sehen. Ob sie eine Frau ist, soll dabei keine Rolle spielen.

Die Pointe: Dass sie eine ist, wird gerade von ihren Kritikern gern als Beweis dafür hergenommen, dass bei der CDU alle was werden können. Merkel, Kramp-Karrenbauer, von der Leyen – da sehe man es doch. Wozu also noch Quoten, die hier gern „Verbote“ genannt werden. Gemeint sind damit Verbote für Männer. Man kann das als typische CDU-Haltung verstehen, die Frauenfrage in diese extra zu bildende Strukturkommission zu verweisen. Intern strittige Themen werden nicht gern öffentlich debattiert – in der Hoffnung, dass man auf diese Weise einen Kompromiss finden möge, dem die Mehrheit zustimmen kann. Das Problem: Eine Quote für Frauen kann kein Kompromiss sein. Entweder es gibt sie oder eben nicht. Insofern ist nur zu verständlich, dass die ohnehin nur 26 Prozent der Mitgliedschaft ausmachenden Frauen die Faxen dicke haben und eine Entscheidung erzwingen wollen. Und wenn sie das schon nicht hinkriegen – diesmal nicht –, dann wollen sie wenigstens für Öffentlichkeit sorgen. Und Öffentlichkeit bedeutet bei der CDU: Streit. Unangenehm. Kristy Augustin sagt: „Jetzt wollen wir mal sehen.“

Wiebke Winter belässt es bei „Ich will #MehrMädels“

Extra zur Abstimmung ist Wiebke Winter nach Leipzig gereist. Winter ist 23 Jahre alt und seit diesem Jahr Vorsitzende der Jungen Union in Bremen. Sie ist eine Gegnerin der Frauenquote. Ihre Überzeugung: „Wir brauchen keinen Kampf der Geschlechter, sondern ein Miteinander.“ Winter ist außerdem für eine gewisse Leichtigkeit bei diesem hart umkämpften Thema, das in CDU und CSU gern als zweit- bis drittrangig beiseite gewischt wird. Im Oktober, beim Deutschlandtag der Jungen Union in Saarbrücken, haben Wiebke Winter und andere junge Frauen Sticker verteilt: „Ich will #MehrMädels (in der JU)“. „Das klingt nicht so aggressiv und verbissen, ist aber eine klare Message“, sagt Winter.

Überhaupt findet sie, dass jedeR was werden kann in der Union, egal welchen Geschlechts. Wenn ältere Frauen in der Partei ihr erzählen, auch für sie werde es einen Punkt geben, an dem sie in der Partei als Frau nicht weiterkommt, ist sie leicht genervt. „Meine Generation ist anders. Es ist nicht alles perfekt, aber schon deutlich besser als für die Frauen damals.“

Jetzt steht sie am Rande des Plenums, den Schal hat sie locker um den Blusenkragen geschlungen, am linken Arm trägt sie eine Handtasche. Sie ist bereit zur Auseinandersetzung. Mit anderen Aktiven der Jungen Union hat sie schon besprochen, wer für den Parteinachwuchs ans Rednerpult gehen soll, wenn die Frauen-Union ihre Plädoyers für ihren weitreichenden Antrag hält. Wiebke Winter rechnet mit mehreren Wortwechseln in der Sache.

Quelle       :      TAZ           >>>>>          weiterlesen

—————————————————————-

Grafikqiellen       :

Oben        —       Annegret Kramp-Karrenbauer: 31 Parteitag der CDU Deutschlands in Hamburg, Messe Hamburg

Annegret Kramp-Karrenbauer: 31 Parteitag der CDU Deutschlands in Hamburg, Messe Hamburg

——————————————

Unten        —       Diana Kinnert, 2019

Abgelegt unter P.CDU / CSU, Positionen, Sachsen, Überregional | Keine Kommentare »

Linken – Parteitag in Berlin

Erstellt von DL-Redaktion am 24. November 2019

Linke will nach Mietendeckel auch an die Böden

Katrin Lompscher (Martin Rulsch) 1.jpg

und diese ohne angefaulte Wagenbretter bauen ?

Von 

„Wem gehört die Stadt?“, ist das Motto des Berliner Linken-Parteitags. Der ging einher mit einem Angriff auf die großen Wohnungsunternehmen.

Der geplante Mietendeckel ist weder vom Senat noch vom Abgeordnetenhaus beschlossen, da plant die Linken-Stadtentwicklungssenatorin Katrin Lompscher die nächste Initiative zur Bekämpfung des „Mietenwahnsinns in der Stadt“.

Auf dem Landesparteitag der Linken am Samstag in Adlershof kündigte sie an: „Nach dem Mietendeckel müssen wir über Bodenpreise reden. Diese seien „derartig explodiert, dass wir Möglichkeiten schaffen müssen, preissenkende kommunale Beschlüsse zu fassen.“

Lompscher blickte dabei in die österreichische Hauptstadt und sagte: „Das kann man in Wien, das sollte man auch in Berlin und anderswo können.“ Die für ihre soziale Wohnungspolitik bekannte österreichische Hauptstadt gilt offenbar nicht nur den Berliner Sozialdemokraten, sondern auch der Linken als Vorbild.

Während der genau wie Grünen-Landesparteivorsitzender Werner Graf auf dem Linken Parteitag anwesende SPD-Fraktionschef Raed Saleh einräumte, mit dem Vorschlag Lompschers nicht viel anfangen zu können, erklärte diese ihr Anliegen in kleiner Runde. Ziel sei es, „die spekulative Überhöhung von Bodenpreisen mit politischen Instrumenten zu begrenzen“. Nötig seien „klare Regeln für die Ausrufung eines limitierten Kaufpreises“. Die „spekulative Erhöhung der Preise muss unmöglich gemacht werden“, forderte Lompscher.

Darüber hinaus kündigte Lompscher an, die Praxis kommunaler Vorkaufsrechte ausweiten zu wollen. Sie sprach sich für ein „generelles Eingriffsrecht der Kommunen beim Verkauf von Grundstücken“ aus und forderte, Spekulationen zu verbieten. Bei Haus- und Grundstücksverkäufen, auch außerhalb von Milieuschutzgebieten, müsse es einen Entscheidungsvorbehalt geben, der Kommunen beziehungsweise deren Wohnungsbauunternehmen den Vorkauf ermögliche.

Mit Blick auf die am kommenden Dienstag anstehende Abstimmung über den Mietendeckel-Entwurf im Senat zeigte sich Lompscher zuversichtlich. Dieser werde mit „zwei kleinen technischen Änderungen“ eingebracht, außerdem seien „zahlreiche Hinweise zur Begründung“ aus anderen Senatsverwaltungen übernommen worden. Dazu dürften auch Hinweise aus dem Rat der Bürgermeister zählen. Diese hatten am Donnerstag zwar mehrheitlich für den Mietendeckel gestimmt. Die für die Bezirke vorgesehenen Aufgaben wollen sie aber nicht wahrnehmen. Lompscher wiederum hatte in dem Abstimmungsergebnis eine „sehr qualifizierte Minderheit“ für ihre Position erkannt.

 Lob auch von Lederer, Wolf, Schubert und Breitenbach

Unterdessen haben führende Mitglieder der Linkspartei den Landesparteitag dafür genutzt, den Mietendeckel zu loben und sich des eigenen Erfolges zu vergewissern. Katina Schubert, Vorsitzende der Berliner Linken, erklärte, es sei „höchste Zeit, dass wir dem Mietenwahnsinn ein Ende setzen“. Sie verteidigte den Mietendeckel als Schritt, direkt in die Gewinnerwartungen von Vermietern einzugreifen und der „Profitschneiderei von Unternehmen wie Deutsche Wohnen, Vonovia, Akelius“ etwas entgegenzusetzen.

CSD Lay+Liebich+Lompscher+Lederer.jpg

[Von Wohnungsbau bis Mietendeckel: Die Auswirkungen der Politik auf das Leben in den Kiezen sind regelmäßig Thema in unseren Leute-Newslettern aus den zwölf Berliner Bezirken. Hier geht’s zur kostenlosen Bestellung: leute.tagesspiegel.de]

Harald Wolf, ehemaliger Wirtschaftssenator Berlins und Bundesschatzmeister der Linken, lobte den Einsatz der Hauptstadt-Genossen für den Mietendeckel. Ihnen sei es gelungen, die „Eigentumsfrage von einer theoretischen Frage zu einer realpolitischen Diskussion“ zu machen. Wolf, der als Grußredner des Parteivorstands angekündigt worden war, erklärte: „Die gesamte Bundespartei steht in dieser Frage solidarisch an der Seite des Berliner Landesverbandes.“

Quelle         :            Tagesspiegel              >>>>>         weiterlesen

——————————————————————-

Grafikquellen         :

Oben       —        Katrin Lompscher, Berlin politician (Die Linke) and member of the Abgeordnetenhaus of Berlin (as of 2013).

Abgelegt unter Arbeitspolitik, Berlin, P. DIE LINKE, Sozialpolitik | Keine Kommentare »

V.-Schlager Justizversagen

Erstellt von DL-Redaktion am 23. November 2019

Richter Knallhart über dem Abgrund

File:Bundesarchiv Bild 183-B0709-0004-008, Oberstes Gericht, Globke-Prozess, Hilde Benjamin, Friedel Malter.jpg

Eine Kolumne von

Der Volkszorn bringt nicht nur dümmliche Antworten auf intelligente Fragen hervor, sondern auch verzweifelte Amtsrichter. Gut, dass es mutige Verlage gibt! Eine Rezension.

Erinnern Sie sich an Richter Gnadenlos, ein Wesen aus dem Zombie-Keller von „Bild Hamburg“? Der schillernde Containerbesucher und nachmalige Spätaussiedler schloss vorübergehend Freundschaft mit Ole von Beust, erschien als Wetterleuchten am Vorabend des Traumpaars Brandner/Weidel, verhedderte sich dann aber in Dümmlichkeiten. Das ist lange her, liebe Kinder, aber der Schreck steckt uns noch in den Knochen.

Nun könnte „Bild“ einen legitimen Sprössling des großen Hamburgers gefunden haben: In Dinslaken, einer Stadt im Kreis Wesel bei Duisburg, fand sich am dortigen Amtsgericht ein „Knallhart-Richter“, ein eisenharter Bursche. Der Riva-Verlag aus München hat die Gedanken des Richters am Amtsgericht Thorsten Schleif unter dem Titel „Urteil: Ungerecht“ auf das Land geworfen (Thorsten Schleif, Urteil: Ungerecht, Riva-Verlag München 2019, 208 S., 19,99 Euro), nachdem im selben Haus schon Amtsrichter Stephan Zantkes Titel „Wenn Deutschland so scheiße ist, warum sind Sie dann hier?“ schön lief.

Herr Schleif ist am Amtsgericht in Dinslaken für Schöffensachen, Strafrichtersachen Buchstaben A bis K und Jugendstrafsachen zuständig; eine Materie, die, wie er uns verrät, äußerst „simpel“ ist und bei richtiger Grundeinstellung kaum Mühe macht: „Jeder Mensch – nicht nur ein Richter – muss einen Sachverhalt strafrechtlich beurteilen können“ (S. 149). Leider wissen das die Bataillone von Versagern, Karrieristen, Schwachköpfen und Feiglingen nicht, von denen Knallhart-Richter Schleif umzingelt ist. Und das führt geradewegs, wohin es führen muss: „Die dritte Staatsgewalt steht einen Schritt vor dem Abgrund“ (S. 195). Dieser Sound erinnert uns an Jens Gnisa, den Direktor des Amtsgerichts Bielefeld und Vorsitzenden des Deutschen Richterbunds (DRB), der 2017 mit dem Werk „Das Ende der Gerechtigkeit“ (Herder Verlag, 288 S., 24,00 Euro) nach uns warf und sich ziemlich beleidigt zeigte, als ich ihn eher kritisch rezensierte. Bei ihm trugen am Absturz bevorzugt die Rechtsanwälte die Schuld, während es bei Schleif die Richter sind. Ist aber ja auch irgendwie egal – Hauptsache der Untergang droht. Auch Patrick Burow, Amtsrichter in Dessau-Roßlau, lässt sich da nicht lumpen: „Justiz am Abgrund. Ein Richter klagt an“ (Verlag LangenMüller, 2018, 208 S., 22 Euro).

Ohne Apokalypse kommt, so scheint es, der publizierende Amtsrichter nicht mehr aus, wenn er seiner traurigen Lage und des allgemeinen Stands der Dinge in Deutschland gedenkt: Zusammenbruch, Vertrauensdesaster, Qualitätsverlust, Ungerechtigkeit und Willkür allerorten, und die Justiz wird der Fluten nicht mehr Herrin! Da hilft – wir wissen es aus zahllosen Veröffentlichungen des Genres „Wie alles immer schlimmer wird“ – nur „ein mutiger und schonungsloser Blick“ (Klappentext) sowie das beliebte „Alarmschlagen“: Ein Richter „deckt auf“, „rechnet ab“, „schlägt Alarm“, „urteilt, dass die Justiz versagt“, „packt aus“, „trifft den Nerv der Zeit“, „rechnet mit der Kuschel-Justiz ab“, usw. usf. – das sind ein paar Kostproben von Medienüberschriften zum Werk des Dinslakener Terminators.

Das Alarmschlagen im 200-Seiten-Takt besorgten bis vor einigen Jahren traditionell eher Fahndungsprofis aus den Einsatztruppen von Kommissar Rainer Wendt („Deutschland in Gefahr“, Riva-Verlag 2017, 192 S., 9,99 Euro) oder Tania Kambouri („Deutschland im Blaulicht. Notruf einer Polizistin“, Piper Verlag 2015, 224 S., 10 Euro); auch originale „Staranwälte“ wie Ingo Lenßen („Ungerechtigkeit im Namen des Volkes“, Verlag Gräfe & Unzer 2019, 192 S., 19,99 Euro) oder Burkhardt Benecken („Schreiend ungerecht – Alltägliche Justizskandale in Deutschland“, Riva-Verlag 2019, 304 S., 19,99 Euro). Aber Richter können das natürlich auch. Vor einigen Jahren wollten gleich mehrere Verlage mich mit folgendem (nicht erfundenen!) Angebot als Autor gewinnen: „Formulieren Sie irgendeine steile These und schreiben Sie 200 Seiten da entlang. Wir bringen das dann in Form. Das Buch können wir in drei Monaten machen.“

Der Abgrund

Was möchte uns der mutige Amtsrichter aus Dinslaken sagen? Er steht, auf dem Buchcover und in der „BamS“, in Robe, weißem Langbinder und mit Gerichtsakten unterm Arm vorm Portal des Amtsgerichts und starrt uns an, als wolle er gleich fragen, ob wir Probleme haben und eins aufs Maul brauchen. Das ist aber sicher nicht so gemeint. Ob es intelligent ist oder vielleicht ein bisschen dienstpflichtwidrig, demonstrativ in amtlicher Eigenschaft und geschmückt mit den Insignien der Justizmacht zu verkünden, die deutsche Strafjustiz sei auf ganzer Linie von Versagern beherrscht, lassen wir mal dahingestellt.

„Ein Richter deckt auf, warum unsere Justiz versagt“, lautet der Untertitel. Herr Schleif, so erfahren wir, ist in der ordentlichen Justiz tätig, das sind Zivil- und Strafrecht. Den Rest nennt er „unordentlich“, ein Klassiker, der auf jedem bunten Abend im Seniorenheim als Humorbombe durchgeht.

Bevor der Autor uns erzählt, ob und wie die Justiz versagt und woran er das erkannt hat, erzählt er uns erst einmal 138 Seiten lang, warum sie versagt. Der Grund ist einfach und jedem erfahrenen Querulanten vertraut: Die Justiz besteht – mit wenigen Ausnahmen, die sich zum Beispiel am Amtsgericht Dinslaken finden – ganz überwiegend aus Deppen, Schleimscheißern, Arschkriechern, Faulpelzen, Nichtskönnern und Feiglingen. Sagen wir’s mit dem Autor: Neun von zehn Richtern, die „typischen“ also, sind diszipliniert, haben ein großes Bedürfnis nach Bequemlichkeit, ein krankhaftes Verlangen nach Macht und einen ausgeprägten Mangel an Selbstbewusstsein (S. 113 ff., 121).

Hätten Sie gedacht, dass ein Jurastudium in Deutschland praktisch völlig nutzlos ist, weil es sich mit „Digestenexegese“ statt mit dem Akteneinlauf von Amtsrichtern befasst? Ahnten Sie, dass man als Rechtsreferendar nichts, aber auch gar nichts Nützliches lernt und sogar zum Protokollführen missbraucht wird, was wirklich keinerlei Erkenntnisse über den Strafprozess vermitteln kann? War Ihnen bekannt, dass ein anständig arbeitender Amtsrichter – zum Beispiel in Dinslaken – pro Woche genauso viele Fälle erledigt wie ein Strafrichter am Landgericht in einem Jahr (nämlich zehn), und das, obwohl die Verfahren dort kein bisschen schwieriger sind (S. 145 f.)? Andererseits benötigen die Landgerichte „doppelt so lange“ für ihre Verfahren wie die Amtsgerichte (S. 147). Wie immer man dieses mathematische Rätsel löst, bleibt doch, dass Strafrichter am Landgericht mindestens die Hälfte des Jahres einfach gar nichts arbeiten.

Sicher wollen Sie wissen, wo der Grund für diesen unglaublichen, der Öffentlichkeit seit Jahrzehnten unbekannt gebliebenen Skandal liegt: fast ausschließlich bei den faulen, ängstlichen, karrieregeilen Strafkammervorsitzenden, deren Fähigkeiten regelmäßig allein darin bestehen, Verfahren zu verschleppen, Entscheidungen hinauszuzögern und Belastungen vorzutäuschen (S. 149). Die monatelang komplett sinnlose, überflüssige Urteilsgründe mit 1000 Seiten Umfang „hinkritzeln“, wo angesichts der Einfachheit des Strafrechts ein paar wenige Seiten reichen würden.

Quelle         :           Spiegel-online           >>>>>         weiterlersen

——————————————————————-

Grafikquellen        :

Oben      —        Oberstes Gericht, Globke-Prozess, Hilde Benjamin, Friedel Malter Zentralbild Stöhr-9.7.1963 2. Tag im Globke-Prozeß eröffnet. Der 1. Strafsenat des Obersten Gerichts der DDR setzte am Vormittag des 9. Juli 1963 die Verhandlungen gegen den des millionenfachen Mordes Angeklagten Staatssekretär des Bonner Bundeskanzleramtes, Dr. Globke, fort. UBz: Hilde Benjamin, Minister der Justiz der DDR, (rechts) im Gespräch mit Friedel Malter, Vorsitzende des Komitees zum Schutze der Menschenrechte vor Beginn des 2. Prozeßtages.

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Germany license.
Flag of Germany.svg
Attribution: Bundesarchiv, Bild 183-B0709-0004-008 / CC-BY-SA 3.0

——————————

Unten         —       Thomas Fischer auf der re:publica 2016

Abgelegt unter Deutschland, Innere Sicherheit, Justiz-Kommentare, Positionen | Keine Kommentare »

Vom 5G – Prothesengott

Erstellt von DL-Redaktion am 23. November 2019

und dem elektronischen Paradies

File:5g.jpg

Quelle        :      Rath-aus-Ravensburg

Von Stefan Weinert, Ravensburg

es kommt Bewegung in das Anliegen, die Implementierung der 5G-Strahlung in unseren Kommunen zu verhindern — ob in der Funktion als  Modellstadt oder aber grundsätzlich auf Zukunft hin, jedenfalls so lange, bis nicht eindeutig geklärt ist, ob die 5. Generation des Mobilfunk für den Menschen, für die Fauna und Flora = für das auf der Erde Lebende (Bioethik) schädlich oder unschädlich ist. Im Grunde müsste man dazu aber über einen längeren Zeitraum eine Gruppe von Menschen dem Einfluss der  5G-Strahlung aussetzen und eine so genannte Kontrollgruppe von ihr entsprechend isolieren (am besten doch gleich zwei Schulklassen …). Doch das wäre nicht nur pervers und  Menschen verachtend und würde gegen das Grundgesetz verstoßen, sondern es würde sich auch kein Mensch freiwillig bereit erklären, sich für die erstgenannte Gruppe zur Verfügung zu stellen. Im Grunde aber geschieht ein solcher Freilandversuch mit Menschen schon dort, bzw. würde er dort geschehen, wo die 5G heute unter der „Prämisse der Ungeklärtheiten“ (s.o.) implementiert wird/würde. Erinnert ihr euch an den Versuch der dänischen Schülerinnen, die in zwei von einander getrennten Zimmern Kresse ausgesät hatten, wobei in einem 4G/LTE-WLAN installiert war und in dem anderen kein WLAN und an das Ergebnis dieses Versuches?! (siehe die Petition „NO5G in Ravensburg und bundesweit = zurzeit 4.420 Unterschriften).
Bad Wiessee – Usingen – Freiburg – Eppstein – Ravensburg haben sich entschlossen entweder kein 5G zu implementieren, auf Glasfaserkabel zu setzen oder das Projekt „Modellstadt“ abzublasen und vor 2022/23 in dieser Hinsicht alles ruhen zu lassen.
Vor bereits 90 Jahren schrieb der große Menschenkenner und Psychoanalytiker Sigmund Freud folgende Zeilen, und ist sicher von vielen seiner Zeitgenossen deshalb verlacht worden. Aber er hatte nicht nur damals recht, sondern unsere Zeit zeigt, dass eingetroffen ist und eintreffen wird, was er „prophezeite“: ‚Die Technisierung seiner Zeit war längst nicht so fortgeschritten, wie heute, wo uns Menschen  das angebliche „elektronische Paradies“ offen steht.
„Es klingt nicht nur wie ein Märchen, es ist direkt die Erfüllung aller – nein, der meisten – Märchenwünsche, was der Mensch durch seine Wissenschaft und Technik auf dieser Erde hergestellt hat, in der er zuerst als ein schwaches Tierwesen auftrat und in die jedes Individuum seiner Art wiederum als hilfloser Säugling – »oh inch of nature!« – eintreten muss. All diesen Besitz darf er als Kulturerwerb ansprechen. Er hatte sich seit langen Zeiten eine Idealvorstellung von Allmacht und Allwissenheit gebildet, die er in seinen Göttern verkörperte. Ihnen schrieb er alles zu, was seinen Wünschen unerreichbar schien – oder ihm verboten war. Man darf also sagen, diese Götter waren Kulturideale. Nun hat er sich der Erreichung dieses Ideals sehr angenähert, ist beinahe selbst ein Gott geworden. Freilich nur so, wie man nach allgemein menschlichem Urteil Ideale zu erreichen pflegt. Nicht vollkommen, in einigen Stücken gar nicht, in anderen nur so halbwegs. Der Mensch ist sozusagen eine Art Prothesengott geworden, recht großartig, wenn er alle seine Hilfsorgane anlegt, aber sie sind nicht mit ihm verwachsen und machen ihm gelegentlich noch viel zu schaffen. Er hat übrigens ein Recht, sich damit zu trösten, dass diese Entwicklung nicht gerade mit dem Jahr 1930 A. D. abgeschlossen sein wird. Ferne Zeiten werden neue, wahrscheinlich unvorstellbar große Fortschritte auf diesem Gebiete der Kultur mit sich bringen, die Gottähnlichkeit noch weiter steigern. Im Interesse unserer Untersuchung wollen wir aber auch nicht daran vergessen, dass der heutige Mensch sich in seiner Gottähnlichkeit nicht glücklich fühlt.“ [Sigmund Freud 1930 in: Das Unbehagen in der Kultur – Kapitel 3]
Wenn ich persönlich diese Zeilen lese, dann wird mir klar, dass „Technisierung“ und „Humanisierung“ in negativer Weise miteinander korrelieren und in einer Art Bruderkampf stehen. Je weiter die Technisierung (heute muss man sagen „Technisierung/Elektronisierung“) des Menschen fortschreitet, desto mehr nimmt seine Humanisierung ab. Die zurückliegenden .einhundert (100) Jahre  bestätigen das – nicht nur politisch, sondern auch materiell. So klafft die Schere zwischen Arm und Reich immer weiter auseinander und ist gefühlt bereits am Anschlag. Die dunkle Zeit von 1933 bis 1945 beginnt, sich zu wiederholen, ja, sie war nie wirklich beendet …
 
Der homo sapiens ist ein „unterwegs Seiender“ und einmal von ihm errungene Eigenschaften können schnell wieder verloren gehen. Kant, Lessing, Schiller, Goethe – wo waren sie 1933? Tucholsky, Kästner, von Ossietzky wurden verbrannt. Es gibt für den Menschen nie die beste Gesellschaft, sondern immer nur eine veränderte, möglicher Weise zum Besseren hin veränderte Gesellschaft – aber auch nur dann, wenn das Individuum an einer Selbstkorrektur aus einer kritischen Selbst-Leistung interessiert und in der Lage ist.
File:Auersberg radar station (aka).jpg
 
Die technisch-ökonomischen Veränderungen schaffen neue, bisher unbekannte Umweltfaktoren. die Anpassung, die dieser Entwicklung folgen muss, könnte die psychologische Evolution des Menschen zu einem höher strukturierenden ICH auslöschen oder ausbremsen. Die Prinzipien der technischen Vervollkommnung einerseits und das der vollkommenen Einsicht andererseits befinden sich mit einander im Kampf. Diese beiden Prinzipien aber gestalten die Welt, und eine Humanisierung unter dieser Prämisse kann nur gelingen, wenn das Individuum vermehrt über die Welt und über sein Selbst nachdenkt und reflektiert, und so wo möglich zu dem Schluss kommt, dass es Grenzen gibt, die der homo sapiens nicht überschreiten sollte, um nicht wieder zum Neanderthaler zu werden. 

Was die fortschreitende Technisierung anbetrifft,  wird auch an erbgenetische Veränderungen beim Menschen gedacht und geforscht, auch um dessen Affekte zu verstehen und dirigieren zu können, und das, um ihn in seiner Überzahl (das Volk, die Masse) für den reibungslosen Gehorsam gefügig zu machen und um die kritischen, störenden Individuen zum Schweigen zu bringen. (siehe den Roman und den Film „1984“) 

Stefan Weinert, Ravensburg
————————————————————————
Grafikquellen     :
Oben          —         Español: Logo 5G
Author Nicosariego

————————-

Unten      —            Dieses Bild zeigt die Radarstation „MSSR Auersberg“, welche sich auf dem Auersberg, dem zweithöchsten Berg von Sachsen, befindet. Installiert ist ein Weitbereichsradar vom Typ „Thales RSM970“.

Author André Karwath aka Aka
Permission
(Reusing this file)
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 2.5 Generic license.

 

Abgelegt unter Baden-Württemberg, Deutschland, Europa, Politik und Netz | Keine Kommentare »

Stadtgespräch aus Ankara

Erstellt von DL-Redaktion am 22. November 2019

Spionagevorwürfe der Türkei

Embassy of Germany in Ankara 01.JPG

Es gab Zeiten da wollte die Türkei gerne Mitglied in der EU werden. Heute glauben Deutsche diese müssten noch ihre Freunde sein? Die Verliebtheit in sich selbst, überwindet keine Grenzen. Red. DL -IE-

Von Jürgen Gottschlich

Die Festnahme eines Anwalts der deutschen Botschaft in Ankara gefährdet Asylsuchende. Ihre Informationen landen beim türkischen Geheimdienst.

Das Thema sei hochsensibel, heißt es im Außenministerium, und hat offenbar das Potenzial, die deutsch-türkischen Beziehungen erneut schwer zu belasten. Der Rechercheverband von NDR, WDR und Süddeutscher Zeitung machte am Mittwochabend öffentlich, dass bereits am 17. September der sogenannte Kooperationsanwalt der deutschen Botschaft in Ankara, Yilmaz S., festgenommen wurde und seitdem in Untersuchungshaft sitzt. Der offizielle Vorwurf laute „Spionage für Deutschland“.

Tatsächlich geht es um die Beschaffung von Informationen, die für in Deutschland laufende Asylverfahren türkischer Staatsbürger wichtig sein können. Im Klartext heißt das: Der Anwalt fragte im Auftrag der Botschaft bei Staatsanwaltschaften oder der Polizei nach, ob gegen den Asylbewerber XY etwas vorlag, ob ein Ermittlungsverfahren gegen ihn lief und ob er bei einer Rückkehr in die Türkei verhaftet werden würde.

SternGang-Doc-Nazi-Collaboration.jpg

Diese Informationen wurden dann über das Auswärtige Amt an das Bundesamt für Migration und Flüchtlinge (Bamf) weitergereicht und dort in die laufenden Asylverfahren eingespeist. Eine „international übliche und aus unserer Sicht unstrittig zulässige Unterstützungsarbeit für die Botschaft vor Ort“, wie das Auswärtige Amt betont.

Ohne dass davon weiter Notiz genommen wurde, hatten regierungsnahe türkische Zeitungen am 18. September über die Festnahme berichtet. Dort heißt es, Yilmaz S. und ein weiterer, nicht genannter Anwalt seien, als sie auf dem Weg zur Botschaft waren, festgenommen worden. Yilmaz S. werde der Unterstützung der kurdischen PKK und der islamistischen Gülen-Bewegung, die für den Putschversuch 2016 verantwortlich gemacht wird, verdächtigt.

Weitreichende Auswirkungen

Bei den Asylsuchenden, für deren Verfahren der Anwalt Informationen beschaffen sollte, handelt es sich offenbar um kurdische Aktivisten und um Anhänger der Gülen-Bewegung. Hier offenbart sich, welche weitreichenden Auswirkungen die Verhaftung des deutschen Anwalts haben könnte. Denn sowohl was die Kurden, aber auch – und vor allem – die Gülen-Anhänger betrifft, ist die Türkei seit Langem erbost, dass die Bundesrepublik vielen von ihnen Asyl gewährt hat und sie damit der Strafverfolgung in der Türkei entzieht.

Quelle       :    TAZ       >>>>>         weiterlesen

—————————————————————-

Grafikquellen      :

Oben          —        Deutsche Botschaft in Ankara  –    Ambasada Njemačke u Ankari.

——————————-

2.) von Oben     —      SternGang-Doc-Nazi-Collaboration

Unten          —      Systemkritische Protestfahne „BananenRepublik Deutschland“

Abgelegt unter Arbeitspolitik, Asien, Deutschland, Regierung | Keine Kommentare »

Kleines Saarland umzingelt

Erstellt von DL-Redaktion am 20. November 2019

von Militär und deren Einsätzen

Bildergebnis für Wikimedia Commons Bilder Bundeswehr in Schulen Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

Quelle      :          Scharf  —   Links

Von Waltraud Andruet,  c/o FriedensNetz-Saar , pax christi Saar/ Saarwellingen

Die Bundeswehr feiert in ganz Deutschland ihren 64. Geburtstag. Auch in Saarlouis fand aus diesem Grund ein großes Spektakel statt. Dabei wurde aus der Hand des saarländischen Ministerpräsidenten Tobias Hans (CDU) das ’Fahnenband’ an das Saarlouiser Fallschirmjägerregiment 26 verliehen. „Wozu soll das dienen? Das hatten wir doch schon einmal, sei gefragt.

Die Bundeswehr will hoffähig werden und drängt sich so in die Öffentlichkeit. Sie mache sich fit für die neuen Perspektiven, die sich aus einer veränderten globalen Lage ergeben, erklärte so Eberhard Zorn, der aktuelle Generalinspekteur der Bundeswehr im Interview, bei seinem Besuch letzter Woche in Saarlouis. Dort referierte er auf Einladung der Standortkameradschaft ’Großraum Saarlouis’. Zorn skizzierte die zahlreichen neuen Perspektiven für die Bundeswehr, die sich aus einer veränderten globalen Lage ergäben, darunter vor allem die starken weltweiten strategischen Interessen Russlands und Chinas. Eine dieser Perspektiven: „Gleichrangig und gleichzeitig“ zu den offiziellen zwölf Auslandseinsätzen mit derzeit 3500 Soldaten rüste die Bundeswehr die Landes- und Bündnisverteidigung wieder auf. Da geht es vor allem um die Grenze der baltischen Staaten zu Russland, zu deren Schutz die NATO- Partner im Baltikum üben. Dazu beabsichtigen die Streitkräfte der USA mit Beteiligung anderer NATO-Staaten und auch der Bundeswehr im Frühjahr2020 die Durchführung eines militärischen Großmanöver mit der Bezeichnung „DEFENDER 2020“ (DEF20). Diese Militärmanöver werden in wesentlichen Teilen auch aus Deutschland unterstützt. DEF20 ist ein militärisches Großmanöver unter Beteiligung vieler europäischer Staaten, das es in dieser Dimension seit 25 Jahren nicht mehr gegeben hat. Es soll unter Beweis gestellt werden, dass es möglich ist, in kurzer Zeit große Mengen an Panzer und Soldaten quer durch Europa an die russische Grenze zu transportieren, so der Vortrag des Generalinspektors Zorn.

Während auf dem ’Großen Markt’ von Saarlouis das Militärspektakel stattfand, dröhnten unterdessen und werden es noch bis zum 6. Dezember weiter tun, die Leopard II Panzer oder zumindest Teile dieses Kommandos auf dem Erprobungsgelände ’Großer Sand’ in Fraulautern. Das Dröhnen dieser Panzergattung hört man nicht nur in der benachbarten Wohnsiedlung von Fraulautern, sondern ihr ’Kampflärm’ ist weit bis nach Saarwellingen auszumachen. „Dieser Geräuschpegel ist für Mensch und Natur unzumutbar“, erklärte Waltraud Andruet, Sprecherin des FriedensNetzes-Saar. Am Nachmittag des Militärspektakels donnerten über die lärmgeplagte saarländische Region dann „zum krönenden Abschluss“ noch über 30 Kampfjets der Bundeswehr. Für diese verbrauchten 2 Stunden und 37 Minuten ’Showtime’ fallen, summiert für alle Maschinen, 22 Flugstunden und 27 Flugminuten an, in denen ca. 134 700 Liter militärischer Treibstoff JP8 in viel Lärm, ca. 371.772 kg CO2 und ca. 1.078 kg NOx (Stickoxide) umgewandelt wurden. Im Vergleich mit dem Auto würde dieser Verbrauch einer gefahrenen Strecke von 2.245.000 km entsprechen (Siehe: http://saartext.de/180-01.html).

Auf der Infoseite ’Saartext.de’ kann ein Leser sich über Militärübungen in der Region informieren. „Wo bleibt da der Schutz und die Sicherheit der eigenen Bevölkerung?“, fragt so Waltraud Andruet offen weiter und kommentierte die Militärshow, auch „als Katastrophe für die Ökobilanz“! Das Militär nimmt auf die „Umwelt“ keine Rücksicht und unsere saarländische Regierung hat bei Umweltproblemen taube Ohren, Für mich ist Krieg der größte Klimakiller, deshalb gilt: „Abrüsten für Klimaschutz!“ Die Zukunftsfähigkeit unseres Planten Erde hängt auch mit der Frage von ’Krieg und Frieden’ zusammen. Militär schädigt auch ohne Krieg aktiv die Umwelt und trägt bei zur Verseuchung wenn nicht Vernichtung unserer aller Lebensgrundlagen.

Es finden sich immer wieder Dumme, welche einer Fahne hinterherrennen.

Nachwort:

Das US-Militär ist der größte Einzelverbraucher fossiler Brennstoffe weltweit mit einem Verbrauch von 48 Millionen Liter pro Tag. Mit 243 Millionen Euro hat die BRDeutschland in den vergangenen sieben Jahren die hierzulande stationierten US-Truppen unterstützt. Die 480 Millionen Euro, die der Bund von 2012 bis 2019 für alle militärischen Baumaßnahmen von NATO-Partnern in Deutschland verplant hat, entfallen „fast ausschließlich“ auf die USA. Das geht aus einer Antwort des Finanzministeriums auf einer Anfrage der Linken-Abgeordneten Brigitte Freihold hervor.„Deshalb fordern wir nicht mehr Geld fürs Militär, sondern „Abrüsten ist das Gebot der Stunde“, so Waltraud Andruet.

 Waltraud Andruet c/o FriedensNetz-Saar , pax christi Saar/Saarwellingen, 13.11.2019

 Für Spenden:

Neue Bankverbindung: Friedens-Netz-Saar, Sparkasse Saarbrücken, IBAN: DE49 5905 0101 0610 5552 60,BIC: SAKSDE55XXX;

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————

Grafikquellen       :

Oben      —       Autor   Lupus in Saxonia / Wikimedia Commons (CC BY-SA 4.0)

——————————-

Unten         —        Fallschirmjäger im Großen Dienstanzug der Bundeswehr

Abgelegt unter Kriegspolitik, Kultur, Regierung, Saarland | Keine Kommentare »

Abbruch oder Aufbruch

Erstellt von DL-Redaktion am 19. November 2019

Zwischen Abbruch und Aufbruch

DIE LINKE Bundesparteitag 10-11 Mai 2014 -118.jpg

Quelle       :        Scharf  —  Links

Von René Lindenau

An einem trüben Novemberwochenende (15.-17.11 2019) traf sich die sächsische LINKE in Dresden zu ihrer 2. Tagung des 15. Parteitages. Neben Trauerarbeit nach den aus Sicht der Partei dramatisch verlustreichen Landtagswahlen,vom 1. September, war ein neuer Landesvorstand, im Besonderen, ein neuer Vorsitz zu wählen. Bei allem stand Fehlerdiskussion, Ursachenforschung für die Wahlniederlagen des Jahres 2019 (Europa, Kommunal, Land) auf dem Programm, ohne jedoch auch den Blick nach vorn nicht zu vergessen.

Als „Ausländer“, der eigentlich im brandenburgischen Landesverband organisiert und angesichts eines nicht besseren Wahlergebnisses, immerhin verlor Rot-Rot die Regierungsmehrheit, genug eigene Sorgen hätte, zog es es mich wenigstens für einen Tag in die sächsische Hauptstadt. Aber was soll man machen: Wenn man sich persönlich mit einigen sächsischen Genossen verbunden fühlt und damit auch diesem Landesverband als Ganzes. Ohne Zweifel, trotz allem bleibt die sächsische LINKE ein ganz wichtiger Teil der Bundespartei. Auch wenn sie der Wähler jetzt geschrumpft hat, die Bedeutung der sächsischen LINKEN ist geblieben, ihre Verantwortung ist eher gestiegen. Jetzt erst Recht! Sachsen´s LINKE muss der Leuchtturm in Dunkel-Sachsen sein!

„Leuchtturm Wärter“ haben die Delegierten an diesem Wochenende gewählt.Wie gut und effizient ihre Strahlkraft in Partei und Gesellschaft sind, wir werden sehen; Stefan Hartmann und Susanne Scharper. Geben wir ihnen und der neuen genossenschaftlichen Führung eine Chance! Aber hatten die, die Genossen Feiks und Dudzak als (im doppelten Sinne?) abgetretene Landesvorsitzende und nicht wiedergewählte Landesgeschäftsführer? Will sagen, mir tut es persönlich um beide Genossen leid. Nichts (!) gegen ihre Nachfolger, im Gegenteil, ihnen sei im Interesse der Partei aller nur denkbarer Erfolg gewünscht. Mussten Feiks und Dudzak als Sündenböcke für die Wählereinbußen herhalten? Sündenböcke sollten jedoch lieber im bezahlten Fußball verortet bleiben, aber nicht in einer linken Partei mit solidarischen Antlitz – zumal ihr Spitzenkandidat Rico Gebhardt als Fraktionsvorsitzender weiter machen kann… Fragen auf Fragen.

Fragen zu stellen, Antworten zu suchen, was denn nun zu den Einbrüchen in der linken Wählerschaft führte und wie es weiter gehen soll, dazu hatten die Delegierten schon am ersten Tagungstag bis gegen 22 Uhr Zeit. Aber sie nutzten sie nicht! Über eine Stunde Redezeit; des Austausches, der Suche nach Antworten und neuen Wegen wurde verschenkt. Ich erlebte das jüngst auch auf einem Bundesparteitag. Aber die „Kaffee-Sachsen“ hätte ich für redseliger gehalten – insbesondere im Angesicht zwischen Abbruch und Aufbruch, habe ich da mehr erwartet: Wo sind die Ursachen für die Niederlagen, wie kommen wir da wieder raus? Wie gehen wir mit den Niederlagen um, lernen daraus und organisieren uns neue Erfolge? Alles schon klar? Vielmehr begann und endete die Debattenzeit mit einem Missbrauch. Eröffnet wurde mit NATO Manövern und Bedrohungen Richtung Russland statt diese nicht unwichtigen Gedanken in der üblichen Antragsdebatte einzubringen sowie ein verspätetes Parteilehrjahr, wo uns der Referent mit unbestritten den nach wie vor richtigen und wichtigen marxschen ökonomischen Grundrissen u.a. kam. Der aktuellen Situation in Sachsen und der Tagesordnung des Parteitages wurden diese Beiträge jedenfalls nicht gerecht.

Wenn man mich als brandenburgischen Zaungast nach möglichen Gründen für die krachende landtägliche Wahlniederlage befragt, meine ich, wesentlich Schuld trug das – plakative – Bekenntnis zum demokratischen Sozialismus. Nichts dagegen, deshalb ist man schließlich in dieser Partei. Aber in einem Landtagswahlkampf, auf Wahlplakate? Überfordern wir da nicht viele Bürger, einschließlich des alten und neuen CDU Ministerpräsidenten, Michael Kretschmar , wenn er geradezu reflexartig ablehnend oder einfach nur unwissend, nicht vom real existierenden gescheiterten DDR Sozialismus für den die SED stand, und einem demokratischen Sozialismus, für den ihre Nachfolgepartei, DIE LINKE heute kämpft, zu unterscheiden weiß. Die Idee des Sozialismus, wie auch immer sie in ihrer Geschichte bisher daher kam, ist nach der verheerenden Niederlage der Wendejahre von 1989/91 bis heute diskreditiert. Linke, sozialistische Ideen haben es bis in die Gegenwart schwer, öffentliche Räume zu erobern, geschweige denn Diskurs bestimmend in Prozesse einzugreifen und entsprechende Entwicklungen voranzutreiben. Die Linke als Partei und Bewegung ist halt immer noch in der gesellschaftlichen Defensive. Wo Veränderungen gelingen sind sie nur kleinteilig und gehen manchem nicht weit genug. Wenn Erfolge gelingen, Dinge schon längst von der Partei aufgeschrieben oder umgesetzt wurden und eigene Genossen nichts davon wissen – dann wird es ganz böse.In einem Landtagswahlkampf erwartet der Bürger zuerst Antworten auf landespolitische Fragestellungen. Dann hätte Sachsens LINKE möglicherweise mehr gepunktet. Programmatische Zielvorgaben einer Partei gehören meines Erachtens nicht in so einen Wahlkampf, auch nicht auf Plakate.

In einer Zeit, da die linksseitig ohnehin nie einfache sächsische Großwetterlage noch komplizierter geworden ist, hat der Dresdner Parteitag das Feld neu bestellt. Nun gilt es für den neuen Landesvorstand gemeinsam mit der geschwächten Landtagsfraktion neu zu säen und zu ernten. Sachsen ist ein zu schönes und ein politisch zu wichtiges Land, als dass es den schwarzen und blau – braunen Block allein überlassen werden darf. Dazu bedarf es einer starken LINKEN, die sich nicht nur in Mandatszahlen ausdrückt. Darüber hinausgehende Bündnisse in alle gesellschaftlich relevanten demokratischen Kräfte der Zivilgesellschaft werden in dieser Situation von noch größerer Bedeutung sein. Im Übrigen wäre das doch ein Weg, um verlorenes Terrain zurück zu erobern. Oder?

Cottbus, den 18.11. 2019  René Lindenau

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquelle       :          Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor      —      Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -118.jpg
  • Created: 2014-05-21 17:36:47

Abgelegt unter P. DIE LINKE, Positionen, Sachsen, Überregional | Keine Kommentare »

G20-Gipfel – Beweise unklar

Erstellt von DL-Redaktion am 18. November 2019

 Nur ein Beamter wurde angeklagt. Woran liegt das?

20170707-IMG 9435.jpg

Singen sie  wieder  ?    ….. die Reihen fest geschlossen. Macht muss Macht zeigen um zu bleiben

Von

Ob sich Polizisten beim G20-Gipfel in Hamburg strafbar gemacht haben, ist noch lange nicht aufgeklärt. Nur ein Beamter wurde angeklagt. Woran liegt das?

Stein- und Flaschenwürfe auf Polizeibeamte, Schlagstockhiebe und Pfefferspray gegen Demonstrierende – gut zweieinhalb Jahre nach dem G20-Gipfel in Hamburg ist die letzte Akte noch lange nicht geschlossen. Mehr als 900 Ermittlungsverfahren gegen mutmaßliche Randalierer hat die Staatsanwaltschaft bislang eingeleitet, rund 180 Personen wurden verurteilt. Vergleichsweise überschaubar wirken dagegen die Ermittlungen gegen mutmaßliche Straftäter in den Reihen der Polizei: Von 156 Verfahren wurden 103 eingestellt, nur ein Polizist landete bislang vor Gericht und wurde verwarnt – weil er einem Kollegen den kleinen Finger umknickte.

Direkt gegenüberstellen lassen sich die Zahlen nicht. Die Frage, ob Gewalt strafbar ist, hängt davon ab, wer sie anwendet und wann. Das staatliche Gewaltmonopol liegt bei der Polizei. Doch was sagt es aus, wenn zwei Drittel der Ermittlungsverfahren gegen Polizisten eingestellt werden mangels hinreichenden Tatverdachts? „Polizeigewalt hat es nicht gegeben“, behauptete der damalige Bürgermeister Olaf Scholz (SPD) wenige Tage nach dem Gipfel und meinte damit: Für systematische Übergriffe von Polizisten auf Bürger gebe es keine Hinweise.

Geben die Zahlen ihm recht? Oder blieben womöglich Straftaten unentdeckt, weil nicht gründlich genug ermittelt wurde?

Früher oder später landen sämtliche Strafanzeigen gegen Polizisten im Einsatz auf dem Schreibtisch von Oberstaatsanwältin Sabine Schmädicke, Leiterin der Abteilung Amtsdelikte. Was und wie lange ermittelt werden soll, bestimmen sie und ihre Kollegen. Von dem Begriff „Polizeigewalt“ hält Schmädicke wenig. Doch sie sagt auch: Wenn ein hinreichender Tatverdacht fehle, heiße das nicht, dass keine Straftat vorgefallen sei. „Wir wissen es einfach nicht“, sagt sie.

Steht ein Polizist oder eine Polizistin im Verdacht, im Einsatz eine Straftat begangen zu haben, prüfen als Erstes andere Polizisten den Fall. Das Dezernat Interne Ermittlungen (D.I.E.) trägt im Auftrag der Staatsanwaltschaft Material zusammen, sucht nach Hinweisen auf strafbares Verhalten und trifft eine Vorauswahl. Dann geht die Akte an die Juristinnen der Abteilung Amtsdelikte, die den Fall strafrechtlich bewerten. Erhärtet sich ein Tatverdacht, erheben sie Anklage. Bei Verfahren gegen Polizistinnen und Polizisten im G20-Einsatz aber sei das schwierig, sagt die Oberstaatsanwältin.

Die Situation während der Gipfeltage war oft chaotisch – Demonstrationen und Proteste in kaum zu überschauender Zahl, vermummte Randalierer, Polizisten in gepanzerter Einsatzmontur, mit individueller Kennung oder ohne. Die Quellen für die Ermittlungen: YouTube-Videos, Aufnahmen der Polizei, Presseberichte, Fotos, Zeugenaussagen. Alles Momentaufnahmen aus bestimmten Blickwinkeln. „Ich sehe eine Szene, von der ich nicht weiß: Wann war das? Wo war das? Welcher Polizeibeamte hat gehandelt?“, sagt Schmädicke. „Und aus welchem Grund kam es zu diesem Geschehen? Das sind alles Fragen, die ich lösen muss.“

20170708-IMG 9769.jpg

Zeugen könnten sich oft nicht an Einzelheiten erinnern, die Einsatzberichte der Polizei seien mit erheblichen Verzögerungen, womöglich erst Tage später, verfasst worden. „Mein Eindruck ist: Die schriftliche Berichtsfertigung, die eigentlich gefordert ist, war objektiv nicht möglich“, sagt Schmädicke. Das alles erschwere die Beurteilung.

Im Zweifel für den Angeklagten: Das gilt auch für die Polizei

Quelle           :         Zeit-online         >>>>>          weiterlesen

———————————————————————

Grafikquellen        :

Oben       —          G20 summit policetroops

——————————–

Unten        —         g20 summit 2017 hamburg

Abgelegt unter Hamburg, Innere Sicherheit, Kriegspolitik, Kultur | Keine Kommentare »

Das Spiel mit Mitgliedern

Erstellt von DL-Redaktion am 17. November 2019

Wie „wahr“ sind veröffentlichte Mitgliederzahlen der Partei DIE LINKE. in der Realität?

DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

Quelle        :    Scharf  —   Links

Von Wolfgang Gerecht

Werden die Öffentlichkeit, die Links-Partei-Wähler und die Mitglieder der Links-Partei durch den 44-köpfigen Bundesvorstand (BuVo) und die Landesvorstände (LaVo) der Partei DIE LINKE durch irreale Mitgliederzahlen getäuscht?

Kann eine Partei, in der ein Landesverband den anderen Landesverband, mittels satzungswidrigen (unrichtigen) Mitgliederzahlen täuscht „demokratisch“ oder gar „solidarisch“ sein?

Ein zentraler Punkt der demokratischen Verfassung einer Partei ist die satzungskonforme Mitgliedschaft eines  j e d e n  Partei-Mitglieds.

Ein wesentlicher Punkt einer satzungskonformen Mitgliedschaft ist die satzungskonforme Zahlung des Mitgliedsbeitrages gemäß Beitrags-Tabelle bzw. die satzungskonforme Beitragsbefreiung eines Mitglieds.

  • Nur satzungskonforme Mitgliedsbeiträge ergeben satzungskonforme Mitgliederzahlen,
  • Nur satzungskonforme Mitgliederzahlen ergeben satzungskonforme Delegierten-Schlüssel.
  • Nur satzungskonforme Delegierten-Schlüssel ergeben eine legale Delegierten-Wahl.
  • Nur eine legale Delegierten-Wahl ergibt eine legale Parteitags-Delegierten-Versammlung
  • Nur eine legale Delegierten-Versammlung ergibt einen legal gewählten Partei-Vorstand.

Das gilt für alle Wahlen einer Partei, so auch für die Partei DIE LINKE.

Egal ob Bundesebene, Landesebene, Kreisebene, Stadt- oder Gemeindeebene.

Egal ob Vorstands-, Kommissions- oder z.B. LAG oder BAG Wahlen u.s.w..

Beispiel Saarland:

Ende 2016 wurden  2.395, für 2017  2.465 und 2018  2.124 Mitglieder ausgewiesen.

Von dort aus berichtet der Landes-Schatzmeister Schmidt gem. ND v. 26.9.19, dass er nach Abschluss der Mahnverfahren mit noch etwa 1800 Mitgliedern rechne.

In 2017 noch 70 Mitglieder dazu, in 2018  dann 341 Mitglieder weniger, dann wird in 2019 gemeldet es sind wahrscheinlich nur noch ca. 1800, also ca. 324 weniger.

Der Saarland-Schatzmeister beklagt zudem, dass die Beiträge viel zu niedrig seien. 30 bis 40 Prozent der Genossen zahlten nur den Menschen ohne Einkommen vorbehaltenen Mindestbetrag von 1,50 Euro monatlich, die meisten von ihnen auch den nicht einmal regelmäßig.

Es ist bei dieser o.g. Sachlage offensichtlich, dass ein Großteil der Genoss Innen im Landesverband Saarland Kenntnis von dieser rechtswidrigen Faktenlage gehabt haben müssen.

Bei der Korrektur der satzungswidrigen und damit rechtswidrigen Mitgliederzahlen aus denen normalerweise auch die Delegierten-Anzahl eines jeden Landesverbandes abgeleitet bzw. errechnet werden, muss um satzungskonform zu werden, folgendes berücksichtigen:

Die Streichung/Löschung der Mitgliedschaft bei den Mitgliedern, die nach dem Mahnverfahren ihre satzungskonform ermittelten Beiträge nicht entrichtet haben.

Die zur Streichung der Mitgliedschaft von LaSchatzMstr geschätzten 300 Mitglieder entsprechen etwa 14% der zum 31.12.2018 von ca. 2.100  (2.124) Mitglieder.

Nach Angaben des Landes-Schatzmeisters im ND zahlen 30 bis 40 Prozent der Genossen nur den Menschen ohne Einkommen vorbehaltenen Mindestbetrag von 1,50 Euro monatlich, die meisten von ihnen auch den nicht einmal regelmäßig. Mindestens 30% der Linken-Mitglieder im Saarland also ca. 630 Mitglieder wären demnach Empfänger von Grundsicherung sei es durch Hartz IV oder durch Sozialhilfe. Das wäre durch Vorlage der Bewilligungs-Bescheide leicht nachzuprüfen. In der Regel wissen die Linken-Mitglieder der Gemeinden- und Stadtverbände ja, wer wirklich satzungskonforme Beiträge zahlt, d.h. ggfs. zu Recht den „Mini-Beitrag“ zahlt oder nicht.

Also diese „Beitrags-Verweigerer“ haben ebenfalls keine Mitgliedsrechte und sind deshalb ebenfalls in das Mahnverfahren einzubeziehen, was bei erfolglosem Abschluss ebenfalls zur Streichung/Löschung der Mitgliedschaft solcher Mitglieder führen muss.

Diese Maßnahme wird zur Reduzierung von 630 Mitgliedern (bei 30%), von 420 Mitgliedern bei (20%) satzungswidrigen Beitragszahlern führen.

Wie heißt es so schön bei der LINKEN permanent: Solidarität, Demokratie u.s.w.

Einige Fragen lauten:

Ist der LV Saarland nur der berühmte Einzelfall?

Wusste der Bundesvorstand, gerade auch die beiden Vorsitzenden Kipping und Riexinger, der Bundesgeschäftsführer Schindler, der Bundes-Schatzmeister Harald Wolfvon alledem überhaupt nichts? Was hat der Bundes-Schatzmeister Wolf und der Bundes-Geschäftsführer Schindler für eine Wiederherstellung einer satzungsgemäßen Mitglieder- und Kassenführung im Landesverband Saarland konkret unternommen? Gibt es weitere Landesverbände mit gravierenden Unregelmäßigkeiten bei der Erhebung eines satzungsgemäßen Beitrags?

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/

——————————————————————

Grafikquellen        :

Oben        —     Bundesparteitag DIE LINKE Mai 2014 in Berlin, Velodrom:

Autor      —     Blömke/Kosinsky/Tschöpe

  • CC BY-SA 3.0 deview terms
  • File:DIE LINKE Bundesparteitag 10-11 Mai 2014 -116.jpg

———————————

Unten     —        Ein bunter Scherbenhaufen von rot  bis braun – ein Scherbenhaufen

Abgelegt unter P. DIE LINKE, Positionen, Saarland, Überregional | 29 Kommentare »

Demokratieförderung Bund

Erstellt von DL-Redaktion am 17. November 2019

Geld allein macht nicht glücklich

Unteilbar Dresden 2019 026.jpg

Von Pia Stendera und Simon Schramm

Wie wir zusamenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Deshalb investiert der Staat viel Geld in Großprogramme zur Demokratieförderung. Was können diese überhaupt leisten?

Demokratie, die Herrschaft des Volkes, bedeutet in Deutschland für die meisten Volljährigen, regelmäßig frei und geheim ihre Re­prä­sen­tan­t*in­nen wählen zu können. Gerade Jüngere halten das für selbstverständlich, sie kennen kein anderes politisches System. Und Demokratie bedeutet, die eigene Meinung frei äußern zu dürfen, auch wenn einige dabei gern weiter gehen würden, als es das Grundgesetz erlaubt. Doch demokratisches Leben ist noch viel mehr als wählen gehen und Meinungsfreiheit.

Wie wir zusammenleben möchten, muss in einer Demokratie immer wieder aufs Neue ausgehandelt werden. Und manchmal braucht es eine Erinnerung, wie sehr wir von unserem politischen System profitieren. Es braucht Überzeugungsarbeit – ob im Betrieb oder in der Kneipe. Um diese Arbeit zu fördern, hat der Staat 2001 beschlossen, Geld zu verteilen. Zusammengefasst hat er das mit dem Begriff Demokratieförderung.

Was heißt das? Konkret geht es um Fördergroßprogramme des Familienministeriums, wobei Geld an Organisationen und Bür­ge­r*in­nen verteilt wird, die sich um die Demokratie kümmern. Unterstützt werden zum Beispiel Bildungsprojekte für Schü­le­r*in­nen, Schulungen für Leh­re­r*in­nen, Projekte zur präventiven Extremismusbekämpfung, aber auch Aus­stei­ge­r*in­nen­pro­gram­me für Ex­tre­mis­t*in­nen.

In den vergangenen 20 Jahren hat die Regierung konstant immer mehr Geld dafür bereitgestellt, Kritik gab es trotzdem. Das Problem: Bisher liefen diese Großprogramme maximal fünf Jahre. Somit waren auch die Förderungen der Projekte immer begrenzt, ihre weitere Existenz stets bedroht. Nun wird mit „Demokratie leben“ zum ersten Mal ein solches Großprogramm verlängert.

Natürlich kann ein Förder-programm nicht alles heilen, was falsch läuft

„Weil Demokratieförderung Planungssicherheit braucht“, begründete Familienministerin Franziska Giffey (SPD) diese Entscheidung. Mit dem Jahr 2020 beginnt dann der zweite Förderzeitraum. Jährlich sollen bis 2024 115,5 Millionen Euro in demokratiefördernde Projekte fließen. Die Entfristung allein schafft aber keine Planungssicherheit.

Unteilbar Dresden 2019 006.jpg

Die Kritik an Großprogrammen zur Demokratieförderung ist so alt wie die Programme selbst. Jedes Mal, wenn diese Programme auslaufen, sagen Ver­tre­te­r*in­nen bisher geförderter Projekte, dass das Geld nicht reicht. Mit „Demokratie leben“ wurden aber allein 2019 115 Millionen Euro verteilt. Das ist mehr als in jedem vergleichbaren Programm in Europa.

Viel Unmut gab es wegen der neuen Verteilung der Fördergelder. Besonders ein offener Brief an das Familienministerium sorgte für Aufsehen. Der Brief wurde von Joseph Blank und Martin Nanzig von der Deutschen Gesellschaft für Demokratiepädagogik initiiert und von 315 Organisationen und Personen unterzeichnet. Wo genau ist das Problem?

Quelle         :     TAZ         >>>>>        weiterlesen

—————————————————————-

Grafikquellen      :

Oben         —          Unteilbar Dresden 2019

Abgelegt unter APO, Kultur, Sachsen, Überregional | Keine Kommentare »

Vom Osten lernen

Erstellt von DL-Redaktion am 16. November 2019

Die Linke und das Jubiläum der DDR-Annexion

File:Amsterdam Grafitti Freedom Lives When the State Dies.png

Quelle        :       untergrund-blättle CH.

Von   Peter Schaber / lcm

Wann immer sich irgendeines der Ereignisse zur deutschen Einheit jährt, füllen sich die Feuilletons mit Jubelarien, die Plätze mit Jubelariern und die Talkshows mit Jubelexperten.

Der immense Aufwand wird benötigt, weil die Erfolgsstory „deutsche Wiedervereinigung“ zu den wichtigsten Mythen dieser Republik zählt. Und weil dieser Mythos immer und immer wieder gebetsmühlenartig wiederholt werden muss, damit er sich als Realität in den Köpfen der Menschen verfestigt.

Denn die traurige Geschichte, die mit Deutschlandwimpel überdeckt und mit Rotkäppchen-Sekt aus dem Gedächtnis gelöscht werden soll, ist: Besonders gut gelaufen ist die „deutsche Einheit“ nicht. Wiedervereinigung war sie keine, sondern eine mit einer Schocktherapie durchgesetzte rasant vollzogene Annexion. Ein historisch gewachsener Staat – wie auch immer man ihn bewerten will – wurde ökonomisch, politisch, juristisch und kulturell ausgelöscht. Bleiben sollte nichts: Keine volkseigenen Betriebe, kein einheitliches Schulsystem, keine Marxist*innen an Universitäten, keine Ostdeutschen in Leitungspositionen.

Begleitet wurde dieser Prozess durch das wahrscheinlich grösste Wirtschaftsverbrechen der deutschen Nachkriegsgeschichte: Die sogenannte Treuhand. Der wurde zunächst das – ja formal der Bevölkerung gehörende – Vermögen der DDR einverleibt – angeblich, um es zu bewahren. In einem Wildwestverfahren wurde privatisiert, verscherbelt, zerschlagen, abgewickelt. Am Ende der Bilanz war der Osten deindustrialisiert, Millionen Menschen arbeitslos oder in Kurzarbeit, einige Westfirmen hatten sich bereichert oder einfach vorsorglich Konkurrenten zerstört. Immense Werte wurden einfach vernichtet.

Was die Treuhand auf ökonomischem Gebiet leistete, wurde auf akademischem und kulturellem auch durchgesetzt. Wer den Kapitalismus nicht aus vollem Herzen wie den Laib Gottes in der Sonntagsmesse empfing, wurde abgesägt – und dafür musste man keineswegs altgediente*r SED-Funktionär*in sein. Die berufliche Ausgrenzung wurde vervollständigt durch das Bild des „Ossis“, das bis heute als negativ konnotierter Topos für den rückständigen, schwer zufriedenzustellen, andauernd jammernden, undankbaren Ostdeutschen in den Feuilletons und an den westdeutschen Stammtischen reproduziert wird.

Einige Autoren – darunter der italienische Ökonom Vladimiro Giacche sowie die Publizisten Wolfgang Dümcke und Fritz Vilmar – sehen in der Art des Anschlusses der DDR sogar Elemente einer „Kolonisierung“. Und in der Tat konnten sich auch jeder Sympathie mit dem ehemaligen sozialistischen Staat unverdächtige Zeitgenossen wie der Ex-Treuhandchef Detlev Rohwedder dieses Eindrucks nicht erwehren: „Manche westdeutschen Unternehmen benehmen sich wie Kolonialoffiziere“, konstatierte der wenig später ermordete Chef-Privatisierer.

Ob man den Begriff „Kolonialisierung“ verwenden will oder nicht, der Anschluss zerstörte in vieler Hinsicht ein gesellschaftliches Gefüge. Es gibt wenige ostdeutsche Familien, und zwar unabhängig von ihrer Stellung zur SED, für die die „Wende“ nicht auch einen krassen Bruch ihrer persönlichen Lebensgeschichte bedeutete. Westdeutsche Professoren fluteten ostdeutsche Universitäten, westdeutsche Manager die Betriebe, westdeutsche Politiker die Parteienlandschaft. Die Folgen dieses Prozesses prägen Ostdeutschland bis heute. Lohnunterschiede, die Besetzung von Leitungspositionen mit Westdeutschen, die Repräsentanz in Politik und Kultur bleiben ungleich zwischen Ost und West. Zehnmal mehr Menschen „pendeln“ vom Osten in den Westen zur Arbeit als umgekehrt.

Die fortbestehende Diskriminierung und Erniedrigung von Ostdeutschen sowie die eigenständige Geschichte in einem – nun verschwundenen – Staat führt dazu, dass es so etwas wie eine eigenständige ostdeutsche Identität gibt.

Und hier kommt die Linke ins Spiel: Wir – insbesondere als westdeutsche ausserparlamentarische Linke – verstehen diese Identität nicht, wir respektieren sie zu wenig und wir versuchen viel zu wenig, ihre progressiven Elemente zu bestärken. Dafür wäre eine Voraussetzung, eine eigenständige Einschätzung dessen zu gewinnen, was sich in diesem Teil Deutschlands denn eigentlich vollzogen hat. Doch grosse Teile der radikalen Linken sehen den ostdeutschen Staat und die Wende durch die Brille der bürgerlichen Geschichtsschreibung.

Bodman-Ludwigshafen - Ludwigshafen - Hafenstraße - Ludwigs Erbe r 11 (Ackermann) ies.jpg

Dabei wäre eine eigenständige Perspektive – jenseits von kritiklosem Abfeiern auf der einen, massloser Diabolisierung auf der anderen Seite – bitter nötig. Denn eine Prämisse sollte klar sein: die DDR gehört – mit allen ihren Fehlern – zur eigenen Geschichte der sozialistischen Bewegung. Die BRD, dieser aus Ex-Nazis aufgebaute, kapitalistische Staat mit Westbindung nicht. Und genauso wie die DDR gehört die Demokratisierungsbewegung an ihrem Ende zur selben Geschichte demokratischer Aufbrüche. Auch deren Erfolge wie ihr Scheitern – angetreten als Versuch, die Verknöcherung aufzubrechen, geendet in einem Deutschland aus Kohl, Krieg, Kapitalismus und Nationalismus – lohnt es sich jenseits der bürgerlichen Mythenbildung zu betrachten.

Denn einerseits lernt man nichts aus den Fehlern eines Sozialismusversuchs, wenn man sich einfach nicht mehr mit ihm auseinandersetzt, weil einem irgendwelche bürgerliche Experten ja ohnehin schon erklärt haben, dass es da gar nichts zu lernen gibt. Und zum anderen lässt sich ohne historisches Verständnis der DDR, der Demokratiebewegung an ihrem Ende und ihrer beider Abwicklung durch den Westen auch heute im Osten keine politische Strategie entwickeln, die in der Lage wäre dort gesellschaftliche Hegemonie nach links zu verschieben.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

———————————————————————–

Grafikquelle        :

Oben          —       Graffiti on the train line leading to Centraal Station in Amsterdam. Photo by Gary Mark Smith. ( Freiheit lebt, wenn der Staat stirbt.)

Author

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————

2.) von Oben        —      Relief Ludwigs Erbe by Peter Lenk, close to Zollhaus and tourist information, Hafenstraße 5, Ludwigshafen am Bodensee, Bodman-Ludwigshafen in Germany: Right-hand part of the triptych: Josef Ackermann

Abgelegt unter Deutschland, Kultur, Regierung, Schicksale | Keine Kommentare »

Die LINKE in Thüringen

Erstellt von DL-Redaktion am 16. November 2019

Für ein sozialistisches Regierungsprogramm der LINKEN in Thüringen

Quelle       :     AKL

Beschluss der AKL Berlin vom 14.11.2019

Angesichts des Wahlergebnisses in Thüringen, aus dem DIE LINKE als stärkste Partei hervorgeht, fordern wir Bodo Ramelow und DIE LINKE-Fraktion in Thüringen auf, keine Koalition oder Tolerierungsabkommen mit der CDU oder anderen im thüringischen Landtag vertretenen Parteien einzugehen. Stattdessen sollte DIE LINKE jetzt das Wahlergebnis zum Anlass nehmen, ein sozialistisches Regierungsprogramm zu verabschieden, dessen Umsetzung einerseits die Lebensbedingungen in Thüringen verbessert und andererseits aufzeigt, dass sich DIE LINKE von allen anderen Parteien unterscheidet. Dieses Programm kann nicht im Bündnis mit bürgerlichen Parteien umgesetzt werden, sondern nur im Bündnis mit der arbeitenden und erwerbslosen Bevölkerung und den Gewerkschaften und sozialen Bewegungen.

Da laut Landesrecht der jetzige Ministerpräsident im Amt bleibt, solange keine neue Regierung gebildet ist, sollte DIE LINKE jetzt die Chance nutzen, als Minderheitsregierung Maßnahmen zur Abstimmung zu stellen wie zum Beispiel: Einführung eines kostenlosen ÖPNV und massiver Ausbau des Schienenverkehrs in Stadt und Land; Beschlagnahmung von spekulativem leerstehendem Wohnraum, Enteignung von Immobilienkonzernen unter demokratischer Kontrolle und Verwaltung, Mietsenkung und Deckelung der Mieten auf Kostenmiete, Bau von kommunalen Wohnungen; Einführung der 35-Stundenwoche bei vollem Lohn- und Personalausgleich im öffentlichen Dienst als Einstieg in weitere Arbeitszeitverkürzung; Rekommunalisierung und massiver Stellenaufbau in Krankenhäusern, Verkehrsbetrieben sowie allen Bereichen der Daseinsvorsorge unter demokratischer Kontrolle und Verwaltung durch demokratisch gewählte Räte von Beschäftigten, Nutzer*innen, Gewerkschaften und Landesvertreter*innen; Unternehmen, die mit Entlassungen oder Kürzungen drohen, in Landeseigentum unter demokratischer Kontrolle und Verwaltung zu überführen; das Nutzen aller Möglichkeiten von Besteuerung der Reichen und Gewinne durch das Land und die Kommunen; massive Investitionen in Infrastruktur und Soziales; Abschaffung aller Gebühren und Kosten im Bildungswesen, Aufsetzen eines Programms zur vollständigen Deckung offener Stellen in den Schulen, Auflösung des Landesamtes für Verfassungsschutz und Einsetzung eines unabhängigen NSU-Untersuchungsausschusses unter Beteiligung von antirassistischen Organisationen, Migrant*innenverbänden und Gewerkschaften.

Für die Durchsetzung und Verteidigung dieser Maßnahmen muss DIE LINKE die arbeitende und erwerbslose Bevölkerung demokratisch einbeziehen. Dazu sollte eine Informationskampagne einschließlich Massenversammlungen durchgeführt werden, die die Basis für Demonstrationen und Streiks in Thüringen und bundesweit sein können. Es darf der LINKEN dabei nicht um Stellvertreter*innenpolitik gehen: Alle diese Maßnahmen aus dem Parlament heraus müssen zu einer Selbstermächtigung derer führen, die vom Kapitalismus ausgestoßen und erniedrigt sind. Die Enteignung der großen Mehrheit der Menschen muss beendet werden – dazu bedarf es der Rückaneignung von dem, was den Menschen unter dem Stichwort „Sachzwänge“ Jahrzehnte lang genommen wurde: Geld, Perspektiven, Würde, Gerechtigkeit. Eine Politik im Sinne dieser Rückaneignung würde auch die Erfolge der AfD unter Arbeiter*innen und Jugendlichen untergraben, welche diese mit rechtspopulistischer Politik, Rassismus und Nationalismus in die Irre führt. Ein solches Programm könnte der LINKEN bundesweit Unterstützung bei denjenigen sichern, die nach einer Alternative Ausschau halten. So wäre garantiert, dass dieser Wahlerfolg keine Eintagsfliege, sondern einen Schritt auf dem Weg der LINKEN zu einer sozialistischen Massenpartei markiert.

akl - Antikapitalistische Linke

————————————————————————–

Grafikquelle         :            –Blogsport

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | 3 Kommentare »

Alkoholverbot an Bahnhöfen

Erstellt von DL-Redaktion am 15. November 2019

Zweifel an Wirksamkeit eines Alkoholverbots am Bahnhof

Ravensburg Bahnhof 2011.jpg

Von Ben Heisch

In der Diskussion über ein Alkoholverbot am Ravensburger Bahnhof häufen sich Beschwerden der Passanten bei der Stadtverwaltung. Auch die Polizei berichtet immer wieder von Konflikten der Betrunkenen und Drogenkonsumenten. SZ-Mitarbeiter Ben Heisch hat sich am Bahnhof bei Passanten umgehört. Zwar sprechen sich viele Bahnreisende für ein Alkoholverbot am Bahnhof aus, bezweifeln aber, dass ein Verbot durchzusetzen wäre.

Ein älteres Ehepaar, das für eine Zugfahrt an den Ravensburger Bahnhof gekommen ist, findet es in Ordnung, Alkohol am Bahnhof zu trinken – solange die Trinker niemanden stören. Außerdem waren sich die Ehepartner einig, dass die Idee, mutmaßlich alkoholabhängigen Menschen das Trinken in der Öffentlichkeit zu verbieten, nicht umsetzbar wäre.

Junge Frau stört sich abends an Betrunkenen

Quelle     :       schwäbische-Ravensbur           >>>>>         weiterlesen

Zu Obigen Artikel erhielten wir folgende Zuschrift

Kommentar von Stefan Weinert zum Bericht der „Schwäbischen“ :

da muss ich doch erst einmal an die Diskussion um ein mögliches Verbot von alkoholischen Getränken an der „blauen Tanke“ (Südstadt) nach 22 Uhr erinnern … Daraus wurde nichts. Wie hat sich die Situation da eigentlich entwickelt? Bitte liebe SZ, berichte mal. – 

Was den Bahnhof anbetrifft, bin ich wohl immer zur falschen Zeit mit der BOB nach FN gefahren. Habe nie irgendwelche Promille-Sünder gesehen … aber selbst wenn: Ein Verbot verlagert das Problem lediglich, löst es aber nicht. (Alte Stadtindianer-Weisheit) Eine andere Weisheit besagt: Was Akademiker, Stadträte, Großkopferte und Honorige und andere Krawattenhalter hinter verschlossenen Türen und opaken, getönten Scheiben saufen, tun die „Penner“ und „Nichtsnutze“ öffentlich. Und das weiß auch (fast) jeder. Abgesehen natürlich vom „Rutenfest“, wo das „öffentliche Besäufnis für alle“ von oben abgesegnet ist und diese Tradition dem „Narrensamen“ mit der Muttermilch eingeflößt wird. 

Das alles ist eine ziemliche Heuchelei. Ein „Nichtsnutz“ kann sich nun mal ein Kneipenbier (die Halbe für 3,30 €; auch in der „Räuberhöhle“) und einen Schnaps (2 cl = 2,50 €) nicht leisten. Für den Preis (plus Trinkgeld) bekommt er im Supermarkt eine ganze Kiste „Oettinger“ oder 1 Liter Wodka. Und da nun auch mal der „Nichtsnutz“ ein soziales Wesen ist (!!), sucht er sich seine „Kneipe“, wo er nicht alleine ist und alleine trinken muss. Erfährt man alles, wenn man sich mit den „Pennern“ auf  Augenhöhe unterhält.#

Ravensburg Rutenfest 2005 Festzug Burg Ravensburg.jpg

Die verlorene Ehre des  Landraubenden Adel wurde doch lange von  Hochstapelnden Politikern – Innen übernommen !

Bereits vor 15 Jahren schrieb ich in einem Leserbrief zum Thema „Säufer am Grünen Turm“, dass jene, die wir gerne „Penner“ nennen, das Spiegelbild unserer angeblich „heilen“ Gesellschaft sind. Weder Streetworker noch das Verbot helfen wirklich, sondern die Veränderung der Gesellschaft insgesamt ist die beste und auch kostengünstigste Lösung. Dazu gehört an erster Stelle, endlich damit aufzuhören, pharisäerhaft auf die öffentlichen Trinker einzuschlagen. Denn wer mit einem Finger auf den „Sünder zeigt“, zeigt gleichzeitig mit den restlichen Fingern auf sich selbst. Und welche die nächsten Schritte sein sollten/könnten … dürfte jedem klar sein.

Ach ja – als Theologe erlaube ich mir, einen der wichtigsten Sätze aus der Bibel in den Kontext der Moderne und in das Ravensburg im 21. Jahrhundert  zu übertragen: WER VON EUCH OHNE BIER IST, DER WERFE DIE ERSTE FLASCHE. Blasphemie? Mitnichten! Bevor Jesus auf der berühmt gewordenen Hochzeit zu Kana 600 Liter (!) Quellwasser in den besten Wein verwandelte, waren die Hochzeitsgäste bereits „trunken“ (nachzulesen in Johannes Kapitel 2 ab Vers 1 und folgende). Selbst wenn diese Geschichte nur eine symbolische Geschichte a la Bultmann sein sollte – wer wir sie heute wohl wie interpretieren ..?

MfG, Stefan Weinert, Ravensburg

——————————————————————

Grafikquellen        :

Oben       —      Ravensburg, Bahnhof (westliche Seite)

 

 

Abgelegt unter Baden-Württemberg, Feuilleton, Kultur, Überregional | Keine Kommentare »

Thüringer Regierung

Erstellt von DL-Redaktion am 15. November 2019

Thüringen – Minderheitsregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–09.jpg

Von Tom Strohschneider

Minderheitsregierung, das klingt erst mal doof. Dabei bietet sie viele Chancen.

Vor ein paar Tagen sorgte eine Meldung auf Twitter für Aufsehen: „CDU führte konkrete Gespräche mit der AfD“, so die Schlagzeile. Und das, so las man weiter, obwohl CDU-Fraktionschef Mike Mohring „zuvor jede Kooperation ausgeschlossen hatte“. Passiert da etwas Heimliches, Ungeheuerliches hinter den Kulissen der Erfurter Nachwahlpolitik? Eine Kooperation mit den Rechtsradikalen gegen Rot-Rot-Grün? Einige Politiker und Journalisten verbreiteten die irritierende Kunde weiter. Bis es jemandem auffiel: Die Meldung ist von 2014. Ein Kollege schrieb: „Geschichte wiederholt sich hoffentlich nicht.“

Was hätte sein können

Es gibt das berühmte Diktum von Karl Marx, dass so etwas eben doch passiert, „das eine Mal als Tragödie, das andere Mal als Farce“. Aber was, wenn es nach der Landtagswahl anders gekommen wäre, nur ein kleines bisschen anders, aber mit großen Wirkungen?

Vielleicht so: Es ist der 28. Oktober 2019, Mike Mohring macht sich am frühen Montagmorgen auf den Weg ins Fernsehstudio, eine schwere CDU-Klatsche im Nacken, unklare Mehrheitsverhältnisse, die Frage einer Kooperation mit der Linkspartei liegt wie ein zwei Tonnen schwerer Stein auf dem Tisch, man kann ihn nicht mal eben mit dem Handrücken wegfegen. „Die CDU in Thüringen ist bereit für Verantwortung, wie auch immer die aussehen kann und sollte“, sagt Mohring. „Deswegen muss man bereit sein, nach diesem Wahlergebnis auch Gespräche zu führen. Ohne was auszuschließen.“ Im Übrigen liege die Hoheit für den weiteren Erfurter Weg „alleine in Thüringen“.

Danach fährt Mohring in die CDU-Bundeszentrale, die Gremien tagen, zerknirschte Gesichter ob des Wahlausgangs – aber der Geist von Altmeister Bernhard Vogel ist in allen Köpfen: Man könne sich doch „Gesprächen nicht versagen“, keine Koalition mit der Linkspartei, das ist klar, aber daneben geht ja auch was. Auch die Thüringer Wirtschaft sieht das so: „Neue Situationen erfordern neue Maßnahmen“, heißt es vom Unternehmensverband. In der CDU-Bundeszentrale stimmt man zu, es wird eine Sprachregelung gesucht, Mohring bekommt sein Mandat. Nur eines nicht: irgendwelche Offenheit zur AfD zeigen. Und Mohring weiß auch: Selbst wenn er so denken würde, sollte er in dieser Runde nie und nimmer Sätze sagen wie: „Ramelow ist inhaltlich leer. Und wir werden als Union alles mit ihm machen können.“

Denn natürlich haben auch die Gegner der „neuen Maßnahmen“ Ohren, SMS-fähige Telefone und sie wissen, an wen sie sich wenden müssen. In der Bild-Zeitung wetzen sie ohnehin schon die Tastaturen, ein Gespräch mit Mohring wird als „Verhör“ verkauft, die alte Leier: Eine Zusammenarbeit mit der Linkspartei sei Verrat der CDU an einem „ihrer letzten heiligen Werte“, der „Markenkern der Partei der Wiedervereinigung“ sei bedroht. Doch Mohring bleibt aufrecht, die CDU bleibt es fast ausnahmslos auch, keine Heckenschützen, kein verbales Störfeuer.

Eine neue Situation erfordert auch neues Verhalten. Hier wird es geliefert. Zumal alle wissen: Wer jetzt gegen Gespräche mit der Linkspartei auftritt, macht jene lauten Minderheiten stark, die am liebsten über die Brandmauer zur AfD hinüberklettern wollten. Ortsfunktionäre aus der vierten Reihe. Ein paar Anhänger der Werte-Union, die von der Frankfurter Allgemeinen Zeitung als „eine kleine Gruppe am rechten Rand der CDU“ beschrieben wird. Auch ein früherer Verfassungsschutzpräsident treibt dort gern sein Wesen.

Aber die CDU im ganzen bleibt stabil. Der Generalsekretär der CDU wehrt einen Vorstoß von der Vorgestern-Fraktion ab, die ihn zu einem Gastbeitrag gegen die Linkspartei drängen wollen. Stattdessen gibt Paul Ziemiak einen Text heraus, in dem er CDU und AfD „wie Feuer und Wasser“ nennt, eine Zusammenarbeit wäre „Verrat an der Christdemokratie“. Mohring sieht sich bestätigt und unterstützt, er nimmt das vertrauliche Angebot von Bodo Ramelow ganz vertraulich an. SMS werden ausgetauscht, aber nicht weitererzählt. Es wird jetzt eine Weile dauern, das wissen alle Beteiligten. Und es wird kompliziert. Der Erfurter Weg ist eine ziemlich steinige und steile Straße.

Mohring wird tags darauf natürlich auf seine Kanäle zu Ramelow angesprochen. Er reißt sich am Riemen: „Private Kommunikation ist aus gutem Grund vertraulich.“ Als sich der Moderator einer Talkshow später nachfragend an ihn heranlanzt, lächelt der CDU-Politiker bloß. Er denkt an das Bild-Interview, Schweigen ist in dieser Situation eine „Frage des Anstands“.

2019-10-27 Wahlabend Thüringen by Sandro Halank–83.jpg

Apropos Anstand, dass das Blatt das Gespräch zum „Verhör“ erklärt hat, wurmt Mohring. Ein Bonmot von Max Goldt kommt ihm in den Sinn: „Diese Zeitung ist ein Organ der Niedertracht.“ Auch dagegen muss man nun aufrecht bleiben. Drei Tage ist die Wahl erst her, der junge CDU-Fraktionschef blickt in eine ungewisse aber auch spannende Zukunft. Ja, eine neue Situation ist das. Thüringen, die politische Landschaft, CDU und Linkspartei – er erinnert sich an den Morgan am Tag nach der Wahl, an seine Worte: „Ruhe und Besonnenheit“.

Was wirklich war

Hätte, hätte, Fahrradkette – die ersten drei Tage nach der Wahl sind in Wahrheit anders verlaufen. Die Lage ist dadurch nicht einfacher geworden, sondern komplizierter. Mike Mohring hat daran großen Anteil, taktisch unsicher, strategisch unvorbereitet, machtpolitisch ungeschickt. Hat er mit dieser Lage etwa nicht gerechnet? In der Talkshow, in der er in Wahrheit auch die Vertraulichkeit Ramelows herumplappernd brach, sagt Mohring: Es sei ein Wahlergebnis „mit dem man nicht rechnen konnte. Vielleicht wollte ich auch nicht damit rechnen.“ Markus Lanz darauf: „Aber damit musste man doch rechnen.“ Mohring: „Klar, konnte man.“

Konnte? Und doch lässt sich die verfahrene Kiste nicht allein auf Mohring schieben. Sein Versuch, unmittelbar nach der Wahl die Tür zur Linken entgegen vorheriger Absagen ein kleines bisschen offenzuhalten, ist vor allem von Politikern der Union vereitelt worden, die Thüringen nur zum Spielball ihrer eigenen Machtlogiken gemacht haben.

Die Mohring-Debatte in der CDU war nicht zuletzt eine um den Kopf der Vorsitzenden Annegret Kramp-Karrenbauer und gegen den Einfluss Angela Merkels. Nicht wenige haben nach dem Motto „Mohring schlagen, AKK und Merkel treffen“ agiert und dabei, man musste das ahnen können, jene angefeuert, die tatsächlich mit Rechtsradikalen reden wollen. Wie ein ausgerollter brauner Teppich für die, die glauben, man müsse die CDU noch weiter nach rechts abbiegen lassen.

Quelle         :     Der Freitag          >>>>>         weiterlesen

——————————————————————-

Grafikquellen              :

Oben       —           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Synode Dresden: Missbrauch

Erstellt von DL-Redaktion am 14. November 2019

im Evangelischen Kirchenbezirk Ravensburg ?

Bavendorf Ev Kirche 2011b.jpg

Offener Brief von Stefan Weinert an Herrn Dekan Dr. Friedrich Langsam

Sehr geehrter Herr Dekan Dr. Langsam,

sehr geehrte Damen und Herren im Ravensburger

Evangelischen Gesamtgemeinderat,

auf dem Hintergrund der aktuell stattfindenden EKD-Synode in Dresden und der Tatsache, dass es auch aus dem Kirchenbezirk Ravensburg Bewerber/innen für das zukünftige Amt einer/s Synodalen gibt und unter der Prämisse einer schonungslosen Aufarbeitung hätte ich gerne von Ihnen gewusst, ob es auch im Dekanat Ravensburg, Fälle von sexuellen Übergriffen von Pfarrern, Pastoren, Diakonen, Jugendmitarbeitern, Kirchenmusikern oder Ehrenamtlichen gegenüber ihnen anvertrauten Mädchen, Buben und Erwachsenen gab und gibt. Zwar bin ich kein Mitglied der Evangelischen  Kirche und ich frage auch nicht als Christ, der ich zwar bin, sondern als Mitglied der Gesellschaft, die auch die Evangelische Kirche erheblich finanziert. Es kann und darf nicht nur eine gewisse Transparenz in Dresden geben, sondern sie muss in jeder Kirchengemeinde beginnen. Zudem hätte ich gerne von Ihnen gewusst, wie Sie zu dem Thema „Entschädigung“ stehen. Bitte verzichten Sie bei einer etwaigen Antwort auf  Allgemeinplätze und Verweise nach Oben. Danke.
Denn eigentlich – so die Idee ihres Gründers – sollte die Kirche eine für den, durch den Alltag gebeutelten Menschen, entlastende lebendige Bewegung sein. „Einer trage des anderen Last,“ betont deshalb auch der zum Paulus gewordene frühere Christenverfolger, und fährt fort: „So erfüllt ihr das Gesetz Christi.“ Doch die Kirche – und seit 502 Jahren, die Kirchen – sind für die Gesellschaft ganz im Gegenteil  – wie einst Bruno – zum „Problembär“ geworden. Bereits vor einem Jahr (2018), auf der EKD-Synode in Hannover, sagte die Hamburger Bischöfin Kirsten Fehrs: Eine Kirche, die solcher Gewalt nicht wehrt, ist keine Kirche mehr“.
 
Damals berichtete die Bischöfin von Johanna (15) , die ihr berichtete, wie alles anfing. Sie (Johanna) fand es eklig, als der Pastor sie das erste Mal überfallartig küsste und an die Brust fasste.Ein Fall von sexuellem Missbrauch, ein Teil einer Serie in Ahrensburg, einer Kleinstadt nördlich von Hamburg. Die evangelische Kirche habe, so Fehrs, aufgrund ihres  Systems ganz spezifische Risikofaktoren. Sexualisierte Gewalt werde an Kindern und Jugendlichen gegangen, aber auch an Erwachsenen in Beratungsszenarien und Abhängigkeitsverhältnissen. Die Täter seien Pastoren, aber auch Jugendmitarbeiter, Kirchenmusiker oder Ehrenamtliche. Gerade weil in der evangelischen Kirche so viele Berufsgruppen und auch Ehrenamtliche Verantwortung gegenüber Kindern und Jugendlichen trügen, müsse man sie alle in den Blick nehmen. Dazu kämen die vereinsartigen Strukturen der evangelischen Kirche: Oft sei es unklar, wer für was zuständig ist, und weil jeder jeden kenne, rede man nicht öffentlich über die Taten. Es gebe unreflektierte Vermischung von Privaten und Dienstlichem und Einrichtungen, die als „Closed Shops“ geführt würden.
Kerstin Claus ist die erste Betroffene von sexuellem Missbrauch, die vor der aktuell stattfindenden EKD-Synode in Dresden spricht. Die heutige Journalistin, Kerstin Claus, wurde als Jugendliche von ihrem evangelischen Gemeindepfarrer über längere Zeit missbraucht.
 Vor einem Jahr in Würzburg hatte die Synode einen Elf-Punkte-Plan beschlossen. Insgesamt sind der evangelischen Kirche mittlerweile 770 Missbrauchsopfer bekannt. 60 Prozent davon betreffen Fälle aus dem Bereich der Diakonie. 40 Prozent ereigneten sich in Kirchengemeinden. 
 
Einen offenen Dissens gibt es zwischen der EKD und den Betroffenen über die Frage, ob Entschädigungen gezahlt werden sollen. Ein Mitglied des Beauftragtenrats betont, dass die in der katholischen Kirche genannten Entschädigungssummen zwangsläufig zu Auseinandersetzungen über die Beweisbarkeit von Sachverhalten führen könnten, also genau zu den Verfahren, die die Betroffenen über lange Zeit stark belasten und retraumatisieren würden. Bischof Bedford-Strohm sogar meint, sexueller Missbrauch sei ein solch schlimmes Vergehen, dass es mit Geld nicht wieder gut zu machen sei. Anders als es die katholische Kirche seit Jahren tut, wolle die evangelische Kirche keine pauschalen Summen an Opfer zahlen, hatte selbige Bischöfin Fehrs zuvor betont. Wie Claus sagte, gehe es nicht darum, dass die Kirche sich freikaufe. Nötig sei ein lebenslanges Bemühen, den Opfern gerecht zu werden. 
 
Das ist blanker Zynismus und auch Kerstin Claus sieht das anders. Ihr und den Opfern gingen die Schritte der Kirche nicht weit genug. Die evangelische Kirche habe lange gezögert, ehe sie die Missbrauchsproblematik erst 2018 offensiv angegangen habe. Nun müsse die Kirche die Bedürfnisse der Betroffenen in den Mittelpunkt rücken, es sei eine transparente Entschädigungsregelung nötig.Sie meint, sexueller Missbrauch habe vielfältige biografische Folgen. Auch deswegen müsse es solch eine Debatte geben. Vor allem aber ruft die Betroffene die evangelische Kirche zu einem Mentalitätswechsel auf. „Sie und ihre Kirche haben noch immer keine klare Haltung gefunden, was den Umgang mit uns Betroffenen angeht“, sagte Claus vor der Synode und fuhr fort: „Sie werden Ihre Deutungshoheit aufgeben müssen.“ Und dann meldet Claus auch ganz konkrete weitere wichtige Forderungen an: „Täter dürfen nicht weiter im Verkündigungsdienst der Kirche stehen.“
 
Für eine erhellende, transparente und zeitnahe Information wäre ich dankbar.
 
Mit freundlichen Grüßen,
 
Stefan Weinert
———————————————————————
Grafikquellen         :

Oben       —           Evangelischer Friedhof Bavendorf (Ortschaft Taldorf, Stadt Ravensburg) mit der evangelischen Kirche

Abgelegt unter Baden-Württemberg, Kommunalpolitik, Kultur, Religionen | Keine Kommentare »

Digitale-Versorgung-Gesetz

Erstellt von DL-Redaktion am 13. November 2019

Bundestag beschließt Gesundheitsdatenbank und Apps auf Rezept

Zeichnung: Jens Spahn sagt "Hartz 4 bedeutet nicht Armut"; in seiner Hand ein Bündel Scheine (Monatsgehalt), im Hintergrund sind Dienstwagen und freies Zugfahren angedeutet.

Quelle       :         Netzpolitik  ORG

Von

Der Bundestag hat das umstrittene Gesundheitsgesetz heute verabschiedet. Damit ist der Weg frei für eine zentrale Gesundheitsdatenbank. Gesundheitsminister Spahn sprach von „einem Stück Neuland“, Kritiker sehen Datenschutzmängel.

Mit der Mehrheit von CDU/CSU und SPD hat der Bundestag heute das Digitale-Versorgung-Gesetz gebilligt. AfD und FDP enthielten sich, Grüne und Linke stimmten dagegen. Das Gesetz schafft unter anderem eine zentrale Forschungsdatenbank mit Daten aller gesetzlich Versicherten und die Möglichkeit zur ärztlichen Verschreibung von Gesundheitsapps. Außerdem ebnet es den Weg zur Elektronischen Patientenakte. Netzpolitik.org hatte in dieser Woche detailliert über die Gesetzespläne berichtet und sieben Gefahren des Gesetzes zusammengefasst.

In der Bundestagsdebatte lobte der CDU-Politiker Roy Kühne das Gesetz. „Datenschutz ist für mich immens wichtig, darf aber nicht im Wege stehen“, sagte er. Dirk Heidenblut (SPD) verwies auf „enorme Chancen in dieser Digitalisierung des Gesundheitswesens“ für Patient:innen. Den Datenschutz habe man penibel beachtet. Christine Aschenberg-Dugnus (FDP) kritisierte mangelnden Datenschutz bei der Übermittlung der Versichertendaten an das geplante Datenzentrum. Auch Achim Kessler (Linke) äußerte Kritik am mangelnden Datenschutz. Er befürchtet, dass die Gesundheitsdaten auch an Wirtschaftsakteure weitergegeben werden könnten. Die Regelungen zu Apps seien ein „riesiges Förderprogramm für die IT-Wirtschaft“.

Maria Klein-Schmeink von den Grünen kritisierte den CDU-Gesundheitsminister Jens Spahn. Es fehle eine klarere strategische Richtung in der Gesundheitspolitik. Der Minister selbst sprach von „einem Stück Neuland“. Es werde bestimmt nicht alles perfekt sein, „aber vielleicht sollten wir mal endlich anfangen, auch digitale Innovationen möglich zu machen“. Und das tue man jetzt.

Kaum Möglichkeiten, das Gesetz noch zu verhindern

Das Gesetz ist nicht zustimmungspflichtig durch den Bundesrat. Dieser kann zwar den Vermittlungsausschuss anrufen und Einspruch gegen das Gesetz einlegen, doch der Einspruch kann durch die gleiche einfache Mehrheit im Bundestag überstimmt werden. Bisher zeichnet sich nicht ab, dass der Bundesrat den Vermittlungsausschuss einberufen wird. In seiner Stellungnahme im September hatten die Länder jedoch einige Kritikpunkte am Gesetz aufgeführt.

Gibt es keinen Einspruch, tritt das Gesetz mit seiner baldigen Verkündung im Bundesgesetzblatt zu weiten Teilen in Kraft. Einige Details, zum Beispiel, wie die Gesundheitsdaten pseudonymisiert und wie sie an das Forschungszentrum übermittelt werden, müssen allerdings noch von der Verwaltung geklärt werden. Ein weiteres Gesetz soll schließlich noch offene Datenschutzfragen rund um die elektronische Patientenakte klären.

Lizenz: Die von uns verfassten Inhalte stehen, soweit nicht anders vermerkt, unter der Lizenz Creative Commons BY-NC-SA 4.0.

———————————————————–

Grafikquelle         :           Twitter    –  Darth Wutze (@HuWutze)     Wikimedia – Commons

Abgelegt unter Deutschland, Gesundheitspolitik, P.CDU / CSU, Regierung | Keine Kommentare »

Das Fanal von Halle:

Erstellt von DL-Redaktion am 13. November 2019

Der neue, alte Antisemitismus

File:MKBler - 393 - Synagogen-Mahnmal (Halle).jpg

von Christian Bangel

Mit den Morden von Halle hat der Judenhass in Deutschland ein neues Fanal gesetzt. Nun kann man hoffen, dass die Tat Wirkung zeigt, dass sie so etwas wie eine Selbstüberprüfung der gesellschaftlichen Mitte auslöst. Doch bisher deutet wenig darauf hin. Stattdessen machte nach den Verbrechen erneut das sedierende Wort vom Einzeltäter die Runde, suchte der Innenminister nach Gründen für die Taten in der Gamingszene.

Doch so viel ist sicher: Stephan B. ist ein Rechtsextremer, und dass er wahrscheinlich allein handelte, darf nicht verschleiern, dass er Erzählungen benutzte, die auch von Rechtspopulisten in Talkshows vorgetragen werden.

Kurz bevor der Mörder sich aufmachte, seine widerwärtigen Phantasien in die Tat umzusetzen, wandte er sich in einem Video an eine globale Blase von Neonazis, Rechtsextremisten und Antisemiten und sagte etwas, das so dumm und hasserfüllt wie bedeutend ist. Er leugnete in dem kurzen Video erst den Holocaust, dann sprach er vom Feminismus, der der Grund für niedrige Geburtenraten im Westen sei, was wiederum zu Massenimmigration führe. Und erklärte, dass „der Jude“ der Grund für all das sei.

Zu wem genau sprach er da? Das Video zeigt, dass B., der zum Teil auf Englisch spricht, offenbar einerseits einer weltweiten, in Foren organisierten Community von Rechtsextremen imponieren wollte. Leuten, die sich in einem Kampf gegen den Islam und die Juden sehen und deren Helden rassistische Mörder wie Breivik und die Täter von Charlottesville und Christchurch sind. Beunruhigend genug. Doch da ist noch mehr. B. versuchte in dem Video nicht nur, Neonazis zu gefallen. Bemerkenswert ist das direkte Nebeneinander seines Antisemitismus mit Thesen, die heute auch innerhalb der AfD-Anhängerschaft weit verbreitet sind. Thesen, die in abgeschwächter Form auch manche, die sich konservativ nennen, in Talkshows vortragen. Der Judenhass des Täters wird in einen direkten Zusammenhang gebracht mit den Narrativen von „Genderwahn“ und „Bevölkerungsaustausch“.

Auch wenn jeder Rechte bei Verstand und nicht zuletzt die AfD sich umgehend so weit möglich von dem Täter distanzierten, so meinte dieser doch offenbar, auch im Sinne jener zu handeln, die daran glauben, dass Angela Merkel und die linken Eliten einen groß angelegten und perfiden Plan verfolgen, die deutsche Bevölkerung auszutauschen. Natürlich kann man als Rechtspopulist behaupten, man habe damit nichts zu tun. Aber der Mörder von Halle benutzt ihre Argumente, er benutzt ihre Worte und ihre Erzählungen.

Nun sind die Neuen Rechten nicht mehr die Neonazis von früher. Sie haben in Deutschland den Durchbruch geschafft, als sie sich konzeptionell vom Nationalsozialismus trennten. Isolierten sich Rechtsradikale früher durch ihre Hitlerei regelmäßig selbst, so lassen sie heute kaum eine Gelegenheit verstreichen, sich von Nationalsozialismus und Antisemitismus zu distanzieren. Wenngleich sie hin und wieder mit Ein- oder Zweideutigkeiten dem faschistischen Teil ihrer Wählerinnen und Wähler zuzwinkern, versuchen sie mit wachsendem Erfolg, sich sogar als die wahren Verteidiger der Juden aufzuspielen. Die Figur, die es dafür brauchte, war der pathologisch antisemitische Muslim. Mit ihm ließ sich die Verächtlichmachung des Islam prächtig hinter dem „Nie wieder!“ der Bundesrepublik verstecken. Wie stark diese Reinwaschung wirkt, kann man daran erkennen, dass die Behauptung, der wahre Antisemitismus sei inzwischen ein zugewanderter, auch in bürgerlichen Milieus wirkt. Der Beitrag von „Springer“-Chef Mathias Döpfner nach dem Anschlag – er schaffte es, den rechten und linken Antisemitismus unter anderem mit einem „einseitigen Verständnis für antisemitische Grundhaltungen mancher muslimischer Einwanderer“ zu begründen[1] – sagt da eigentlich alles.

Der Antisemitismus der AfD braucht keine Juden mehr

Dabei darf und sollte dieser Tage nicht verschwiegen werden, dass in Berlin erst fünf Tage vor dem Anschlag von Halle ein 23jähriger Syrer mit einem Messer in der Hand auf die Wachmänner vor einer Synagoge zulief. Der Judenhass aber wirkt längst wieder in allen Teilen der Gesellschaft. Der Versuch, ihn zu ethnisieren und ihn damit weit weg von der weißen deutschen Bevölkerung zu halten, hilft niemandem außer der AfD. Antisemitismus hat keine Hautfarbe und keine Religion, es gibt ihn unter Linken und unter Rechten, unter Arbeitslosen und unter Superreichen. Er ist die Geißel der menschlichen Zivilisation, seit Jahrtausenden. Doch es hat schon seinen Grund, warum der Zentralrat der Juden immer wieder besonders vor der AfD warnt, vor einem neu aufkeimenden Rassismus, der sich insbesondere gegen Muslime, aber auch gegen Juden richtet. Es ist derselbe Grund, warum auch die sicher nicht linke israelische Regierung jeden Kontakt zu den deutschen Rechtspopulisten verweigert.

HalleSynagoge 01.JPG

Ein Wesenszug des klassischen Antisemitismus liegt in der Bereitschaft, die Juden als eine kollektiv nach einem düsteren Plan handelnde Gruppe zu markieren. Sie als Fremdkörper zu betrachten, der innerhalb einer Gesellschaft seine eigenen Ziele verfolgt, der irgendwann unweigerlich den Niedergang seiner „Wirtsgesellschaft“ auslöse. Ein anderer ist die Beschreibung von Juden als wurzellose, wohlhabende Kosmopoliten, denen die Werte und Normen der Mehrheitsgesellschaft fremd seien.

Beide antisemitischen Erzählfiguren kommen zusammen, wenn die AfD und ihre Anhänger von der demographischen Katastrophe sprechen, die der linke Feminismus ausgelöst habe und die nun handstreichartig durch arabische Massenzuwanderung gelöst werde, unterstützt von linken Bildungsbürgern, die nichts von den Normen und Werten des Normalbürgers wüssten. Nicht viel anderes sagte ja auch der Täter von Halle, bevor er den Juden daran die Schuld gab. So unelegant gehen heutige Rechtspopulisten natürlich nicht vor. Sie überlassen es meist den Zuhörerinnen und Zuhörern, ihre Schlüsse zu ziehen. Der Antisemitismus der AfD braucht keine Juden mehr. Er braucht nur noch die antisemitischen Stereotype.

Doch es ist nicht nur die verbrecherische Tat von Halle, es sind auch kleinere Zeichen, die einen sorgen müssen. Die wachsende Zahl von Leuten beispielsweise, die meinen, Deutschland müsse einen Schlussstrich unter seine Vergangenheit ziehen oder, mit Björn Höcke, eben eine 180-Grad-Wende vollbringen. Die von einem Drittel der Deutschen geteilte Behauptung, die Juden würden den Holocaust zu ihrem Vorteil nutzen. Die völlig unproportionale Anzahl von Deutschen, die behaupten, ihre Vorfahren seien im Widerstand gewesen. All das sind Zeichen dafür, dass viele Deutsche aufgehört haben, sich aktiv mit dem antisemitischen Erbe zu befassen, das in die Katastrophe des Völkermordes an den Juden führte. Wenn sie es denn je getan haben. Stattdessen wird ein lächerlicher Begriff wie „Aufarbeitungsweltmeister“ zum Symbol dieser versteinernden Erinnerungskultur. Als sei die Bewältigung unserer Vergangenheit längst mit Bestnote abgeschlossen und jetzt etwas zum Angeben wie der Tiguan im Carport.

Quelle       :         Blätter           >>>>>        weiterlesen

———————————————————————-

Grafikquellen         :

Oben            —            Auf dem Jerusalemer Platz in Halle an der Saale befindet sich das Synagogen-Mahnmal. Von der 1870 gebauten Synagoge konnte nur das Portal, welches nun das Mahnmal darstellt, erhalten werden, während das sonstige Gebäude in der Reichspogromnacht von den Nationalsozialisten zerstört wurde.

MKBler (CC BY-SA 4.0)

————————

Unten          —        Synagoge in Halle (Saale), Jüdischer Friedhof, Humboldtstraße

Abgelegt unter Deutschland, Innere Sicherheit, Kultur, Sachsen-Anhalt | Keine Kommentare »

Oskars letzter Versuch ?

Erstellt von DL-Redaktion am 13. November 2019

Ganz, ganz viel zu tun

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Von Anna Lehmann

Amira Mohamed Ali wird Nachfolgerin von Sahra Wagenknecht. Das Erbe wird schwer. Denn die Fraktion ist nach der Wahl gespaltener denn je.

Es gab da dieses Bild, kurz nachdem Amira Mohamed Ali am Dienstagnachmittag gegen halb vier zur Fraktionschefin der Linken gewählt worden war. Sie stand im Clara-Zetkin-Saal der Linksfraktion im Reichstagsgebäude, umringt von zwei Herren: zum einen Co-Fraktionschef Dietmar Bartsch und zum anderen Diether Dehm, einst Vorsitzender ihres niedersächsischen Landesverbandes und bis heute einflussreicher Strippenzieher in der Partei. Mohamed Ali lächelte in eine Kamera, Dehm und Bartsch neben ihr reckten die Fäuste. Gewonnen!

Die Szene war eigentlich nicht für die Öffentlichkeit bestimmt, der Fraktionssprecher scheuchte Neugierige schnell wieder aus dem Saal. Diether Dehm veröffentlichte es dennoch auf Facebook. Danach gingen Mohamed Ali und Bartsch aus dem Raum und vor die Presse und sie stand im Rampenlicht. Das erste Mal so richtig, seitdem sie vor zwei Jahren in den Bundestag eingezogen war.

2017 war Mohamed Ali auf Platz 5 der niedersächsischen Landesliste und als fünfte Niedersächsin für die Linke gerade noch in den Bundestag gerutscht. Zwei Jahre später ist sie Fraktionschefin, Nachfolgerin der bekanntesten Linken-Politikerin Sahra Wagenknecht. Eine Traumkarriere als Politikerin. Oder doch eher ein Knochenjob als Trümmerfrau?

Wie tief die Fraktion nach dieser knappen Wahl mit zwei Wahlgängen gespalten ist, zeigte sich im weiteren Verlauf des Nachmittags. Caren Lay, die ihre Kandidatur für den Fraktionsvorsitz als Erste angekündigt hatte, hätte als erfahrenere und bekanntere Kandidatin eigentlich die besseren Karten haben müssen. Die Vizefraktionvorsitzende und mietenpolitische Sprecherin sitzt seit 2009 im Bundestag.

Der Frust entlädt sich

Mohamed Ali ist nun mit Unterstützung des sogenannten Hufeisens ins Amt gekommen, jenes machttaktischen Bündnisses aus Reformern und Partei-Linken, das vier Jahre lang eine knappe Fraktionsmehrheit gesichert hatte. Doch der Groll gegen diese Machtbündnis war in den letzten Jahren gewachsen. Nun bekamen die übrigen Kandidat:innen für den Fraktionsvorstand den geballten Frust über diesen knappen Wahlsieg und das Wirken des Hufeisens zu spüren.

Sahra Wagenknecht and Dietmar Bartsch. Hannover Parteitag 2017.jpg

Vom Winde verweht

Der erste parlamentarische Geschäftsführer Jan Korte erhielt nur 39 von 68 möglichen Ja-Stimmen. Und das, obwohl er im Bundestag souverän auftritt und ohne Gegenkandidat:in angetreten war. Von den sechs potenziellen Arbeitskreisleiter:innen, die sich auf sechs Stellen bewarben, fielen zwei im ersten Wahlgang durch, Fabio de Masi und Heike Hänsel. De Masi wurde im zweiten Anlauf gewählt, Hänsel fiel erneut durch. Bartsch wird drei Kreuze gemacht haben, dass er mit 64 Prozent in einem Rutsch zusammen mit Mohamed Ali gewählt wurde. In einem anderen Wahlprozedere wäre er wohl genauso abgestraft worden.

Quelle          :         TAZ         >>>>>          weiterlesen

Neue Fraktionsspitze der Linken

Der Verfeindungskomplex

DIE LINKE Bundesparteitag 10. Mai 2014-2.jpg

Kommentar von Stefan Reinecke

Politische und persönliche Fehden sind in der Linksfraktion eng verwoben. Genau das kann für die unverbrauchte Mohamed Ali eine Chance sein.

Amira Mohamed Ali, Muslimin und Juristin aus Hamburg, wird zusammen mit Dietmar Bartsch die Linksfraktion führen. Das ist eine erstaunliche Umkehrung des Prinzips demokratischer Elitenauswahl. Eigentlich wird an die Spitze gewählt, wer sich als besonders robust, vertrauenswürdig oder taktisch versiert erwiesen hat. Mohamed Ali ist eine sympathische, eher nachdenkliche denn agitatorische Parteilinke. Doch sie ist erst seit vier Jahren in der Partei und nicht nur in der Öffentlichkeit ein unbeschriebenes Blatt.

Auch in der Fraktion kann sich niemand an wegweisende Beiträge erinnern. Manche behaupten, sie solle Wagenknecht bloß den Sessel warm halten, bis die wieder Lust hat auf den Job. Gewissermaßen das Modell Putin/Medwedjew. Das ist eines jener bösartigen Gerüchte, die ziemlich typisch sind für die giftige Atmosphäre bei den GenossInnen. Die Wahrheit ist: Der linke Flügel hat schlicht niemand anderen gefunden.

Ein Sieg des Bündnisses von Reformern und linkem Flügel, von Bartsch und Wagenknecht gegen Caren Lay und Katja Kipping also? So sieht es aus. Aber die Sache ist komplexer. Die Grenzen zwischen den drei Lagern sind ausgefranst und überlagert von persönlichen Animositäten.

Quelle         :         TAZ         >>>>>          weiterlesen

——————————————————————-

Grafikquellen           :

Oben      —      Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Hamburg, P. DIE LINKE, Überregional | Keine Kommentare »

Die Linke Niedersachsen

Erstellt von DL-Redaktion am 12. November 2019

Die Causa Perli…   Potemkin

Landtag Niedersachsen DSCF7719.JPG

Quelle      :   Potemkin

Von    jpsb

Zu den geliebten Aufgaben eines Blogs wie Potemkin gehört es Meinungen und Standpunkte in den politischen Prozess des linken Politbetriebes einzupflegen. Dabei kann es dazu kommen, dass Adressaten von Kritik sich als Opfer von Angriffen oder gar Kampagnen wähnen. Schnell ist dann von Mobbing und Hetze die Rede. All das dient nur einer einzigen Strategie: Den Inhalten von Textbeiträgen ihrer Stoßrichtung zu berauben, jeder Debatte eine rein persönliche Note zu geben und sich schlussendlich der Verantwortung für eine mitgliederöffentliche Klärung von ungelösten Machtfragen zu entziehen.

Denn der letzte Blogbeitrag auf Potemkin hat im Landesverband Niedersachsen eine Kontroverse darüber ausgelöst, welche Kritik an Mandatsträgern, namentlich dem Bundestagsabgeordneten Victor Perli,  erlaubt sein soll und welche nicht. Unlängst wurde das Thema sogar im Landesvorstand behandelt. Natürlich hinter dem Rücken derjenigen, die für eine Verrohung der parteiinternen Umgangsformen verantwortlich gemacht werden.

Eine Verrohung der Umgangsformen? Bei den Linken? Dies klingt wie ein Treppenwitz der Geschichte. Denn in der öffentlichen Meinung ist längst und völlig zu Recht eingepreist, das Links der Mitte immer mit ganz besonders harten Bandagen Machtkämpfe ausgefochten werden. Die Partei war, ist und wird immer ein Ort bis aufs Messer geführter Diadochenkriege sein. Ein Landesvorstand der da eine andere Erzählung zum Besten geben will ist per se handlungsunfähig, da er die Realitäten im eigenen Verband schlichtweg nicht zur Kenntnis nehmen will.

Auch Perlis Aufstieg folgt den Mustern einer Mobilisierung gegen Andere. Auf der letzten Listenaufstellung forderte er erfolglos auf Platz 2 der Landesliste den niedersächsischen Abgeordneten Dehm heraus und hoffte dabei, nach Einschätzung etlicher Beobachter der Aufstellungsversammlung,  auf die Unterstützung des damaligen Abgeordneten Herbert Behrens. Als der Angriff auf Dehm misslang, wendete er sich umgehend gegen Behrens selbst und beerbte dessen Bundestagsmandat. Wer zielstrebiges Personal wie Perli unterschätzt, kann auch bei den offensichtlichsten Manövern schnell ins Hintertreffen geraten. Eine Lektion, die für Behrens zu spät kam.

Perli verkauft sich dabei gerne als eine Mischung aus junger Hoffnung und Schwiegersohnsliebling. Die von ihm versprochene Modernsierung des Landesverbands oder gar eine stärkere Profilierung in Strategiefragen blieb aus. Perli ist ein höchstens mittelmäßiger Redner, hat keinerlei Netzwerksarbeit im Bundestag vorzuweisen und in den von ihm bearbeiten Themen ist nicht die Spur von Erneuerung erkennbar. Der Genosse ist ein klassischer Hinterbänkler, der aber im Landesverband Niedersachsen ein Gespür für Machtpolitik entwickelt hat.

Dazu gehört auch die Beherrschung  finanziell wichtiger Aggregate eigener Machtpolitik. Zum Beispiel des Rosa-Luxemburg-Bildungswerkes in Niedersachsen, dessen erster Vorsitzender er ist. An sich unscheinbar, wird diese Institution durch Steuergelder finanziert und kann somit über die Vergabe von Bildungsaufträgen und die Organisation politischer Veranstaltung auch zu internen Machtzwecken mit Wirkung auf den Parteiapparat eingesetzt werden. Da im Bildungswerk auch Arbeitsplätze eingerichtet wurden, ist es Teil der internen Humanressourcen mit Wirkung auf den Landesverband der Partei.

2019-04-11 Diether Dehm MdB by Olaf Kosinsky-9591.jpg

Gebrauchte er nicht früher die Hände zum halten der Flöte, wenn er musizierend durch Hameln lief?

Wie dann durch die Hintertür politische Fakten geschaffen werden, zeigt eine Posse aus dem abgelaufenen Wahlkampf zum Amt der OberbürgermeisterIn in Hannover. Dort hatte eine im Kreisverband Hannover völlig isolierte Gruppe um die ehemalige linke Stadträtin Helga Nowak, eine Gegenkandidatin zur Nominierung des eigenen Kreisverbandes aktiv im Wahlkampf unterstützt. Dass Ergebnis war eine Kanibalisierung der Stimmen im linken Lager und ein schlechtes Wahlergebnis sowohl für die Gegenkandidatin Kaczmarek, als auch für die Kandidatin der Linken Jessica Kaußen

Quelle         :           Potemkin            >>>>>           weiterlesen

————————————————————-

Grafikquellen         :

Oben      —           Victor Perli, Landtagsabgeordneter Niedersachsen, 16. Wahlperiode (Fotoprojekt Landtagsabgeordnete Niedersachsen am 24. und 25. November 2009)

————————————

Unten         —          Diether Dehm, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Bundestag, Niedersachsen, P. DIE LINKE, Überregional | 2 Kommentare »

Elektroautos : Aus Aachen

Erstellt von DL-Redaktion am 12. November 2019

Versucht die fossile Autoindustrie dies zu verhindern?

File:StreetScooter C16.jpg

Quelle       :     Scharf  —  Links

Von Walter Schumacher

Vor über 100 Jahren wurden in Aachen schon mal Autos hergestellt [1].
Seit 2014 gibt es erneut eine Autoproduktion: mit dem „Streetscooter“ und dem e.Go“ werden zwei besonders sinnvolle Elektro-Auto-Typen [2] entwickelt, serienreif gemacht und hergestellt, die wirklich beispielhaft sind für „vernünftige“ E-Autos! [3]

Während einerseits alle politischen und wirtschaftlichen Indikatoren in Richtung eines großen Erfolgs für das Produkt stehen, kommen aber weder die Produktion noch die Auslieferung dieser Fahrzeuge richtig in Gang!

Manipuliert die „fossile“ Autoindustrie die Herstellung vernünftiger Elektro-Autos?

Als kraz beobachten wir diesen erstaunlichen Widerspruch schon seit langem und stellen uns die Frage: Wird die Produktion vernünftiger E-Autos in Aachen gewollt behindert? Und warum könnte das geschehen?

Vorweg das Besondere an Streetscooter und e.Go

  • Der erste war der „Streetscooter“ (10/2015). Er ist ein Elektro-Lieferwagen und es gibt ihn in zwei Größenvarianten: „klein“ wie ein VW-Transporter und „groß“ wie ein Mercedes-Sprinter. Es ist ein zweckmäßig konstruiertes, einfaches Fahrzeug. Die Einzelkomponenten sind weitestgehend Standardprodukte.
    Er passt perfekt in das Anforderungsprofil „Versorgungs- und Arbeitsfahrzeuge im Nahbereich“ (<150km) mit vielen Zwischenhalten, Rückkehr zu einem festen Standort und einem Fahrzeugpool bei flexibler Nutzung von Firmen. Ein perfektes Fahrzeug für ALLE städtischen und regionalen Lieferdienste.
    Die Streetscooter gingen sehr schnell an die Kunden. Seither laufen etwa 10.000 Fahrzeuge in einem harten Alltagsbetrieb. Es sind keine bemerkenswerten Produktionsfehler bekannt geworden.
  • Das zweite Aachener Fahrzeug ist der „e.Go“ (seit 2016), ein kleiner Stadtwagen. Vom Raumangebot her ist er zwischen Smart und Fiat 500/VW Lupo angesiedelt. Technisch ist er komplexer als der Streetscooter, basiert aber auf den Erfahrungen bei dessen Entwicklung. Auch hier werden sehr einfache Komponenten verwendet. Es gibt keine technisch-sachlichen Gründe für Lieferprobleme der Komponenten (außer: man will nicht liefern). Ebenso wenig sind Probleme bei der Zulassung des Wagens bekannt.
    Das Anforderungsprofil ist gezielt für den innerstädtischen Ein-/Zwei-Personenverkehr konzipiert; entweder als Firmenpool-Wagen oder aber als privater Zweitwagen. Mit einem Preis von <20.000€ ist der e.Go deutlich preiswerter als die heutigen anderen E-Autos!

Beide Wagen sind auf ein Käuferpublikum mit folgenden Eigenschaften ausgerichtet: Zweckmäßige Nutzung eines Fahrzeugs, ökologische Orientierung, kein Bedarf an psychologischem Imageaufbau/Protzen (ich-bin-männlich, ich-bin-sportlich, ich-bin-reich).
Diese positive Bewertung bezieht sich ausdrücklich auf das genannte Nutzersegment. [3] Es sind keine klassischen Allzweckautos – da müsste sich noch deutlich was an der Batterietechnik tun. Aber für die genannten Nutzungssegmente gibt es zur Zeit nichts besseres als diese beiden Wagentypen!

==> Hierzu ein positiver Bericht in Auto-Motor-Sport

Die bisherige (kurze) Geschichte von Streetscooter und e.Go

  • Der „Streetscooter“ startete 2014 fulminant und machte ansehnliche Produktionszahlen. Die Firma (Produktionsanlagen) wurde 2014 von der Post AG aufgekauft und sogar noch in Düren durch ein zweites Werk erweitert – und dann würde es plötzlich ganz ruhig um den Wagen.
    Anfangs war er ein Verkaufsrenner. Die Post hat über 10.000 Fahrzeuge im Einsatz, man sieht das Fahrzeug aber auch bei anderen Lieferdiensten. Trotz dieser Erfolge wird der Streetscooter mittlerweile als Sorgenkind präsentiert, Gerüchte besagen, dass die Post das Werk wieder verkaufen will.
  • Den „e.Go“ gibt es seit 3/2017. Seit 5/2017 kann man den Wagen prinzipiell! kaufen. Und mittlerweile arbeiten 500 Leute in dem e.Go-Werk – aber der Wagen wird einfach nicht ausgeliefert!
    Seit mindestens 11/2018 gibt es auf der Hohen Straße in Köln einen großen ‚e.GO Pop-Up Store‘, in dem systematisch Werbung für den Kauf des e.Go macht. Die Verantwortlichen werden das Geld dafür doch nur in die Hand genommen haben, weil sie selber den baldigen Verkauf des Wagens erwartet hatten.
    Stattdessen werden halbjährlich Ausreden für die Nicht-Auslieferung veröffentlicht und die (willigen) Kunden immer wieder vertröstet. Ursprünglich sollten 3000 Fahrzeuge bis Ende 2019 produziert werden. Die Auslieferung ist aber erneut ins Jahr 2020 verschoben worden.
    Den e.Go gibt es „theoretisch“, aber aus irgendwelchen dubiosen Gründen ist er einfach nirgends zu kaufen! Auch der OB Philips wartet nach eigener Aussage immer noch auf „seinen“ e.Go!

Warum also Probleme – bei beiden E-Fahrzeugen?

Diese mysteriöse Geschichte über „Produktionsprobleme“ wird halbjährlich in den lokalen Zeitungen mit wortreichen Ausreden und erstaunlichen Meldungen begründet. Die letzte Überschrift dazu lautet am 19.10.2019 in den AN „e.Go räumt Produktionsprobleme ein.

  • Zu Problemen beim „Streetscooter“ ist (öffentlich) nichts bekannt!
  • Beim e.Go werden öffentlich folgenden Gründe genannt:
    • Der Lieferant ‚Ford‘ liefert nicht. (Was, welche Teile und warum? Ist unklar)
    • Der Batterielieferant ‚BMZ‘ ziert sich mit Lieferungen.
    • Und echt witzig: in den AN vom 19.10.19 wird eine „IP67-Regel für technische Geräte“ zitiert, die folgende skurrile Auflage enthält: „technische Geräte müssen auch nach einem mind. 30 minütigem Tauchbad im bis zu einem Meter tiefen Wasser voll funktionsfähig sein“. Und weil Lieferkomponenten diese Regel nicht erfüllen, darf der e.Go nicht gebaut werden?? Hmm!?

Es gibt ein ganz anderes, aber echtes Problem beim e.Go

Dort entstehen monatliche Unkosten von 2-3 Mio Euro! Seit Monaten sind dort ca. 500 Leute beschäftigt, was bei e.GO mindestens 2-3 Mio Euro Kosten, ohne jedwede Einnahmen erzeugt. Es müsste also ein Kostenproblem existieren – das aber öffentlich NICHT problematisiert wird.

Wieso führt das eigentlich nicht zum Bankrott? Wer bezahlt das?
Sorgt VW dafür, dass das Werk nicht pleite geht? Sorgt VW für Ruhe an den Arbeitsplätzen (wo ja faktisch nicht produziert wird) und „erkauft“ sich (wörtlich) so die Zeit, um seine wesentlich teureren Modell an den Markt bringen zu können? Die Erklärung könnte in der „Strategischen Partnerschaft“ von VW und e.Go liegen (siehe weiter unten).

Unsere Vermutung:
Es gibt einen Boykott der Auto-Industrie gegen ein vernünftiges E-Auto!

Je öfter sich die Ausreden für die Nicht-Lieferung des e.Go wiederholen, desto mehr fragen wir uns, ob wir gerade Zeugen werden, wie die (fossile) deutsche Autoindustrie mit trickreichen Mitteln verhindert, dass endlich mal vernünftige Elektro-Autos (statt der gigantischen E-SUVs) auf den Markt kommen?

Wir haben deshalb mal zusammengestellt, was wirklich hinter dieser eigenartigen und für Aachen (als perspektivischem Produktionsstandort) etwas bitteren Geschichte stecken könnte.

Indizien für eine „gewollte Produktionsbehinderung der sinnvollen E-Autos“

Unser Denkansatz lautet: Die Produkte Streetscooter und e.Go sind (vom Timing und der Funktionsweise) viel zu gut, sodass sie den ganz Großen in der Automobilbranche als Konkurrent echten ökonomischen Ärger machen und deshalb auf dem Markt stark „eingehegt“ oder besser noch „verhindert“ werden müssen. Möglicherweise hatte die fossile Autoindustrie beim Streetscooter noch erwartet, dass die RWTH-Newcomer es nicht schaffen würden. Aber nachdem der Streetscooter dann doch ein Erfolg wurde, wollten sie beim e.Go „besser aufpassen“. Die folgenden Argumente gelten für beide Fahrzeuge.

  • „Zeit schinden, um noch ein/zwei Jahre fossile Autos verkaufen zu können“ (= ExtraProfit-sichern). Jeder Monat spätere Auslieferung guter E-Autos schafft „Zeitraum“ für den Verkauf weiterer (gewinnbringender) Fossil-Autos.
  • „Zeit schinden, um als erstes Protz-E-Autos verkaufen zu können“ (=ExtraProfit-sichern). Solche sinnvollen E-Autos kommen für die fossile Autoindustrie „zu früh“, weil:
    • der Markt für dicke E-SUVs & schnelle E-PKW frei bleiben soll. Leute mit viel Geld wollen sich ein „grünes Image“ kaufen und zahlen dafür auch gerne viel Geld ….
    • erst nach Abdeckung dieses Marktanteils, „lohnt“ sich auch die Belieferung des preiswerteren Marktsegments.
      Sobald einmal der e.Go für 16.000 – 19.000 € auf der Straße zu sehen sein wird, brechen mit Sicherheit die Verkaufszahlen all der wunderschönen E-Golfs E-Opels, E-BMW, E-Benz ein, die zwar (sinnloserweise) in 3 Sek von Null auf 100 km/h „können“, aber preislich mindestens ein/zwei Klassen teurer sind.
  • „Diskreditieren“
    Diese Protz-E-Autos werden die Diskussion um die E-Mobilität bestimmen, weil viele ernsthafte Umweltschützer leider ausschließlich den Irrsinn der Protz-E-Autos sehen werden. Die Relevanz von sinnvollen E-Autos wird dann (wie beabsichtigt?) in den Hintergrund gedrängt.
  • „E-Auto als Spielzeug“?
    siehe zusätzlich auch den Artikel „Produziert e.Go Mobile bald ein VW-Funcar?

Eine vergiftete „strategische Partnerschaft“ mit VW?

Es gibt eine vertraglich/kommerzielle Verbindung zwischen VW und e.Go, die ebenfalls für die von uns unterstellte, bewusste Behinderungs-Strategie spricht: Wir wissen, VW will e.Go als Basis für die eigene, zukünftige E-Mobilitätssparte haben. (In den AN vom 5. März 2019 heißt es dazu: „… Der Weltkonzern öffnet seinen Elektrifizierungsbaukasten (MEB), mit dem es ab 2020 die neue Generation von Elektroautos bauen will, … e.GO ist weltweit der erste Partner in der Elektrosparte … Das Aachener Unternehmer profitiert doppelt von der Kooperation: Zum einen kann der Baukasten in die gerade anlaufende Produktion des eigenen e.GO life integriert werden. Und beide Unternehmen entwickeln in den kommenden Monaten gemeinsam ein Elektro-Auto, das die VW-Flotte ergänzen soll….“ (https://www.aachener-nachrichten.de/nrw-region/kooperation-von-ego-und-vw-neue-elektroautos-in-aachen-produziert_aid-37182963)

Das würde einerseits erklären, wer und warum die Übernahme der aktuell entstehenden Kosten übernimmt. Unfreundlich formuliert ist das dann ein „Leerlauf-Geld“ oder „Bestechungsgeld“ von VW, damit im Aachener e.Go-Werk Ruhe herrscht und man „freiwillig“ nicht liefert, um so den Markt für die in 2020 kommenden (erhofften) VW-Modelle „frei“ zu halten.

Beides macht Sinn für VW: Einerseits so den gefährlichen Newcomer klein halten; gleichzeitig sich dessen Know-how für die eigenen (eigentlich zu spät) kommenden Goliath-Aufgaben an zu eignen!

Es KÖNNTE aber auch ganz anders sein…

Es gibt doch echte Probleme bei der Produktion – eine simplere Erklärung?
Dann wären die Produktions- und Auslieferungsverzögerungen Ergebnis echter Probleme und zeigen nur, dass eine RWTH (bzw. das kommerzielle Spin-Off) nicht in der Lage ist, ein sinnvolles verkäufliches Produkt zu entwickeln, technisch zu planen und zu produzieren. Wir von der kraz glauben DAS nicht.

Zum Schluss eine Bitte

Wir haben versucht, eine wichtige Wirtschaftsentwicklung in Aachen zu beschreiben. Uns fehlen eine Reihe von Fakten, wir haben nur „mögliche“ Erklärungen geliefert. Unsere LeserInnen mögen selber entscheiden, was da eigentlich los ist.

Als kraz-Redaktion würden wir uns aber freuen, wenn wir Insider-Informationen bekämen, die unsere genannten Thesen entweder stützen oder aber widerlegen. Uns geht nicht um das „Recht-Haben“, wir wollen „verstehen“.

Anmerkungen

[1] Zur Geschichte der Aachener Auto-Produktion
Zu Beginn des vorigen Jahrhunderts (1903) gab es eine Automobilproduktion in Aachen durch die Firmen Fafnir und Cudell. Aber schon 1926 war alles wieder vorbei. Deshalb war es schon eine Sensation, als Streetscooter und e.Go als Spin-Offs der RWTH neu auftauchten.

[2] Das Missverständnis im Namens „Elektro-Auto“
Ein Elektro-Auto heißt so, weil der Antrieb „elektrisch“ ist. Der Strom für den Antrieb kann prinzipiell auf unterschiedliche Art ins Fahrzeug gelangen (Straßenbahnen und O-Busse bekommen ihn per Oberleitung). Bei Autos ist der heutige Standard eine (Lithium)-Batterie. Sie könnten aber genauso gut durch Brennstoffzellen (Wasserstoff) mit Strom versorgt werden! Eine (veraltete) Zwischenlösung war ein kleiner fossiler Motor im Fahrzeug, der dessen Batterie und damit die Elektromotoren mit Strom versorgt.

[3] Unser hohes Lob für den Streetscooter und den E.Go könnten so wirken, als ob wir E-Autos für DIE Lösung der städtischen oder gesellschaftlichen Problematik des Autoverkehrs halten.
Nein, wir wissen sehr wohl, dass Elektrofahrzeuge auch den gleichen Platz verbrauchen, den Fuß- und Radverkehr gefährden und verdrängen, die Städte mit Lärm verpesten usw. usf.. Elektroautos sind nur in einigen Bereichen ein echter Fortschritt gegenüber den fossilen Autos. In anderen sind sie genauso schlecht und für das „schlechte Gewissen bei der Autonutzung“ sind E-Autos sogar eher verführerisch, um sich so ein reines Gewissen zu verschaffen!
Wir wissen, dass die wirkliche Lösung ein anderes Verkehrskonzept (= anderer Modalsplit) mit viel mehr Öffentlichem Verkehr (ÖV) sein muss und sein wird. Hierzu gab und gibt es in Aachen Überlegungen („Renaissance der Tram“), über die wir in einem längeren Artikel berichten werden.

Datei:Streetscooter 3.JPG

ABER: Wir wissen auch, dass die Umformung unserer Lebenswelt in Auto-gerechte-Städte – und leider auch des „Denkens“ der Menschen im Sinne einer ‚Windschutzscheibenperspektive‘ – „erfolgreich“ gesteuert durch die Profitlogik der Autoindustrie gelungen ist und dass mit dem aktuellen Höhepunkt der Perversion durch SUVs und der aktuellen Automode mit den hochgeschürzten, aggressiven Frontpartien der Autos eine spezielle Form der „Männlichkeit“ bedient wird.

Deshalb wird es – egal wie schnell ein deutlich besserer ÖV entwickelt wird – noch lange individuell fahrende Autos geben, die bestimmte Bereiche in den Städten und Regionen mit Autos statt mit ÖV bedienen. Unklar ist, wie lange es noch dauert, bis die selbstgesteuerten durch autonom fahrende Fahrzeuge ersetzt werden. Und spätestens DANN wird ein hoher Bedarf an elektrischen – statt fossilen Antrieben bestehen.

Deshalb wünschen wir uns jetzt schon die beschleunigte Entwicklung der Elektroautos – und gerne auch Aachen als die Stadt, in der die Vorreiterfahrzeuge entwickelt und produziert werden. Heute polemisieren noch nur noch genau diejenigen gegen E-Fahrzeuge, die bisher immer die fossile Industrie und ihre Protz-Autos erhalten wollten. Wenn sie dabei heute das Argument „mehr ÖV“ verwenden, ist das nur verlogen. Wir sagen das aus Kenntnis der Verkehrspolitik der letzten 35 Jahre, die sich an zwei wichtigen Lobbyorganisation manifestiert hat: Dem ADAC (als reine Autolobby) und dem VCD (=Verkehrsclub Deutschland), der sich seit seiner Gründung 1986 eindeutig für ein sinnvolles Miteinander ALLER Verkehrsteilnehmer: Fußgänger, Radfahrer, ÖV-Nutzer und Autofahrer einsetzt.

Quelle: https://www.kraz-ac.de/elektroautos-made-in-aachen-5974

Urheberrecht
Die unter www.scharf-links.de angebotenen Inhalte und Informationen stehen unter einer deutschen Creative Commons Lizenz. Diese Lizenz gestattet es jedem, zu ausschließlich nicht-kommerziellen Zwecken die Inhalte und Informationen von www.scharf-links.de zu vervielfältigen, zu verbreiten und öffentlich zugänglich zu machen. Hierbei müssen die Autoren und die Quelle genannt werden. Urhebervermerke dürfen nicht verändert werden.  Einzelheiten zur Lizenz in allgemeinverständlicher Form finden sich auf der Seite von Creative Commons http://de.creativecommons.org/was-ist-cc/.

——————————————————————-

Grafikquellen          :

Oben           —         Prototyp StreetScooter Leichtelelektromobil     C 16

Author Franz Haag

This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.

——————————-

Unten      —          Streetscooter – Ein batteriebetriebenes Lieferfahrzeug für die Deutsche Post, gebaut in Aachen von der Talbot Services GmbH

Urheber RudolfSimon

Diese Datei ist unter der Creative-Commons-Lizenz „Namensnennung – Weitergabe unter gleichen Bedingungen 3.0 nicht portiert“ lizenziert.

Abgelegt unter Medien, Nordrhein-Westfalen, Umwelt, Wirtschaftpolitik | Keine Kommentare »

Linker Krieg oder Frieden

Erstellt von DL-Redaktion am 11. November 2019

Die Linke vor der Wahl:

Wagenknecht, Sahra, 2013.JPG

Sekt oder Selters ?

Aus Berlin Anna Lehmann

Am Dienstag wählt die Fraktion eine Nachfolgerin für die scheidende Fraktionschefin Sahra Wagenknecht. Doch es geht um mehr: Gelingt der zerstrittenen Fraktion ein Aufbruch?

Sahra Wagenknecht geht es anscheinend gerade richtig gut. Die Fraktionschefin wirke entspannt und gut gelaunt, berichten Abgeordnete. Als die Linksfraktion am vergangenen Dienstag über den Klimaaktionsplan stritt und sich die Sprit-Junkies und die Auto-Hasser in der Fraktion gegenseitig Ignoranz vorwarfen, habe Wagenknecht vermittelt: Es sei doch klar, dass man die Akzeptanz des Klimaschutz stärken müsse, auch bei denen, die nicht bei Fridays for Future mitmarschierten.

Wagenknecht hat, so scheint’s, endlich in ihre Rolle als Fraktionsvorsitzende gefunden. Und das in den Tagen ihres Abgangs. Am Dienstag wird die Fraktion Wagenknecht nach vier Jahren an der Spitze als Fraktionschefin verabschieden. Bereits im März hatte sie angekündigt, dass sie den Posten abgeben wird, wegen Stress und Überlastung.

Es zog sich länger als geplant, Wagenknecht absolvierte noch pflichtgemäß Wahlkampftermine für die Europawahl sowie in Sachsen, Brandenburg und Thüringen. Bis zu dieser letzten Wahl hatte sich die Partei strikte innerparteiliche Ruhe verordnet.

Ab Dienstag darf Wagenknecht endlich wieder einfaches Fraktionsmitglied sein und die Linke wählt eine neue Fraktionsspitze.

Es geht um viel, um viel mehr als die Nachfolge der populären und polarisierenden Spitzenfrau. Die Neuwahl ihres Führungspersonals wird für die Linke auch zu einer Bewährungsprobe: Versinkt die Fraktion erneut im Machtkampf der verfeindeten Lager – grob umrissen in die Truppen um Parteichefin Katja Kipping und die Getreuen von Sahra Wagenknecht und Dietmar Bartsch. Oder nehmen die Linken nach zwei zerstrittenen Jahren und drei verlorenen Wahlen den kleinen Aufschwung der Thüringer Landtagswahl mit und zeigen, dass sie interne Auseinandersetzungen solidarisch und zivilisiert klären können. In Thüringen ist die Linke Ende Oktober erstmals in ihrer Geschichte stärkste Partei geworden. Das Grundrezept: ein überaus beliebter Ministerpräsident und eine Partei, die geschlossen hinter ihm stand.

2018-06-09 Bundesparteitag Die Linke 2018 in Leipzig by Sandro Halank–103.jpg

Leicht wird es nicht, diesen Schwung mitzunehmen. Wagenknecht hinterlässt eine zerrüttete Fraktion. Sie ließ kaum eine Gelegenheit aus, die Migrationspolitik der Partei und den Kurs der Parteiführung öffentlich in Frage zu stellen. Innerparteiliche Diskussionen mied sie, lieber gründete sie die Sammlungsbewegung „Aufstehen“, die Menschen zusammenbringen und den etablierten Parteien Druck machen sollte. Das scheiterte.

Die Parteivorsitzenden Kipping und Bernd Riexinger wiederum ließen sich auf einen Dauerstreit mit Wagenknecht und ihren Fans ein und damit zu, dass die Linke sich öffentlich zerlegte. Eine Fortsetzung dieses Dramas ist nicht ganz ausgeschlossen.

Leicht wird es nicht: Sahra Wagenknecht hinterlässt eine zerrüttete Linksfraktion

Zwei Frauen haben ihre Kandidatur für den weiblichen Part der Doppelspitze angekündigt: Caren Lay und Amira Mohamed Ali. Lay, die Vizefraktionsvorsitzende und mietenpolitische Sprecherin ist, stammt aus Rheinland-Pfalz, ihr Wahlkreis aber ist seit Langem Bautzen in Sachsen. Sie zählte mal zur „Jugendbrigade“ um Katja Kipping. Vielen gilt sie wegen ihrer Nähe zur Parteichefin als Teil des Konflikts. Lay bemüht sich jedoch gerade um Distanz zu Kipping und betont gern, dass sie sich nicht als deren Anhängsel verstehe.

2019-04-12 Amira Mohamed Ali MdB by Olaf Kosinsky-0330.jpg

Mohamed Ali ist in Hamburg geboren und lebt seit vielen Jahren in Oldenburg. Sie arbeitete als Rechtsanwältin, bevor sie vor zwei Jahren über die niedersächsische Landesliste in den Bundestag einzog. Als verbraucherpolitische Sprecherin hielt sie dort engagierte Reden für die Kennzeichnung von Nahrungsmitteln und gegen falsche Subventionen an Landwirte, denen allerdings nicht mal ihre eigene Fraktion vollzählig beiwohnte. Mohamed Ali soll von Diether Dehm, der Wagenknecht verehrt und Kipping verteufelt, zur Kandidatur überredet worden sein.

Quelle          TAZ          >>>>>           weiterlesen

——————————————————————

Grafikquellen           :

Oben     —         Sahra Wagenknecht während einer Wahlkampfveranstaltung zur Bundestagswahl 2013 auf dem Friedensplatz in Bonn

2.)  von Oben      —             Bundesparteitag Die Linke 2018 in Leipzig

———————————–      — 

Unten         —             Amira Mohamed Ali, Mitglied des Deutschen Bundestages, während einer Plenarsitzung am 11. April 2019 in Berlin.

Abgelegt unter Berlin, Opposition, P. DIE LINKE, Überregional | Keine Kommentare »

Schöner Kämpfen in Berlin:

Erstellt von DL-Redaktion am 10. November 2019

Das Hauskollektiv der K9

File:Berlin-Friedrichshain Kinzigstraße.jpg

Quelle       :        untergrund-blättle CH.

Von kinzig 9

Die Geschichte der Hausbesetzung an der Kinzigstrasse 9. Das Haus an der Kinzigstrasse 9 in Berlin ist mehr als ein reines Wohnprojekt. Es ist der Versuch, gemeinsam ein anderes Leben jenseits von gesellschaftlichem Anpassungsdruck, Vereinzelung und Entpolitisierung zu ermöglichen. Nach jahrelanger Besetzung wurde das Haus gekauft und in ein Genossenschaftsmodell überführt.

Im Jahre 1874 wurde die Kinzigstrasse strassenbaulich und planerisch erschlossen. Bereits 1881 errichtete man eine Remise, Ställe und kleinere Lagerschuppen auf dem Grundstück. Auf den Fundamenten dieser Erstbebauung entstanden später der Seitenflügel und die heutige Remise. Die für den damals noch Kolonie Friedrichsberg genannten Berliner Vorort rund um die Kinzigstrasse typische Bebauung mit kleineren Manufakturgebäuden und Ställen kann heute noch auf den benachbarten Grundstücken Kinzigstr. 25-29 besichtigt werden.

Die Entstehungszeit 1874 – 1900

1892/93 wurden die heute erhaltenen fünfgeschossigen Gebäude auf dem Grundstück Kinzigstrasse 9 (damals noch Blumenthalstrasse 42) unter der Leitung des Zimmerermeisters W. Schlundt errichtet. Auftraggeber war Tischlermeister T. Weinrich. Vorderhaus und Seitenflügel wurden als Wohngebäude, das Quergebäude als Fabrikgebäude für Weinrichs Tischlerei errichtet. 1893/94 wurden die noch vorhandenen Schuppen im Hof abgerissen und durch die heute vorhandene zweigeschossige Remise ersetzt.

Das Vorderhaus wurde im historisierenden Stil des Neobarock gestaltet. Die aufwändig gestaltete, repräsentative strassenseitige Stuckfassade enthält neben hauptsächlich barocken auch Renaissance-Motive und ist heute noch in weiten Teilen erhalten. Während die Strassenfassade in den ersten acht Jahren keinen Farbanstrich erhielt, wurden für die Innengestaltung, vor allem der Treppenräume des Vorderhauses, aufwändige Handmalereien angebracht. Für die damalige Zeit ebenso aufwändig und entsprechend kostspielig fielen die Tischlerarbeiten aus, welche in weiten Teilen erhalten geblieben sind. Auffällig ist auch die für den Erbauungszeitraum ungewöhnlich massive Bauweise mit preussischen Kappendecken und diversen Stahlkonstruktionen im Quergebäude und äusserst soliden Holzbalkendecken im Vorderhaus.

Ab 1894 wurde im grossen Laden im Vorderhaus rechts, sowie im Erdgeschoss des Seitenflügels eine Schlachterei betrieben. Im Hof wurde geschlachtet und Wurst gemacht. Der kleine Laden wurde zunächst von einer Blumenhandlung, später aber durchgehend als Wohnung genutzt. Im Quergebäude betrieben mehrere Tischlereien Manufakturen, die Remise diente als Holzlager.

Die Wurstfabrik 1901 – 1945

1901 erwarb ein Schlächtermeister das gesamte Gebäude und begann das Quergebäude zur Wurstfabrik umzubauen. Die räumliche Nähe zum Viehhof an der Eldenaer Strasse machte diese Nutzung lukrativ. Mehrere Räucherkammern und grosse Wurstkessel wurden eingebaut, die Remise zum Pferdestall umgebaut.

1910 erwarb der Schlächtermeister Ernst Remané das Gebäude. Remané besass noch mehrere andere Gebäude. Die Kinzigstrasse wurde jedoch zum Stammsitz der Familie ausgebaut. Bereits im Jahre 1911 liess er umfangreiche Umbauten am Gebäude vornehmen. Das 1. OG des Vorderhauses und des Seitenflügels wurde zur herrschaftlichen Wohnung mit grossem Salon, Badezimmer und gefliester Dienstbotenküche umgebaut. Aufwändige Mosaikparkett- und Linoleumböden, teure Linkrusta-Tapeten sowie neue Deckenstuckelemente wurden in die Wohnung eingebaut. Die Vorderhaus–Treppenräume wurden vermutlich zu dieser Zeit mit kostspieligen Jugendstilmalereien neu gestaltet. Diese Malereien sind heute als Nachbildung wieder im Treppenhaus vorhanden. Zur selben Zeit wurden auch alle hofseitigen Fenster einschliesslich der des Quergebäudes mit neuen Jugendstil- Profilen versehen.

Schon 1910 liess Remané einen grossen Lastenaufzug am Quergebäude montieren. Dieser wurde vermutlich im 2. Weltkrieg zerstört, seine Lage ist aber heute noch an fehlenden Gesimsteilen des Quergebäudes zu erkennen. Bis zum 2. Weltkrieg wurde die Nutzung des Gebäudes als Wurstfabrik immer weiter intensiviert. Bald wurde die linke Hälfte des Seitenflügels in die Produktionsstätten integriert. Das Quergebäude wurde vom Keller bis unter das Dach mit Kühlräumen und Räucherkammern versehen, die Kellerräume des Seitenflügels dienten als Schweineställe, die des Vorderhauses teilweise als Kühl- und Lagerräume. Der grosse Laden im Vorderhaus wurde zum geräumigen Verkaufsraum, die Remise zum Schlacht- und Brühraum ausgebaut.

Im Hof wurden zahlreiche Kochkessel, Lagerschuppen und Sickergruben errichtet. Die meisten dieser Ein- und Umbauten waren illegal, was 1929 die Bauaufsicht zu mehreren Anzeigen veranlasste. Das Quergebäude erlitt vermutlich zu dieser Zeit durch die zu grossen Lasten der Wurstkessel und stark überdimensionierten Feuerstätten schwere, statisch relevante Bauschäden, welche bei der Sanierung im Jahre 2000 zu erheblichen technischen Problemen führten.

Friedrichshain, Berlin, Germany - panoramio (74).jpg

Die Wohnverhältnisse in der Kinzigstrasse 9 waren exemplarisch für die soziale Situation in Berlin am Beginn des 20. Jahrhunderts. Während die Eigentümerfamilie unter luxuriösen Verhältnissen ein ganzes Geschoss des Hauses bewohnte, lebten in den anderen Geschossen bis zu fünf Familien unter extrem ärmlichen Bedingungen. In der Kinzigstrasse 9 existierten von Beginn an so genannte 2-Generationen-Wohnungen, in denen sowohl die Eltern, als auch Tochter und Schwiegersohn mit Kindern und Grosseltern in einer gemeinsamen Wohnung bestehend aus zwei Küchen und zwei Zimmern lebten.

Eine dieser Wohnungen ist heute noch weitgehend im 2.OG des Vorderhauses erhalten. In einer solchen etwa 60qm grossen Wohnung lebten bis zu 12 Personen. Die Toiletten lagen teilweise in den Treppenhäusern, zum Teil aber auch im Hof. Die hygienischen Bedingungen in der Kinzigstrasse 9 waren katastrophal. Schriftliche Berichte von Mietern der damaligen Zeit beschreiben, dass es aufgrund der Dampf- und Rauchentwicklung durch die Wurstfabrik nie möglich war, über den Hof, geschweige denn in den Himmel zu blicken. Einzelne Wohnungen grenzten direkt an schlecht isolierte Kühlräume und waren dadurch nicht ausreichend zu beheizen. Das ganze Jahr hindurch wurden die Schlachtabfälle offen im Hof gelagert. Mehrere Fälle von Tuberkulose sind aktenkundig. Die Gesundheitsbehörden wurden mehrfach in der Kinzigstrasse 9 aktiv.

Über die Verhältnisse im Haus während des Nationalsozialismus ist wenig bekannt. Nachweisbar ist nur, dass Eigentümer Remané noch in den dreissiger Jahren das gesamte Vorderhaus-Treppenhaus im expressionistischen Stil der damaligen Zeit neu streichen liess. Diese Wandbemalung ist in ihrer aufwändigen Gestaltung die einzige heute in Berlin bekannte, da zu jener Zeit in der Regel nicht die notwendigen finanziellen Mittel für solche Arbeiten vorhanden waren. Im 2. Weltkrieg wurde der Dachstuhl des Quergebäudes zerstört. Ansonsten erlitt die Kinzigstrasse 9 keine relevanten Kriegsschäden.

Die Lederwarenfabrik 1945 – 1980

Nach dem Krieg wurde das Quergebäude zunächst von einer Firma für Maschinen- und Anlagebau genutzt. 1954 liess die Tochter des ehemaligen Eigentümers Brunhilde Waschke geb. Remané das Quergebäude für die Lederwarenfabrik Ludwig Georg Lumpe umbauen und fast alle noch von der Wurstfabrik vorhandenen Einbauten entfernen. Das Erdgeschoss des Seitenflügels diente als Büroraum, die Remise als Lagerschuppen. 1962 wurde auch der grosse Laden im Vorderhaus für die Lederwarenfabrikation umgebaut. Im gleichen Jahr wurde auch die Sichtmauerwerksfassade des Quergebäudes verputzt. Dazu wurden alle Gesimse abgeschlagen und grosse Teile des Sichtmauerwerks schwer beschädigt. Diese Fassade wurde im Jahr 2000 aufwändig rekonstruiert.

Verfall und Abrissplanung 1980 – 1989

Zu Beginn der 80er Jahre begann die Kommunale Wohnungsverwaltung (KWV) mit der Umgestaltung der Wohnblöcke südlich der Frankfurter Allee. Geplant war der Abriss fast sämtlicher Altbauten von der Niederbarnimstrasse bis zum S-Bahnhof Frankfurter Allee und deren Ersetzung durch Neubauten in industrieller Plattenbauweise. Das Planungskombinat des so genannten „Baufeld Nr. 5“ sollte ursprünglich in der Kinzigstrasse 9 residieren.

Die dafür geplanten Umbauten wurden jedoch nie realisiert. Während sich die Eigentümerin die 80er Jahre hindurch beharrlich gegen ihre Enteignung wehrte, wurde in der Umgebung ein Häuserblock nach dem anderen gesprengt. Teile des Gebäudes standen nun leer. Der Seitenflügel wurde baupolizeilich gesperrt. Das Quergebäude wurde zunächst von einer Firma für Elektroarbeiten, später durch eine Schlosserei und für Lager- und Unterkunftsräume des VEB Bau genutzt.

Die Kinzigstrasse 9 wurde zur Sprengung vorbereitet. Davon zeugen heute noch die rot-weissen Sprengzeichen an der Strassenfassade, sowie ein Sprengschlitz unterhalb des untersten Fassadengesimses. Aufgrund der Verzögerungen bei der Zwangsenteignung endete die Neubaustelle zunächst in der Kinzigstrasse 7. Am 30.September 1989 wurde Brunhilde Waschke rechtskräftig enteignet und in ein Altenwohnheim umgesiedelt. In der Folgezeit stand das Haus vollständig leer. Im Mai 1990 wurden die Häuser Kinzigstrasse 11-15 gesprengt.

Die Zeit der Hausbesetzung 1990 – 1999

Am 4. August 1990 verhinderte die Besetzung des Gebäudes schliesslich die Sprengung. Die Kinzigstrasse 9 wurde aus einer Grossdemonstration gegen die Wohnungspolitik des Berliner Magistrats heraus und mit massgeblicher Unterstützung von Hausbesetzern aus der benachbarten Mainzer Strasse besetzt. Zu diesem Zeitpunkt waren die Plattenbauten gegenüber und neben dem Haus noch im Bau. Der Grund für die Besetzung der Kinzigstrasse 9 war nicht nur die drohende Sprengung, sondern auch die umfangreichen Möglichkeiten, die die grossen Räume im Quergebäude boten.

In der Folge diente das Quergebäude sowohl für Tagungen des Berliner Besetzerrates, als auch für Parties und andere grössere Veranstaltungen. Während der militärischen Räumung der besetzten Häuser in der Mainzer Strasse vom 12. bis 14. November 1990 existierte auch ein Räumungstitel für die Kinzigstrasse 9, der jedoch – vermutlich wegen logistischer Probleme der Berliner Polizei – nicht umgesetzt wurde. Dennoch verliess die ursprüngliche Besetzergruppe noch im November desillusioniert das Haus. Die Kinzigstrasse 9 stand daraufhin für kürzere Zeit wieder leer.

Im Winter 1990/91 wurde das Haus Stück für Stück von kleineren Besetzergruppen und Einzelpersonen bezogen, die jedoch keine zusammenhängende Hausgruppe darstellten. Darunter waren Punks, Obdachlose und Trebejugendliche, aber auch Drogendealer. In der Folge kam es zu zwei Drogentoten in der Kinzigstrasse 9. Die Punks warfen schliesslich die Drogendealer aus dem Haus und etablierten eine geschlossene Hausgemeinschaft. In der Folge erlangte die Kinzig 9 als „härtestes Punkhaus Deutschlands“ grosse Bekanntheit und wurde zum Treffpunkt für Punks aus ganz Europa. Das gesamte Quergebäude wurde im Jahr 1991 Tag und Nacht für Parties genutzt, in Vorderhaus und Seitenflügel wohnten zeitweise bis zu 80 BewohnerInnen und Gäste.

Es kam zu schweren Konflikten zwischen den neu eingezogenen Nachbarn der Plattenbauten und den BesetzerInnen, vor allem aufgrund von ruhestörendem Lärm und Sachbeschädigungen. Mehrere Räumungsbegehren der zuständigen Wohnungsbaugesellschaft wurden vom Senat ignoriert. In den Jahren 1991-92 verübten Neonazis mehrere Brandanschläge auf die Kinzigstrasse 9. Dabei wurden Teile des Vorderhauses, vor allem die herrschaftliche Wohnung im 1.OG und die Stuckdecken der Durchfahrt unwiederbringlich zerstört. Von der Ausstattung des 1.OG blieben lediglich die Fliesen der Küche, sowie einige grossflächige Teile der Mosaiklinoleumböden und der Linkrusta-Tapete erhalten, die heute in Berlin Einzelstücke aus der Erbauungszeit darstellen. Teile des Vorderhauses waren in der Folge unbewohnbar; die Zahl der BesetzerInnen nahm stark ab.

Anfang 1992 zog eine weitere Besetzergruppe aus dem Umfeld der ehemaligen Mainzer Strasse in den mittlerweile wieder leerstehenden Seitenflügel und das Quergebäude ein und begann mit der Instandsetzung. Das Vorderhaus wurde weiterhin von Punks bewohnt. Die beiden BewohnerInnengruppen konnten sich nicht auf ein gemeinsames Vorgehen einigen, und es kam zu gewalttätigen Auseinandersetzungen untereinander. In den Folgejahren agierten beide Gruppen isoliert voneinander. Der grosse Laden des Vorderhauses wurde als Kneipe genutzt. Im Quergebäude entstanden eine gemeinnützige Tischlerei und ein Veranstaltungssaal, die von der BesetzerInnengruppe als Jugend- und Kulturprojekte betrieben wurden. Teile des Quergebäudes wurden zu Wohnräumen umgebaut. Einzelne Wohnungen im Seitenflügel erhielten Mietverträge, der Rest des Hauses blieb bis 1998 besetzt.

Die senatseigene Wohnungsbaugesellschaft WBF führte in den 90er Jahren mehrfach Bau- und Instandsetzungsmassnahmen durch, welche die denkmalschutzrelevante Substanz des Gebäudes teilweise zerstörten. So wurde der Seitenflügel 1993/94 so saniert, das heute fast nichts mehr an sein ehemaliges Erscheinungsbild erinnert. Obwohl das Gebäude bereits im September 1995 unter Denkmalschutz gestellt wurde, liess die WBF 1996 die beiden Hoftore der Durchfahrt entfernen und verschrotten. Das jetzige Hoftor ist ein Nachbau.

Friedrichshain, Berlin, Germany - panoramio (36).jpg

Ebenfalls 1996 begann die WBF mit dem Abschlagen der maroden Strassenfassade, was nur durch die Intervention der BesetzerInnen und des Denkmalamtes unterbunden werden konnte. Der fehlende Stuck auf der linken Fassadenseite wurde damals zerstört. Die WBF versuchte in dieser Zeit mehrfach das Gebäude zusammen mit dem angrenzenden Bauland an grössere Investoren zu verkaufen. Diese Bemühungen scheiterten jedoch aufgrund der Denkmalschutzauflagen und der Besetzung des Gebäudes. Am 8.10.1996 wurde das besetzte Vorderhaus polizeilich geräumt, in der Folgezeit aber von den BesetzerInnen des Quergebäudes nach und nach wiederbesetzt.

Legalisierung und Selbstverwaltung

Ende 1998 erwarb die BesetzerInnengruppe mit ihrem gemeinnützigen Verein die Kinzigstrasse 9 von der WBF. Das Haus wurde der Wohnungsbaugenossenschaft Selbstbau e.G. geschenkt und mit dieser ein langfristiger Pachtvertrag abgeschlossen, da das Ziel von Hausgruppe und Verein hauptsächlich in der gemeinnützigen Arbeit, jedoch nicht im Eigentum an Immobilien liegt. In den Jahren 1999-2002 rekonstruierten die BewohnerInnen das die Gebäude in Eigenregie. Die Finanzierung wurde durch Fördergelder aus dem Selbsthilfe-Programm des Berliner Senats, durch Zuwendungen des Landesdenkmalamtes, sowie durch Eigenmittel der BewohnerInnen gesichert.

Bei der denkmalgerechten Rekonstruktion wurde versucht, die wechselhafte Geschichte des Hauses in seinem Erscheinungsbild zu dokumentieren. So zeigt vor allem die strassenseitige Fassade die vielseitigen Spuren und Narben der Hausgeschichte.

Auch die heutige Nutzung des Gebäudes zeigt Parallelen zu vergangenen Zeiten. So ist der Anteil der Gewerbeflächen nach wie vor relativ hoch: Auf 600qm verteilen sich verschiedenste gemeinnützige Dienstleistungsangebote. Siebdruckwerkstatt und Kneipe nutzen die strassenseitigen Läden. Die Remise dient als Gästehaus, in den Gewerberäumen des Seitenflügels sitzt das Vereinsbüro. Das 1. OG des Quergebäudes wird als Atelier genutzt. Hochparterre und Souterrain des Quergebäudes werden unter dem Namen „Grössenwahn + Leichtsinn“ von den BewohnerInnen gemeinschaftlich als öffentliche Kiezkulturstätte betrieben. Die Räume können von verschiedensten politischen und kulturellen Initiativen für Veranstaltungen und Parties genutzt werden. (Diesbezügliche Anfragen können an groessenwahn@kinzig9.de gestellt werden.) Nach wie vor ist die Kinzigstr. 9 ein selbstverwaltetes Projekt. Alle 35 BewohnerInnen entscheiden auf gemeinsamen Plena über die Belange des Hauses und die Nutzung der öffentlichen Räume.

Dieser Artikel steht unter einer Creative Commons (CC BY-NC-SA 2.0) Lizenz.

————————————————————————

Grafikquellen      :

Oben        —         Berlin-Friedrichshain Kinzigstraße

Author Assenmacher
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

—————————–

2. ) von Oben          —      Friedrichshain, Berlin, Germany

————————

Unten         —           Friedrichshain, Berlin, Germany

Abgelegt unter Berlin, Mensch, Positionen, Regierung | Keine Kommentare »

Charlie : Erinnerung to go

Erstellt von DL-Redaktion am 10. November 2019

Checkpoint Charlie in Berlin

Aus Berlin Jan Pfaff, Hanna Voß, Felix Zimmermann

Einst ein Ort der Weltgeschichte, heute ein Rummelplatz: Wie der Checkpoint Charlie wurde, was er ist – und was er sein könnte.

Wie selbstverständlich steht sie plötzlich da, eine orangefarbene Hütte am Checkpoint Charlie, gerade groß genug für eine Person. „Sharepoint Charlie“ kann man auf ihrer Seite lesen. Aufgebaut ist sie vor der Nachbildung des U.S. Army Checkpoints und den aufgetürmten Sandsäcken, hinter denen jeden Tag Touristen aus aller Welt posieren. Ein Kameramann macht sich bereit, ein Mann in Soldatenuniform und einer mit Klemmbrett nehmen Positionen ein. Ein Werbespot für eine Autovermietungsfirma soll hier gedreht werden.

Aber bevor die erste Einstellung aufgenommen wird, kommen zwei Polizisten und erklären den Männern, dass sie hier nicht drehen dürfen. Sie hätten eine Drehgenehmigung für ganz Berlin, behaupten die Werbefilmer, nur gerade nicht dabei. Allgemeine Genehmigungen hätten hier keine Gültigkeit, für den Checkpoint Charlie bräuchten sie eine Sondernutzungserlaubnis, referiert ein Polizist. Aus dem Dreh wird nichts.

Die Szene erzählt von dem besonderen Status dieses Ortes – und seinen heutigen Problemen. Der Checkpoint Charlie ist ein Stück Weltgeschichte. Das Schwarzweißfoto, auf dem sich am 27. Oktober 1961 genau hier gefechtsbereite Panzer der zwei Supermächte gegenüberstanden, ihre Geschütze aufeinander gerichtet, gehört zum globalen Bildergedächtnis. Am Checkpoint Charlie trafen Ost und West aufeinander, Kapitalismus und Kommunismus, GIs und rote Armee, getrennt durch eine weiße Linie, die die Grenze zwischen den Berliner Bezirken Mitte und Kreuzberg markierte.

Heute besuchen den Ort jedes Jahr rund 4 Millionen Menschen. Und viele versuchen den Mythos für sich auszuschlachten, ein Geschäft damit zu machen – da sind die Straßenhändler, die Sowjetuniformen, Pelzmützen und Gasmasken anbieten, daneben die vollgestopften Souvenirläden mit ihren bunten Mauerbröckchen, DDR-Fahnen und Miniatur-Trabis.

Fastfoodketten und Würstchenbuden rangeln um Kundschaft, Sightseeingbusse rollen im Schritttempo über die einstige Grenzlinie, Hütchenspieler und Bettlergruppen tauchen plötzlich auf und verschwinden wieder. Das zügige Tempo, mit dem sich die Menschen sonst in dieser Gegend bewegen, kommt hier fast völlig zum Stillstand. Schulklassen blockieren die Gehwege, Touristen stehen auf der Straße herum.

Wer heute nur einige Minuten am Checkpoint Charlie herumläuft, hat das Gefühl, über einen großen Rummelplatz zu gehen. Geboten wird historische Erinnerung to go, hier schnell ein Selfie, da schnell eine Bratwurst. Wie hat sich der Ort, an dem einmal Menschen bei Fluchtversuchen starben und die Angst vor einem Dritten Weltkrieg ständig präsent war, in eine schäbige Flaniermeile verwandelt? Wie wurde der Checkpoint Charlie, was er heute ist? Und was erzählt das über unseren Umgang mit historischer Erinnerung?

Im Hinterzimmer des Cafés Einstein, direkt am ehemaligen Grenzverlauf, hängen Schwarzweißbilder aus den 60er Jahren, darauf Stacheldraht, Brachen und Soldaten in Wintermänteln. Darunter sitzt Smiley Baldwin und macht seinem Vornamen alle Ehre – er lächelt, während er sich zu erinnern versucht, wie das damals war, als er als amerikanischer Soldat Dienst am Checkpoint Charlie tat.

Baldwin kam 1987 als Militärpolizist nach Berlin, zuvor war er zwei Jahre bei Frankfurt stationiert. „Dort war die Studentenszene in den Reagan-Jahren gegenüber US-Soldaten sehr ablehnend. In Westberlin waren die Leute so nett zu uns – sie waren dankbar, dass wir da waren.“ Als Militärpolizist fuhr er zusammen mit Berliner Polizisten Patrouille. Er interessierte sich für die Geschichte der Stadt, lernte Deutsch. Abwechselnd wurde er am Checkpoint Bravo an der Transitautobahn zur BRD und am Checkpoint Charlie eingesetzt.

In dem Kontrollhäuschen arbeitete er als Assistent des Non-Commissioned Officer in Charge, des verantwortlichen Unteroffiziers. „Ich habe ihm beim Papierkram geholfen oder auch mal den Müll rausgebracht.“ Eigentlich sei das ein Bürojob gewesen. Die Russen wollten genau wissen, wer, wann, wieso in den Ostteil wollte, dafür galt es unzählige Formulare auszufüllen.

Aber wichtiger als die Bürokratie sei etwas anderes gewesen: „Es ging um Ästhetik. Es musste alles gut aussehen. Vor allem große, sportliche Jungs wurden hier eingesetzt“, erzählt Baldwin. „Meine Uniform konnte allein stehen, so steif war sie, damit sie keine Falten warf. Die Schuhe blitzten. Das Häuschen roch ganz neu und nach Putzmittel.“

Der Kontrollposten und die GIs gehörten zum „Schaufenster des Westens“, als das die Amerikaner Westberlin verstanden. „Wir mussten unserem Gegner zeigen, wie wir aussehen – und zwar tiptop“, sagt Baldwin. „Militärstrategisch waren wir ja tot.“ Es gab zwar Szenarien, wie sich die Soldaten der Westalliierten im Kriegsfall auf das Gebiet der BRD hätten zurückziehen sollen. „Aber jeder wusste, dass das bei der Übermacht der Sowjets und NVA-Soldaten völlig aussichtslos gewesen wäre.“

Das Schaufenster des Westens

Er erinnert sich an eine Situation am Checkpoint, die ihm gezeigt habe, was das eigentlich bedeutete: Kalter Krieg. „Ich stand hier und sah jemand, der von der anderen Seite auf uns zurannte. Fünf Meter vor der weißen Linie ist der Mann gestolpert. Wir durften ihm nicht helfen. Wenn einer von uns nur einen Schritt über diese Linie gemacht hätte, wäre die Welt in der nächsten Minute nicht mehr in Ordnung gewesen.“ In dem Moment war der Kalte Krieg kein abstraktes Konzept mehr, kein komischer Arbeitsplatz in einem fernen Land, sagt Baldwin. „Es war plötzlich sehr ernst. Wir haben zugeschaut, wie der Mann abgeführt wurde.“

1992 scheidet er aus der Armee aus und bleibt in dem nun wiedervereinigten Berlin. Er arbeitet als Türsteher, wird feste Größe des Berliner Nachtlebens, 17 Jahre macht er die Tür des legendären Clubs „Cookies“. Er ist der Einzige aus seiner ehemaligen Einheit, der in Berlin geblieben ist.

Wie blickt er heute auf diesen geschichtsträchtigen Ort? „Was mit dem Checkpoint Charlie geschieht, ist allein Sache der Deutschen“, sagt Baldwin. „Mit dem Fall der Mauer und dem Abzug der Soldaten ist unsere Verantwortung dafür vorbei. Und das ist gut so.“

Die Zeit nach 1989 bedeutet für den Checkpoint Charlie erst mal Rückbau. Die Mauer ist durchlässig geworden, jetzt soll sie ganz weg. Zwischen Juli 1990 und November 1991 werden in Berlin 155 Kilometer Mauer abgerissen, 302 Beobachtungstürme, 20 Bunkeranlagen, dazu die Grenzübergänge. Den Anfang macht der Checkpoint Charlie. In einer feierlichen Zeremonie mit den Außenministern beider deutscher Staaten, der USA, Frankreichs, Großbritanniens und der Sowjetunion wird die Kontrollbaracke der Amerikaner am 22. Juni 1990 abtransportiert. Die 298th U.S. Army Band spielt dazu „Berliner Luft“. Die taz, deren Redaktionsgebäude um die Ecke liegt, schreibt: „Letzte Vorstellung für Onkel Charlie“.

Und zunächst gibt es keinen Plan, was mit dem ehemaligen Grenzübergang passieren soll. Von einem Ort des Geschehens zu einem Ort des Erinnerns – das geht nicht von heute auf morgen. Was eben noch Gegenwart war, ist nicht gleich Geschichte, und damit ist es auch nicht gleich erinnerungswürdig.

Ganz nah am Unrecht

Es gibt aber jemand, der am Checkpoint Charlie praktisch von Anfang an da ist. Jemand, der Räume füllt, die andere offen lassen. Rainer Hildebrandt, ein ehemaliger Widerstandskämpfer gegen die Nazis, eröffnet im Juni 1963 am Checkpoint sein Mauermuseum. Weil viele Geschäfte wegen der schlechten Lage nach dem Mauerbau 1961 wegzogen, kann er die Räume eines ehemaligen Cafés übernehmen. Axel Springer, der in der Nähe sein neues Verlagshaus baut, schickt einen Elektriker vorbei, der die Leitungen verlegt. Viele Redaktionen und Bildarchive stellen für die Ausstellung kostenlos Fotos zur Verfügung.

„So nahe wie möglich am Unrecht sein, dort entfaltet sich die menschliche Größe am stärksten“, erklärt Hildebrandt zur Eröffnung mit dem Pathos eines Freiheitskämpfers die Ortswahl. Das letzte Haus vor der Mauer ist damals auch nicht nur Museum. Fluchthelfer beobachten durch ein kleines Fenster alle Bewegungen am Grenzübergang, Geflüchtete werden aufgenommen, Fluchtpläne entwickelt.

Nach der Wende wollen Rainer Hildebrandt und seine Frau Alexandra den Checkpoint zu einem Denkmal für die Westalliierten machen, dafür soll auch die ehemalige Kontrollbaracke zurückkehren. Nicht die größere Baracke, die 1990 feierlich abtransportiert wurde, sondern eine Nachbildung der ersten Alliiertenbaracke aus den 60er Jahren. Eine winzige Holzhütte mit einem Schild auf dem Dach: US Army Checkpoint. Die Hildebrandts lassen sie anhand von Fotos nachbauen, am 13. August 2000 wird sie enthüllt.

Da war die Mauer für Merkel und Gauck noch ein Schutzwall.

2004 stirbt Rainer Hildebrandt. Im Inneren der nachgebauten Baracke erinnern ein Porträtfoto und ein Gedenktext an ihn, am Eingang des Mauermuseums steht eine eiserne Statue des Gründers. Das Museum selbst wirkt heute, als ob ein Messie mit Hang zur Zeitgeschichte sich mal so richtig austoben durfte.

Quelle              :         TAZ        >>>>>         weiterlesen

——————————————————————-

Grafikquellen        :

Oben      —         Passing Checkpoint Charlie on the way to Berlin (West) 14 November 1989

———————————–

2.) von Oben      —      Checkpoint Charlie

Abgelegt unter Berlin, Deutschland, Regierung, Schicksale | Keine Kommentare »

Von der CO2 – Steuer

Erstellt von DL-Redaktion am 9. November 2019

Lizenz zum Klima-Killen

Quelle      :   untergrund-blättle CH.

Von     Norbert Trenkle  streifzuege.org

Warum der Glaube an die CO2-Steuer illusionär ist und es keine „ökologische Marktwirtschaft“ geben kann. Von der CO2-Steuer zu sagen, sie erziele nicht die versprochenen Wirkungen, ist eine Verharmlosung.

Aufs Ganze betrachtet, wird sie weder eine nennenswerte Reduktion der klimaschädlichen Emissionen bewirken, noch gar eine „ökologische Transformation“ der Marktwirtschaft einleiten, sondern ist vielmehr ein Freibrief, den sich die Gesellschaft ausstellt, um genauso weitermachen zu können wie bisher. Um das zu verstehen, braucht es nicht viel Phantasie. Ein wenig Erfahrungswissen genügt. Selbst wenn die Steuer hier und dort gewisse Einspareffekte beim CO2-Ausstoss bewirken mag, ist doch völlig absehbar, dass diese durch einen gesteigerten Ressourcenverschleiss an anderer Stelle konterkariert werden. Dieser Mechanismus ist längst bekannt und wurde in der Postwachstums-Literatur breit diskutiert. So werden etwa relative Einsparungen beim Energieverbrauch (z.B. effizientere Motoren) durch eine Ausdehnung des absoluten Verbrauchs überkompensiert (z.B. grössere Autos und höhere Stückzahlen). Das ist der sogenannte materielle Rebound-Effekt.

Des Weiteren liefern politische Massnahmen mit einem ökologischen Anstrich die Legitimation dafür, die bestehende Produktions- und Lebensweise aufrechtzuerhalten und das Wirtschaftswachstum weiter anzukurbeln; denn schliesslich wurde ja vorgeblich bereits ein relevanter Beitrag zur Erhaltung von Natur und Umwelt geleistet. Man spricht hier von dem politischen Rebound-Effekt. Typisches Beispiel dafür war die Einführung der Abgaskatalysatoren in den 1980er-Jahren, welche die PKWs „umweltfreundlich“ machen sollte, tatsächlich aber lediglich das Alibi dafür lieferte, den Autoverkehr weiter auszubauen (seitdem hat er sich in Deutschland verdoppelt). Und schliesslich gibt es auch noch den psychologischen Rebound-Effekt, der darin besteht, den Konsumenten ein gutes Gewissen zu verschaffen, damit sie weiterhin ungehemmt den massenhaft produzierten Warenschrott kaufen.

Bedürfte es irgendwelcher Belege, dass die CO2-Steuer genau auf diese Weise wirken wird, die laufende Debatte liefert sie frei Haus. Alle politisch Verantwortlichen quer durch das gesamte Parteienspektrum überschlagen sich förmlich in der Anpreisung der erwarteten Einspareffekte, um dann sogleich hinterherzuschieben, die Steuer dürfe selbstverständlich die Gesellschaft nicht über Gebühr belasten. Am absurdesten sind die Vorschläge, die Einnahmen aus der neuen Steuer sogleich wieder an die Bevölkerung auszuschütten.

Denn auch wenn dabei tatsächlich diejenigen belohnt würden, die einen etwas niedrigeren CO2-Fussabdruck als der Durchschnitt aufweisen, werden sie sicherlich das zusätzliche Einkommen sogleich wieder im Konsum anlegen, so dass der Ressourcenverbrauch nur an anderer Stelle anfällt. Den Vogel abgeschossen hat in dieser Hinsicht mal wieder die Ökopartei CSU in Gestalt ihres obersten Umweltaktivisten Markus Söder, der ohne jeden Sinn für unfreiwillige Komik vorgeschlagen hat, die Belastungen durch die CO2-Steuer sollten durch eine Erhöhung der Pendlerpauschale kompensiert werden. Wer also mit dem Auto zur Arbeit fährt, wird zunächst an der Tankstelle zur Kasse gebeten, um das Geld dann über die Steuererklärung wieder zurückzubekommen.

Sollte die CO2-Steuer tatsächlich ökologisch einen nennenswerten Effekt haben, müsste sie hoch genug sein, um den Konsum aller energieintensiven Waren und Dienstleistungen massiv einzuschränken. Das beträfe dann allerdings fast die gesamte Palette des Konsums, angefangen beim Autoverkehr und der Heizung, über den Flugverkehr bis hin zu den meisten Industrie- und Agrarprodukten. Natürlich wird das nicht geschehen. Und zwar nicht einfach deshalb, weil die Interessenverbände der Industrie und der Wirtschaft das mit allen Mitteln zu verhindern suchen (das tun sie selbstverständlich), sondern weil keine relevante politische Partei sich an der inneren Logik eines Wirtschafts- und Gesellschaftssystems versündigen wird, das seinem Wesen nach auf dem Imperativ des endlosen ökonomischen Wachstums beruht.

Dieser Wachstumszwang resultiert daraus, dass im marktwirtschaftlichen System die Produktion gesellschaftlichen Reichtums aufs Ganze gesehen nur einem einzigen Zweck unterliegt: dem Zweck, aus Geld mehr Geld zu machen. Das Geld ist aber Ausdruck einer historisch ganz spezifischen Form gesellschaftlichen Reichtums. Es repräsentiert abstrakten Reichtum, Reichtum, der sich gleichgültig verhält gegenüber den stofflich-konkreten Grundlagen und Bedingungen seiner Produktion. Was zählt, ist allein, dass der Mechanismus der Geldvermehrung, also die Akkumulation von Kapital, in Gang bleibt, denn an ihm hängt die gesamte Gesellschaft wie der Junkie an der Nadel.

Die Produktion abstrakten Reichtums hat jedoch immer auch eine konkret-stoffliche Seite. Es werden Güter produziert, Transporte getätigt, Maschinen in Gang gesetzt, Rohstoffe geschürft, Wälder gerodet, und dabei wird natürlich immer auch Arbeitskraft vernutzt. All dies ist aber immer nur Mittel für den eigentlichen Zweck der Produktion. Die stofflich-konkrete Welt ist also der Produktion des abstrakten Reichtums untergeordnet. Und hiermit sind wir auch schon beim Kern des Problems. Denn anders als in der stofflich-konkreten Welt gibt es in der Welt des abstrakten Reichtums keine Grenzen. In ihr regiert das Gesetz der endlosen Vermehrung. Hat eine Summe Kapital einen Gewinn abgeworfen, fungiert dieser in der nächsten Periode selbst als Kapital und muss seinerseits Gewinn erzeugen, der dann auch wieder investiert werden muss, und so weiter und so fort.

Es liegt auf der Hand, dass diese Zwangsdynamik nicht kompatibel ist mit der natürlichen Begrenztheit der stofflich-konkreten Welt. Vielmehr läuft die Produktion abstrakten Reichtums zwangsläufig darauf hinaus, die natürlichen Lebensgrundlagen zu zerstören. Je weiter sich die kapitalistische Produktionsweise auf dem gesamten Globus durchsetzt hat und je weiter sie expandiert, desto schneller schreitet auch diese Zerstörung voran. Denn der Hunger der abstrakten Reichtumsproduktion nach stofflichen Ressourcen wächst in exponentiellem Massstab an. Das ist keine neue Einsicht. Schon im 19. Jahrhundert wiesen einige Autoren darauf hin – darunter auch ein gewisser Karl Marx. Und spätestens seit im Jahr 1972 der erste Bericht des Club of Rome erschien, ist die Erkenntnis, dass es „Grenzen des Wachstums“ gibt, auch ins allgemeine Bewusstsein durchgedrungen.

Dass trotzdem immer so weiter gemacht wird, als sei das alles eine Fussnote der Geschichte, liegt nicht an der Unfähigkeit der Politik oder an ihrem Unwillen, die Erkenntnisse der Wissenschaft ernst zu nehmen, wie viele in der Fridays for Future-Bewegung meinen. Der Grund ist vielmehr das ungeheure Beharrungsvermögen einer gesellschaftlichen Produktions- und Lebensweise, die sich mittlerweile auf der gesamten Welt durchgesetzt hat und daher als alternativlos erscheint. Denn auch wenn die allermeisten Menschen über kein Kapital verfügen, sind sie doch genauso darauf angewiesen, dass der Akkumulationsprozess in Gang bleibt.

Um unter den herrschenden Bedingungen zu überleben, müssen sie entweder ihre Arbeitskraft verkaufen oder hängen auf andere Weise von Geldflüssen ab, etwa in der Gestalt von Sozialleistungen, die aber auch aus dem Kreislauf des Kapitals gespeist werden müssen. Deshalb drehen sich auch die meisten Interessenkämpfe um die Verteilung von Geld und setzen den dahinterstehenden Mechanismus als selbstverständlich voraus. Das ist der tiefere Grund, weshalb das Wirtschaftswachstum den Status einer Religion geniesst und nur von gesellschaftlichen Minderheiten ernsthaft in Frage gestellt wird. Und das liegt nicht daran, dass die Menschen mehrheitlich dumm oder borniert wären. Sie wissen einfach nur sehr genau, dass unter den herrschenden Bedingungen eine Schrumpfung der Wirtschaft nichts Gutes für sie bedeuten würde.

Ein konsequenter und zeitnaher Umbruch der energetischen Basis wäre ein so gravierender Einschnitt, dass er sich insbesondere in den kapitalistischen Zentren gar nicht ohne schwerste ökonomische, soziale und politische Verwerfungen durchsetzen liesse. Denn die massive Entwertung bestehender Industrieanlagen und Infrastrukturen würde einen wirtschaftlichen Schock auslösen und eine schwere Krise nach sich ziehen, deren Kosten zudem sehr ungleich verteilt wären. Sie träfe vor allem jene Regionen und Bevölkerungsteile, die in besonderem Masse von den fossilen Industrien und Strukturen abhängig sind. Hinzu kämen noch die gewaltigen Kosten auf der Konsumseite. Millionen von konventionellen PKWs würden faktisch entwertet, Wohnhäuser müssten massenhaft neue Heizungen erhalten und wärmegedämmt werden, während gleichzeitig die Preise für praktisch alle Lebensmittel und Konsumgüter in die Höhe schössen. Auch hiervon wären wieder vor allem Menschen mit niedrigen und mittleren Einkommen betroffen, die über keine finanziellen Spielräume verfügen.

Bagger2Occupied! (26597515324).jpg

Wenn also die Gegner der CO2-Steuer diese als „unsozial“ brandmarken, dann haben sie durchaus starke Argumente auf ihrer Seite. Natürlich sind das ganz überwiegend Leute, denen die „soziale Frage“ sonst vollkommen egal ist und die sie hier nur aus durchsichtigen politischen und ideologischen Motiven instrumentalisieren. Dennoch verweisen sie auf ein durchaus ernst zu nehmendes Problem. Die ohnehin bestehenden sozialen und regionalen Disparitäten würden sich zweifellos deutlich vergrössern, und damit verschärften sich auch die gesellschaftlichen Verteilungskonflikte, wie jetzt schon an den Protesten der Gelbwesten deutlich wurde.

Hinzu kommt noch, dass der Streit um die Klimapolitik längst schon ideologisch und identitätspolitisch aufgeladen ist und die Gesellschaft polarisiert. Die Leugnung oder totale Relativierung des Klimawandels gehört nicht zufällig zum Kernbestand der rechtspopulistischen Ideologie. Denn diese stellt wesentlich eine regressive Reaktionsform auf die Erfahrung dar, dass die westlich-weisse Vorherrschaft auf der Welt an ihre Grenzen stösst. Deshalb hasst die rechtspopulistische Gefolgschaft mit besonderer Inbrunst alle jene, die sie an den Verlust ihrer vermeintlich selbstverständlichen Privilegien erinnern. Neben den Flüchtlingen sind das nicht zuletzt die Klimaschützer*innen, die sich dagegen wenden, die Kosten des Lebensstils in den kapitalistischen Zentren auf die übrige Welt und die kommenden Generationen abzuwälzen.

Aus dieser angespannten politischen und gesellschaftlichen Situation erklärt sich, weshalb der politische Diskurs unter dem Druck der Fridays for Future-Bewegung die Forderung nach einer CO2-Steuer zwar aufgegriffen hat, aber nur, um sie sogleich wieder auf ein homöopathisches Mass herunter zu dimensionieren. Auch die Grünen machen da keine Ausnahme. Sie treten jetzt schon auf die Bremse und werden das erst recht tun, wenn sie wieder an die Regierung gelangen sollten. Gemessen an dem engen Spielraum politischen Handelns unter kapitalistischen Bedingungen ist das durchaus rational; denn eine Regierung, die anders handelte, würde eine unkontrollierbare gesellschaftliche Konfliktdynamik auslösen und binnen kürzester Zeit gestürzt. Das wissen im Grunde auch diejenigen, die sich für eine konsequent hohe CO2-Steuer einsetzen. Sie verdrängen es jedoch mit der Behauptung, diese sei durchaus mit Wachstum und der Schaffung neuer Arbeitsplätze kompatibel; es handle sich lediglich um ein Steuerungsinstrument, um die marktwirtschaftlichen Aktivitäten in eine neue Richtung zu lenken und auf „nachhaltige“ Energieformen umzustellen. Angeblich soll es sogar möglich sein, mit solchen und ähnlichen Massnahmen eine „ökologische Marktwirtschaft“ durchzusetzen.

Im Prinzip teilen fast alle Ökonomen die Ansicht, dass sich Marktwirtschaft und Ökologie versöhnen liessen, wenn man es nur politisch geschickt anstelle. Gestritten wird lediglich darüber, welche Massnahmen besser zum Ziel führten. Besonders angepriesen wird der Handel mit Emissionszertifikaten als Alternative oder Ergänzung zur CO2-Steuer. Doch zum einen gibt es diesen ja schon seit fast 15 Jahren auf EU-Ebene, wo er sich als ein ziemlicher Flop erwiesen hat, was ihre Anhänger natürlich immer nur auf die fehlerhafte Anwendung zurückführen. Zum anderen bewegt sich auch diese Massnahme, selbst wenn sie einmal einigermassen funktionieren sollte, in dem gleichen Dilemma wie die CO2-Steuer. Wäre der Preis für die Zertifikate hoch genug, um eine ernsthafte Wirkung auf den CO2-Ausstoss zu haben, würde er das „Wachstum“, also die Dynamik der Kapitalakkumulation abwürgen. Und das darf natürlich nicht sein, weshalb es auch nicht verwundert, dass der Preis pro Tonne CO2 derzeit bei nur 25 Euro liegt. Und schliesslich stellt sich ohnehin die Frage: Wenn die Regierungen in der Lage sind, den CO2-Ausstoss der Unternehmen zu kontrollieren, warum schreiben sie dann nicht gleich entsprechende Grenzwerte vor, statt diese über den absurden Umweg eines höchst undurchsichtigen Marktes herstellen zu wollen?

Wenn überhaupt, sind es innerhalb der kapitalistischen Logik immer nur solche direkten staatlichen Vorgaben, die eine gewisse Wirkung erzielen können. Dagegen bedeutet der Versuch, beim Preismechanismus anzusetzen, immer nur einen Umweg zu nehmen, der bestenfalls minimale Wirkungen und immer negative Nebenwirkungen erzeugt. Das gilt für die CO2-Steuer und die Emissionszertifikate genauso wie für die Vorstellung, die Produktionsweise liesse sich durch eine mit moralischem Druck bewirkte Veränderung des individuellen Konsumverhaltens verändern. Populär sind solche Ideen nur deshalb, weil sie sich in die hegemoniale Ideologie einfügen, wonach der Markt durch die Summe der Entscheidungen von angeblich souveränen Individuen und Unternehmen gesteuert werde. Tatsächlich liegt jedoch der Antriebsmechanismus der kapitalistischen Dynamik in der Akkumulation von Kapital und damit in der Sphäre der Produktion, während Kaufentscheidungen immer nachgelagert und von dieser Dynamik abhängig sind.

Grundsätzlich ist die Vorstellung einer „ökologischen Marktwirtschaft“ nichts anderes als eine Seifenblase. Zwar kann der Kapitalismus prinzipiell in vielfältiger Weise reguliert und „eingehegt“ werden, auch wenn das im Zeitalter der Globalisierung immer schwieriger wird. (Ein „freier Markt“ ohne Regulierung existiert nur in den Horror-Phantasien der Hardcore-Liberalen; es hat ihn nie gegeben und es kann ihn nie geben.) Aber die Grundlogik des Wachstumszwangs, die auf dem Selbstzweck der Kapitalakkumulation beruht, lässt sich nun einmal nicht wegregulieren, weil sie den Wesenskern des marktwirtschaftlichen Systems ausmacht.

Selbst wenn es also tatsächlich gelänge, die energetische Basis kurzfristig umzustellen, würde das die Wucht der ökologischen Zerstörung bestenfalls ein wenig abbremsen und auf andere Gebiete verschieben. Schon jetzt werden quer durch die Bank so ziemlich alle Ressourcen knapp, das Trinkwasser und sogar der Sand als Grundstoff für die Bauindustrie. Und wenn tatsächlich der Individualverkehr auch nur grösstenteils auf Elektromobilität umgestellt würde, würde das zu extremen Engpässen bei der „nachhaltigen Stromproduktion“ führen und ausserdem den ohnehin erbitterten Kampf um die knappen, aber notwendigen Rohstoffe wie Lithium und die „seltenen Erden“ weiter anfachen. Alle diese Beispiele verweisen letztlich nur auf den unauflöslichen Grundwiderspruch, dass ein Produktions- und Wirtschaftssystem, das auf dem Imperativ der endlosen Kapitalakkumulation beruht, einfach nicht kompatibel ist mit der natürlichen Begrenztheit der Welt.

Befinden wir uns also in einer Sackgasse? Ist die Zerstörung der natürlichen Lebensgrundlagen unvermeidlich? Ja, aber nur, wenn wir die Logik des kapitalistischen Systems als unumstösslich akzeptieren. Wenn wir es jedoch wagen, sie grundsätzlich infrage zu stellen und praktisch zu durchbrechen, eröffnen sich neue Perspektiven. Die Alternative zur Marktwirtschaft kann dabei selbstverständlich nicht eine staatliche Planwirtschaft sein, wie wir sie aus den Zeiten des glücklicherweise verblichenen „Realsozialismus“ kennen. Denn der war nichts anderes als ein autoritär strukturierter, staatlich organisierter Kapitalismus. Auch hier stand die Produktion des abstrakten Reichtums im Mittelpunkt, nur bildeten sich Preise, Löhne und Gewinne nicht auf dem Markt, sondern wurden von der staatlichen Planungsbehörde vorgegeben. Und auch hier war das Wirtschaftswachstum der Massstab des Erfolgs, nur dass die staatlichen Strukturen einfach zu starr und behäbig waren, um mit dem Westen mithalten zu können, den sie eigentlich bloss im Ausmass der Umweltzerstörung übertrafen.

Die Frage, die sich heute stellt, ist nicht die nach mehr oder weniger Staat oder Markt. Sie geht weit über diese falsche Alternative hinaus. Die notwendige gesellschaftliche Transformation hat einen viel grundsätzlicheren Charakter. Sie betrifft nicht nur „die Wirtschaft“ und ihr Verhältnis zur „Ökologie“, sondern zielt auf einen weiten, qualitativ bestimmten Begriff von gesellschaftlichem Reichtum. Dieser schliesst zwar einerseits die Orientierung auf den stofflichen Reichtum ein, bedeutet also notwendig eine Aufhebung der abstrakten Reichtumsproduktion. Andererseits darf gesellschaftlicher Reichtum nicht auf die materielle Güterproduktion im engeren Sinne reduziert werden. Gesellschaftlicher Reichtum bedeutet auch und vor allem: Reichtum an sozialen Beziehungen, bedeutet die Möglichkeit, sich frei entscheiden zu können, in welcher Weise man gesellschaftlich tätig sein will. Es sind Städte, Ortschaften und Landschaften, in denen die Menschen sich wohlfühlen; es ist der Erhalt der natürlichen Umwelt und vieles anderes mehr.

Die Transformation der gesellschaftlichen Reichtumsform schliesst aber auch eine grundlegende Transformation der gesellschaftlichen Beziehungsform mit ein. Es geht um ein völlig anderes Verhältnis der Menschen untereinander, zu ihrem gesellschaftlichen Zusammenhang und zur natürlichen Umwelt. In der kapitalistischen Gesellschaft treten sich die Menschen als vereinzelte Einzelne gegenüber, die allesamt ihre partikularen Interessen gegeneinander verfolgen. Ihr Verhältnis ist das der allgemeinen Konkurrenz und der wechselseitigen Fremdheit; zugleich erscheint ihnen auch ihr gesellschaftlicher Zusammenhang als äusserlicher, fremder Gegenstand, zu dem sie sich instrumentell verhalten, so wie sie selbst ja nur Mittel im Dienste der abstrakten Reichtumsproduktion sind.

Keep-it-in-the-ground.jpg

Ausdruck davon ist die Verwandlung fast aller Beziehungen in Warenbeziehungen, was jeden und jede Einzelne dazu zwingt, sich ständig auf Marktfähigkeit und Verkäuflichkeit zu trimmen. Die Gleichgültigkeit der Menschen gegeneinander sowie gegenüber der Gesellschaft und den natürlichen Lebensgrundlagen ist also ein Strukturprinzip des Kapitalismus. Die Alternative dazu kann nur eine Gesellschaft sein, die auf den Prinzipien der freien Kooperation und der Selbstorganisation beruht und in der Individualität nicht auf Abgrenzung und Selbstbehauptung beruht, sondern die individuelle Entfaltung jedes und jeder Einzelnen die Voraussetzung für die individuelle Entfaltung aller anderen ist.

Das mag utopisch klingen, doch im Grunde ist der Boden dafür längst schon bereitet. Denn die kapitalistische Gesellschaft hat nicht nur gewaltige Gefahren und Bedrohungen hervorgebracht, sondern auch Potentiale, die in die oben gezeigte Richtung weisen. Allerdings können diese Potentiale nur in bewusster Frontstellung gegen die marktwirtschaftliche Logik verwirklicht werden. Denn andernfalls werden sie nicht nur neutralisiert, sondern verwandeln sich sogar in Triebkräfte für die weitere Beschleunigung der kapitalistischen Dynamik und der Zerstörung der natürlichen Lebensgrundlagen.

In besonderem Masse gilt das für die zunehmende Bedeutung der Produktivkraft Wissen für die Gesellschaft und die Reichtumsproduktion. Sinnvoll angewendet, würde sie es nicht nur ermöglichen, die für die Güterproduktion aufgewandte Zeit allgemein radikal zu reduzieren und trotzdem alle Menschen auf der Welt (und zwar wirklich alle) mehr als ausreichend mit stofflichem Reichtum zu versorgen. Sie birgt auch das Potential für eine ressourcenschonende und ökologisch verträgliche Produktion. Ein Beispiel: Durch eine umfassende Dezentralisierung der Produktionskreisläufe bei gleichzeitiger globaler Kooperation (freier Fluss des Wissens, Austausch der nicht regional verfügbaren Ressourcen etc.) würden nicht nur die Transportwege auf das nötige Mindestmass verkürzt, sondern die Produktionszusammenhänge und Ressourcenflüsse wären auch viel überschaubarer und einer bewussten Steuerung leichter zugänglich.

Unter dem Diktat der kapitalistischen Rentabilitätslogik geschieht jedoch das genaue Gegenteil. So wurde, zum ersten, zwar die Arbeitszeit in den industriellen Kernsektoren extrem reduziert, aber nur um massenhaft Arbeitskräfte „überflüssig“ zu machen und in prekäre Arbeitsverhältnisse abzudrängen, während die verbliebenen einem umso intensiveren Leistungsdruck ausgesetzt sind. Zweitens ist die Produktion nur in einem negativen Sinne „dezentralisiert“ worden, insofern nämlich die verschiedenen Produktionsabschnitte nach Kostenkriterien über den gesamten Globus verteilt wurden, was nicht nur mit einer extremen Ausbeutung der Arbeitskräfte in der Peripherie einhergeht, sondern auch allein wegen des gewaltigen Transportaufwands unter ökologischen Gesichtspunkten katastrophal ist. Und drittens schliesslich sind viele umweltfreundliche und dezentral anwendbare Technologien entweder verworfen worden, weil sie nicht „rentabel“ waren, oder wurden gleich von interessierten Unternehmen entsorgt, um sich so vor der Konkurrenz zu schützen.

In ähnlicher Weise werden beispielsweise die Fähigkeiten zur Kooperation und zum selbstständigen Arbeiten, die in den modernen Unternehmen immer wichtiger geworden sind, ständig durch die allgegenwärtige Konkurrenz und den Leistungsdruck sowie den permanenten Zwang zur „Marktfähigkeit“ konterkariert (was sich nicht zuletzt in einer starken Zunahme psychischer Leiden niederschlägt). Oder es ist die an sich vernünftige Idee, nicht alle möglichen Güter zu besitzen, sondern sie zu teilen und gemeinsam zu nutzen, innerhalb kürzester Zeit in ein neues Geschäftsfeld verwandelt worden, das den Grundgedanken der Sharing Economy in ihr glattes Gegenteil verwandelt hat.

So hat beispielsweise Uber die ohnehin schon prekären Arbeitsbedingungen im Transportgewerbe noch einmal verschlechtert und im Übrigen nicht etwa zur Reduzierung, sondern zur Zunahme des Autoverkehrs in den Städten beigetragen, weil viele Leute sich lieber von einem Dienstleistungssklaven chauffieren lassen als die U-Bahn oder den Bus zu nutzen. Und schliesslich ist auch das Internet längst schon in ein riesiges Geschäftsfeld für die Unterhaltungsindustrie, die Werbebranche und die unterschiedlichsten kriminellen Machenschaften sowie in ein gigantisches Überwachungsinstrument verwandelt worden, während die darin enthaltenen (und anfangs euphorisch gefeierten) Potentiale für eine global vernetzte Kooperation und den freien Fluss des Wissens nur noch in Nischen genutzt werden.

Die Aufzählung liesse sich fast endlos fortsetzen. Sie verweist auf die ungeheure Flexibilität und Attraktionskraft der kapitalistischen Logik, der es immer wieder gelungen ist, widerstrebende Tendenzen und Impulse zu integrieren und für die Fortsetzung der eigenen Akkumulationsdynamik nutzbar zu machen. Allerdings gibt es immer auch Einzelne, Gruppen und Initiativen, die sich dieser Logik widersetzen, auch wenn diese in der Regel randständig bleiben und erst im Rahmen von starken sozialen Bewegungen an Bedeutung gewinnen können. Hinzu kommt noch ein Weiteres.

Zwar verfügt das kapitalistische System über eine ungeheure Fähigkeit, die Grenzen seiner Existenz immer wieder hinauszuschieben, aber der Preis dafür ist eine Verschärfung des Krisenpotentials und der damit einhergehenden Zerstörungswucht. Das betrifft nicht nur den unauflöslichen Widerspruch zwischen dem Drang zur endlosen Kapitalakkumulation und der natürlichen Begrenztheit der Welt, der durch symbolische Massnahmen wie eine CO2-Steuer oder andere Ersatzhandlungen wie die Moralisierung des Konsums so lange verdrängt wird, bis er ein Ausmass erreicht, das tatsächlich die menschlichen Lebensbedingungen auf der Erde infrage stellt.

Auch auf der Ebene der ökonomischen Dynamik stösst der Kapitalismus mittlerweile an seine historischen Grenzen. Denn die umfassende und systematische Automatisierung und Digitalisierung der Produktion seit den 1980er-Jahren zog nicht nur eine enorme Erhöhung des Arbeits- und Leistungsdrucks nach sich, sondern hatte auch gewaltige Auswirkungen auf die Selbstzweckbewegung der Kapitalverwertung.

Da diese wesentlich auf der Anwendung von Arbeitskraft in der Warenproduktion beruht, löste deren massenhafte Verdrängung zwangsläufig einen fundamentalen Krisenprozess aus, der bis heute anhält. Zwar hat auch hier wieder das kapitalistische System seine Fähigkeit unter Beweis gestellt, die eigenen Widersprüche zu verdrängen; der Schwerpunkt der Kapitalakkumulation wurde auf die Ebene der Finanzmärkte verlagert, wo das fiktive Kapital, also der Vorgriff auf „zukünftigen Wert“ in der Gestalt von Anleihen, Aktien und anderen Finanzmarktpapieren seit bald vierzig Jahren den Takt der Weltwirtschaft vorgibt. Doch auch wenn es so gelang, die historischen Grenzen der Kapitalakkumulation noch einmal zu verschieben, ist der Preis dafür doch eine Vervielfachung des Krisenpotentials, das sich in wiederkehrenden Finanzmarktkrisen entlädt.

Da jeder dieser Krisenschübe aber mit schöner Regelmässigkeit durch die „Produktion“ von noch mehr fiktivem Kapital gelöst wird, also durch die Anhäufung von noch mehr Sprengstoff, fällt zwangsläufig jede nachfolgende Explosion umso heftiger aus. Schon jetzt zeichnet sich der nächste Crash an den Finanzmärkten ab, der die ökonomischen, sozialen und politischen Auswirkungen der Krise von 2008 bei Weitem in den Schatten stellen wird.

Für sich genommen, ist also die Tatsache, dass die kapitalistische Dynamik in mehrfacher Hinsicht an ihre historischen Grenzen stösst, keine gute Nachricht. Denn das kapitalistische System bricht nicht einfach zusammen und verschwindet im Nichts, vielmehr entfaltet es in dem Versuch, seine eigene Existenz zu verlängern, noch einmal eine ungeheure Zerstörungsgewalt und hinterlässt, wenn es nicht daran gehindert wird, die Erde als verwüstetes Feld. Verhindern kann das nur eine globale Bewegung, die sich entschlossen gegen die kapitalistische Logik stellt und zugleich das Terrain für eine selbstorganisierte, kooperative Gesellschaft jenseits der abstrakten Reichtumsproduktion erkämpft.

Antwort von Ende Gelände Satire.jpg

Der Weg in eine solche Gesellschaft führt nicht über die Parlamente, aber auch nicht über die klassische Revolution der bürgerlichen Epoche nach dem Muster von 1789 oder 1917. Denn diese zielte immer schon darauf, den Gewaltapparat des Staates zu okkupieren, um ihn als Agentur für eine gesellschaftliche Transformation von oben zu nutzen, und reproduzierte damit nur das bestehende Herrschaftsverhältnis, statt es aufzuheben. Eine kooperative, selbstorganisierte Gesellschaft beruht jedoch auf dem Prinzip der freiwilligen Assoziation der gesellschaftlichen Individuen und kann daher nicht von oben verordnet, sondern nur von einer globalen Emanzipationsbewegung in einer konfliktreichen Auseinandersetzung mit der bestehenden Gesellschaft entwickelt werden. Die Spielräume dafür müssen aber erkämpft werden: durch die Aneignung der nötigen Ressourcen (Grund und Boden, Gebäude, Produktions- und Kommunikationsmittel etc.) für den Ausbau der eigenen Strukturen und durch das aktive Zurückdrängen der abstrakten Reichtumsproduktion und ihrer ebenso imperialen wie destruktiven Dynamik.

Entscheidend wird dabei natürlich auch der Kampf um die Deutungshoheit in der Gesellschaft sein. Die beiden Gegner sind klar definiert. Das ist einerseits die liberale Simulations- und Postpolitik, die unter der Berufung auf „Sachzwänge“ das marktwirtschaftlich-kapitalistische System für alternativlos erklärt und allenfalls zu ein paar kosmetischen Korrekturen bereit ist. Und es ist andererseits die Neue Rechte, die sich als Gegenmodell zum Liberalismus profiliert, obwohl sie nur dessen regressives Spiegelbild darstellt und für eine autoritäre, rassistische und offen gewalttätige Zuspitzung der Krisendynamik steht. Dazwischen jedoch liegt ein breites und heterogenes Feld von Diskursen, Bewegungen und Initiativen, aus dem sich eine gesellschaftliche Gegenmacht bilden könnte, wenn eine neue Perspektive gesellschaftlicher Emanzipation sichtbar und praktisch greifbar wird und eine synthetisierende Kraft entfaltet.

Die Fridays for Future-Bewegung birgt durchaus die Potentiale, zur Initialzündung einer solchen Gegenmacht zu werden. Sie hat ein Bewusstsein für die existentielle und weltweite Dimension der Krise, sie ist global vernetzt und nicht-hierarchisch organisiert, sie will die Gesellschaft praktisch verändern – und sie hat die wichtige Erfahrung gemacht, dass sie mit entschlossenem Druck von unten gesellschaftlich und politisch etwas bewegen kann.

Ihre Schwäche besteht allerdings darin, dass sie mit ihrer Kritik und ihren Forderungen bisher noch ganz im Rahmen der herrschenden gesellschaftlichen Funktionsweise verbleibt und politisch vor allem die besonders konsequente Anwendung der CO2-Steuer und von ähnlichen politischen Instrumenten fordert sowie den Konsumverzicht propagiert. Damit bewegen sich die Protestierenden aber in einem Diskursfeld, in dem sie nur verlieren können, denn es ist ein Leichtes nachzuweisen, dass diese Forderungen mit der marktwirtschaftlichen Systemlogik nicht kompatibel sind. Will die Fridays for Future-Bewegung in der Offensive bleiben, muss sie daher dazu übergehen, diese Logik radikal infrage zu stellen. Tut sie es nicht, wird sie dabei zusehen müssen, wie ihr Protest gegen den Klimawandel in eine Lizenz zum Klimakillen verwandelt wird.

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

————————————————————–

Grafikquellen          :

Oben         —        Aktivistinnen und Aktivisten auf der Nord-Süd Bahn.

—————————–

2.) von Oben      —     This years Ende Galeande not just shut down the mine, railroad transport and Schwarze Pumpe electrical power plant but also broke records in number of activists taking part in its action over 3500 and generated global attention for Climate Justice.

—————————-

3.) von Oben       —        Blick auf den Tagebau Welzow Süd mit Ende Gelände Transparent „Keept it in the ground“.

——————————–

Unten        —      Ende Gelände reagiert auf den Vorwurf Vattenfalls, es hätte eine „Spur der Verwüstung hinterlassen“.

Abgelegt unter Bildung, Brandenburg, Nordrhein-Westfalen, Überregional, Umwelt | Keine Kommentare »

KOLUMNE MACHT

Erstellt von DL-Redaktion am 9. November 2019

Schluss mit der Altersdiskriminierung!

File:Maischberger - 2016-12-14-7439.jpg

Von Bettina Gaus

Der CDU-Politiker Daniel Günther, 46, mag recht haben mit seiner Kritik an den CDU-Mitgliedern Friedrich Merz und Roland Koch, 63 und 61. Nur: Warum spielt er auf ihr Alter an?

Wie lange will man leben? Manche möchten unbedingt Zeitzeugen der ersten menschlichen Kolonie auf dem Mars werden, andere – wie mein Vater, dem das leider nicht vergönnt war – die vollständige Freigabe der Akten des Mordes an John F. Kennedy erleben. Mal sehen, was länger dauert. Ich bin bescheidener.

Mir genügt es, wenn ich noch um den Weg bin, sobald Daniel Günther älter ist als 60 Jahre. Falls der heute 46-jährige Ministerpräsident von Schleswig-Holstein sich treu bleibt, dann muss er von diesem Zeitpunkt an in der Öffentlichkeit die Klappe halten. Ein Grund zur Vorfreude.

Bisher wollte ich Günther gar nicht zum Schweigen bringen. Das hat sich erst nach seiner Kritik an dem ehemaligen CDU-Spitzenpolitiker Friedrich Merz, 63, geändert, der das Erscheinungsbild der Bundesregierung als „grottenschlecht“ bezeichnet hatte. Als der ehemalige hessische Ministerpräsident Roland Koch, 61, der Bundeskanzlerin „Argumentationsenthaltung“ vorwarf, gab es für Daniel Günther kein Halten mehr. Er lederte los.

Die CDU bräuchte nicht „irgendwelche Personalquerelen von älteren Herren“, sagte er im Interview. Und: „Das sind einige, die früher einmal Verantwortung getragen haben und jetzt glauben, dass sie sich noch einmal ein bisschen wichtig darstellen können.“ Fazit: „Jeder hat seine Zeit.“ Dieser Satz gefällt mir besonders gut.

Jeder hat seine Zeit. Herr Günther entscheidet, wann die abgelaufen ist. Nein, tut er nicht.

2018-12-07 Daniel Günther CDU Pateitag in Hamburg-2519.jpg

Immer diese Provinz – Kasper, können gerade noch über den Tisch sehen. Da gab es doch eine Ministerin welche sich zur Sekretärin degradieren ließ ! Heute hört sie auf das Kommando: Weglaufen und Schießen.

Die Gesellschaft hat sich mehrheitlich darauf verständigt, Menschen nicht wegen ihrer Hautfarbe, ihrer Religionszugehörigkeit oder wegen ihres Geschlechts benachteiligen zu wollen. Lange genug hat es gedauert. Das klappt nicht immer, ist aber gewünscht. Siehe Grundgesetz.

Aber es geht nicht nur um rechtliche Regelungen. Es geht auch um Kränkung. Andernfalls wäre die jahrzehntelange Debatte um korrekte Formulierungen überflüssig – die manchmal, ja, nervtötend war und ist. Daniel Günther betreibt Altersdiskriminierung. Es wäre nett, wenn die Herabsetzung älterer Menschen ebenfalls irgendwann geächtet würde. Gesetzlich und gesellschaftlich. Nein, nicht nur nett. Überfällig.

Quelle       :         TAZ          >>>>>           weiterlesen

———————————————————————-

Graflkquellen       :

Oben     — 

This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
Attribution: © Raimond Spekking / CC BY-SA 4.0 (via Wikimedia Commons)

——————————-

Unten        —      Daniel Günther auf dem 31 Parteitag der CDU Deutschlands in Hamburg, Messe Hamburg

Abgelegt unter Opposition, P.CDU / CSU, Regierung, Schleswig-Holstein | Keine Kommentare »

Überfälliger Denkmalssturz

Erstellt von DL-Redaktion am 8. November 2019

Ein Profiteur der Nazis

Bundesarchiv B 145 Bild-F004204-0003, Ludwig Erhard mit seinem Buch.jpg

Von Ulrike Herrmann

Ludwig Erhard wird bis heute gefeiert – dabei hat er eng mit Gauleitern und NS-Behörden kooperiert. Und bestens daran verdient.

 Die Nachkriegszeit hat ein Gesicht: Ludwig Erhard. Vor siebzig Jahren wurde die erste Bundesregierung vereidigt und vor allem ihr Wirtschaftsminister ist unvergessen. In Deutschland sind Straßen, Festsäle und Schulen nach Erhard benannt. Erhard bediente, wonach sich viele Westdeutsche sehnten: Er inszenierte sich als politikferner „Professor“, der über den Parteien stand. Zugleich suggerierte Erhard, dass er zu NS-Zeiten eine Art Widerstandskämpfer gewesen sei. Doch diese Legenden sind falsch. Erhard war ein Profiteur des NS-Regimes und hat hochbezahlte Gutachten für Gauleiter und Himmler-Behörden verfasst.

Erhards NS-Vergangenheit ist historisch bestens dokumentiert, wird aber bis heute tatkräftig verschwiegen. Das neue Ludwig-Erhard-Museum in Fürth behauptet etwa, dass er die NS-Diktatur „in einer Art Nische“ überstanden hätte. Dieser ungebrochene Erhard-Kult zeigt beispielhaft, dass die Deutschen die NS-Vergangenheit noch immer nicht vollständig aufgearbeitet haben.

Erhard hat die meisten seiner Lügen wahrscheinlich selbst geglaubt, denn sie halfen ihm, schwere Niederlagen zu verbrämen. Dies begann bereits mit seiner Habilitation. Später hat Erhard behauptet, er hätte auf eine „akademische Laufbahn verzichten“ müssen, weil er kein Nazi gewesen sei. Dem italienischen Premier Aldo Moro erzählte Erhard beispielsweise, er sei zu Hitlers Zeiten „verfemt und geächtet“ gewesen und habe „seine Professorentätigkeit nicht ausüben dürfen“.

Die Wahrheit ist weniger schmeichelhaft: Erhards Habilitation scheiterte nicht am NS-Regime, sondern an seiner eigenen Unfähigkeit. Er brachte zwar 141 Seiten zu Papier, aber der Inhalt war so dürftig, dass Erhard das Werk lieber nicht einreichte. Die NSDAP war jedenfalls nicht schuld, dass Erhard nicht zum Professor aufrückte. Nürnbergs NS-Bürgermeister Eickemeyer wollte ihn sogar ohne Habilitation mit dem Titel ehren, stieß jedoch auf den Widerstand des standesbewussten bayerischen Kultusministeriums: Es fehle „ein umfangreiches wissenschaftliches Werk“, wurde aus München beschieden.

Erhard war damals Geschäftsführer beim Nürnberger Institut für Wirtschaftsbeobachtung der deutschen Fertigware, das eigentlich Marktforschung betrieb. Aber ab 1938 tat sich ein neues Thema auf, weil sich das Hitler-Reich Gebiete einverleibte – ob Österreich, das „Sudetenland“, das „Protektorat Böhmen und Mähren“, Lothringen oder das „Warthegau“: Es gab kaum ein Gebiet, über das Erhard keine Studie erstellte.

Aufträge von Gauleiter Bürckel

Besonders eng arbeitete Erhard mit Josef Bürckel zusammen, der erst Gauleiter in Wien und dann in Lothringen war. Zwei Expertisen stechen heraus: Anfang 1942 sollte Erhard die „Gesichtspunkte“ untersuchen, die bei der „Verwertung des volksfeindlichen Vermögens zu beachten“ seien. Damit war das Eigentum von deportierten Juden und missliebigen französischen Politikern gemeint.

Konrad Adenauer - Im Gespräch mit Ludwig Erhard-kasf0104.JPG

Beide kämpfen um ihre Vergangenheit .

Auch die zweite Expertise hatte mit diesem Themenkomplex zu tun: In den enteigneten Betrieben waren NS-Manager eingesetzt worden, die sich oft als extrem korrupt und unfähig erwiesen, so dass Erhard nun die „Problematik der kommissarischen Verwalter“ beleuchten durfte. Erhard war also bestens über die Judenverfolgung informiert – und gedachte davon zu profitieren, indem er Gutachten einwarb. Nach dem Krieg verbreitete Ludwig Erhard die Legende, er habe in Lothringen nur die Glasindustrie untersucht.

1940 tat Erhard zudem einen weiteren Großkunden auf – die „Haupttreuhandstelle Ost“, die im annektierten Polen tätig war. Mehrfach bereiste Erhard diese Gebiete und sprach dort mit den „verschiedensten und maßgebendsten Stellen“, wie er in einem Brief an Nürnbergs NS-Bürgermeister Eickemeyer herausstrich. Erhard kannte also das Grauen, das sich in Polen abspielte.

Massenmord als „Evakuierung“

Die polnische Elite war bereits im Herbst 1939 ermordet worden, um jeden Widerstand zu brechen: 20.000 Politiker, Priester, Professoren, Lehrer und Adlige wurden als Geiseln erschossen oder bestialisch niedergemetzelt. Diesen Massenmord umschrieb Erhard später in einem Gutachten euphemistisch als „Evakuierung der sogenannten polnischen Intelligenz“.

Die restliche Bevölkerung wurde ausgehungert und teilweise deportiert, weil die Gebiete möglichst schnell „eingedeutscht“ werden sollten. Bis Mai 1941 wurden 320.000 Polen aus dem Warthegau und aus Westpreußen in Züge gepfercht und in den Osten Polens abtransportiert, wo es für sie weder Nahrung noch Unterkünfte gab. Gleichzeitig wurden 160.000 Juden in das Ghetto von Lodz gezwängt und später ermordet.

Maischberger - 2019-03-06-6426.jpg

Erhards neuer Großkunde, die „Haupttreuhandstelle Ost“, war Teil dieser brutalen Gewaltherrschaft: Sie sollte die konfiszierten polnischen Betriebe verwalten, verwerten und an Deutsche übertragen. Allerdings zogen gar nicht genug qualifizierte „Volksdeutsche“ ins Warthegau um, so dass es mehr enteignete Firmen als deutsche Interessenten gab. Erhard sollte daher ein wirtschaftspolitisches Gesamtkonzept entwerfen, wie sich der „neue deutsche Ostraum“ entwickeln ließe.

Rassistische Klischees

Im Sommer 1941 war der Vorbericht fertig, in dem es nicht an rassistischen Klischees fehlte. So schrieb Erhard beispielsweise: „Der polnische Arbeiter hat sich ja als willig und fleißig erwiesen, wenn auch seine Leistung nicht an reichsdeutschen Maßstäben zu messen ist. Dies ist der Ausfluss mangelnder Erziehung und rassisch bedingter Eigenschaften.“ Erhard stellte daher fest: „Das polnische Volk hat weder die Gestaltungskraft noch den Gestaltungswillen, die es zu so wahrhaft kultureller Leistung befähigt.“ Erhards implizite Botschaft: Die Polen konnten froh sein, dass sie von den Deutschen unterworfen und enteignet worden waren, denn nun übernahm der germanische Sachverstand.

Quelle          :          TAZ           >>>>>          weiterlesen

———————————————————————–

Grafikquellen         :

Oben      —       For documentary purposes the German Federal Archive often retained the original image captions, which may be erroneous, biased, obsolete or politically extreme. Herr Dr. Wehrenkamp (Ukon Verlag) überreicht Dr. Ludwig Erhard sein Buch „Wohlstand für Alle“

—————————–

Unten       —          MAISCHBERGER am 6. März 2019 in Köln. Produziert vom WDR. Thema der Sendung: „Attacke auf die Reichen: Beschimpfen, besteuern, enteignen?“ Foto: Ulrike Herrmann, Journalistin

Abgelegt unter Bildung, Bücher, Deutschland, Finanzpolitik | Keine Kommentare »

Nach dem Untergang

Erstellt von DL-Redaktion am 8. November 2019

Knappe Nachricht von den Deutschen

File:Die Gartenlaube (1871) b 672.jpg

Heim ins Reich und wo findet wer die Karrenbauer ?

Quelle         :     untergrund:blättle CH.

Von Eckharh Mieder

Was haben die Deutschen erfunden?
Das Auto und die Kriege,
Die nach dem Untergang
Als Weltkriege in den Büchern
Der Überlebenden und sonstigen Aliens
Eingetragen sind.

Die Deutschen sind freundliche Menschen.
Sie fassen alles korrekt an. Messer und
Gabeln beherrschen sie. Und das Auslöffeln auch.
Niemand von ihnen hat die Absicht,
Mauern zu bauen oder Flughäfen
Oder Gräben zwischen Mensch und Mensch
Auszuheben.

Das haben die Deutschen noch erfunden: zum einen
Den Kommandoton, zum anderen
Das Winseln vor den Stiefeln, die sie
Selber tragen oder vor denen sie sich
Verneigen dürfen. Aber
Sind die Deutschen damit speziell?

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

——————————————————————

Grafikquelle         :      Die Gartenlaube. / Ernst Keil (PD)

Abgelegt unter Bildung, Deutschland, Feuilleton, Regierung | Keine Kommentare »

Diskriminierung Sinti+Roma

Erstellt von DL-Redaktion am 8. November 2019

Ein Senator, seine Polizisten und 86 Trickdiebe

File:20060817 diosig.jpg

Da wären wir dann wieder bei den typisch – teutschen Legenden über die Clan – Familien  gelandet !!

Eine Kolumne von

In einer Berliner Polizeistatistik lebt die unselige „Sonderbehandlung“ von Sinti und Roma fort. Der Innensenator sieht weder Erklärungs- noch Gesprächsbedarf. Ein Lagebild.

Sachverhalt

Die Polizeiliche Kriminalstatistik für Berlin 2017 führte unter „einfacher Diebstahl“ 158.000 Fälle auf. Als Tatverdächtige erfasst wurden 79.000 deutsche und 59.000 nicht deutsche Personen. Die Zahl der sogenannten Trickdiebstähle betrug 2044 (davon 500 Versuche). Als „Trickdiebstahl in Wohnungen“ wurden 1248 Fälle erfasst; die Gesamtschadenssumme betrug hier sechs Millionen Euro. Es handelt sich also um etwa sechs Promille der Diebstahlstaten; der Schaden betrug acht Promille des durch Eigentums- und Vermögenskriminalität verursachten Gesamtschadens von 642 Mio. Euro. Es wurden 86 Tatverdächtige erfasst: 53 männliche, 33 weibliche (41 deutsch, 45 nichtdeutsch). Der Anteil der wegen Trickdiebstahl in Wohnungen verdächtigen Personen betrug damit 0,6 Promille der 138.000 wegen Diebstahl Verdächtigen. Auf Seite 48 des Berichts ist im Anschluss an die Fall- und Verdächtigenzahlen zum Trickdiebstahl in Wohnungen ausgeführt:

„Bei den hierzu durch die Fachdienststelle ermittelten Tatverdächtigen handelt es sich überwiegend um Angehörige der Volksgruppe der Sinti und Roma. Diese Familienclans leben mittlerweile seit Jahren in Deutschland und besitzen überwiegend die deutsche Staatsangehörigkeit.“

Am 7. Dezember 2018 wandte sich der Vorsitzende des Zentralrats Deutscher Sinti und Roma, Romani Rose, an den Senator für Inneres und Sport von Berlin, Andreas Geisel (SPD), und bat, die Praxis zu erklären und zu beenden. Der Senator antwortete am 21. Januar 2019:

Drafi Deutscher – Sinti

„Die von Ihnen kritisierte Textpassage … basiert nicht auf der Erfassung Tatverdächtiger als Angehörige der Volksgruppe Sinti und Roma, sondern auf der fachlichen Einschätzung der für die Bekämpfung der gewerbsmäßigen Bandenkriminalität zuständigen Dienststelle des LKA. Eine solche Einschätzung wird nur in begründeten Einzelfällen publiziert.“

Am 21. Februar 2019 fragte der Vorsitzende des Zentralrats nach, in welcher Weise Sinti und Roma vom LKA erfasst werden, und bat erneut um ein Gespräch mit dem Senator. Dieser antwortete im April, die Aussagen ergäben sich „aus Erkenntnissen aus der Vorgangsbearbeitung und nicht aus der Erfassung von Minderheitenzugehörigkeit“ und seien im Einzelfall sachgerecht. Für ein Gespräch sehe er keinen Anlass.

Diese Familienclans

Die zitierte Passage ist nur zwei Sätze lang, aber bemerkenswert. Die Aussage, bei den Tatverdächtigen handele es sich überwiegend um Sinti und Roma, hat keinen statistischen Wert. Was sich daraus ergeben soll, dass für 1250 registrierte Taten insgesamt mindestens 44 Tatverdächtige als Sinti oder Roma bezeichnet wurden, ist nicht erkennbar. Gespenstisch ist der nachfolgende Satz: „Diese Familienclans leben mittlerweile seit Jahren in Deutschland.“ Von „Familienclans“ war zuvor nicht die Rede; das Wort „diese“ kann sich also nur auf die Volksgruppe der Sinti und Roma beziehen. Die Gleichsetzung der Zugehörigkeit zu dieser Minderheit mit „Familienclans“ ist schon im Ansatz verfehlt, da nicht alle Sinti und Roma als „Clan“ definierbaren Familien angehören. De Begriff „Clan“ ist hochgradig unklar und bedürfte, um Aussagekraft zu erlangen, einer sorgfältigen und sachbezogenen Definition. Abwegig ist der Hinweis, „diese Clans“ lebten „mittlerweile seit Jahren in Deutschland“. Damit wird eine definitorische Verbindung zwischen konkreten Tatverdächtigen des Jahres 2017 und einer durch ethnische (Sinti und Roma) und kulturelle („Familienclans“) Merkmale beschriebenen Bevölkerungsminderheit hergestellt. Unerfindlich ist schließlich, welche inhaltliche Bedeutung der Hinweis im Sachzusammenhang haben soll: Dass Sinti und Roma „mittlerweile seit Jahren“ in Deutschland leben (tatsächlich sind es 600 Jahre), ist eine banale und für den Zusammenhang unverständliche Information.

Die Fall- und Verdächtigenkennziffern der PKS bieten keine Grundlage für eine statistische Differenzierung zwischen ethnischen Gruppen innerhalb von Angehörigen desselben Staats. Das gilt für die Zuordnung zu den ethnischen Minderheiten der Friesen, Dänen, Sorben und der Sinti und Roma gleichermaßen, im Übrigen auch für religiöse, weltanschauliche, politische Differenzierungen. Es fehlt überdies auch jeder Hinweis darauf, wie und von wem festgestellt wurde, ob die jeweils Tatverdächtigen Sinti oder Roma waren.

Deshalb ist die Reaktion des Senators auf die Einwendungen des Zentralrats nicht verständlich. Seine Erklärung, die zitierten Aussagen ergäben sich nicht aus der statistischen Erfassung von ethnischen Merkmalen, sondern aus „Vorgangsbearbeitungen“, beantwortete die gestellte Frage nicht. Wenn bei der Vorgangsbearbeitung im Einzelfall ein entsprechender Hinweis an die Polizei erfolgt, kann er nur dann für eine Statistik verwendet werden, wenn solche Hinweise systematisch erfasst und dokumentiert werden. Wenn die Vielzahl der Einzelfallerkenntnisse nicht ausgewertet und zusammengeführt würde, wäre die Aussage, „überwiegend“ Sinti und Roma seien tatverdächtig, von vornherein haltlos. Wenn sie das nicht sein soll, muss sie auf einer systematisch-empirischen Differenzierung nach dem Merkmal „Sinti und Roma“ beruhen. Eine dritte Möglichkeit gibt es nicht. Beide Möglichkeiten sind aber gleichermaßen sachfern und unzulässig.

Polizeiaufgaben

Aufgaben der Polizei sind Strafverfolgung und Prävention. Die PKS dient daneben als Grundlage kriminologischer Forschung, zur allgemeinen sicherheits- und kriminalpolitischen Orientierung sowie als Tätigkeitsdokumentation der Polizei. Die Erfassung ethnischer Merkmale könnte theoretisch kriminalistische Funktionen erfüllen. Dies wäre aber – die verfassungsrechtliche Zulässigkeit vorausgesetzt – allenfalls dann sinnvoll, wenn signifikante Merkmale flächendeckend und systematisch erhoben und ausgewertet würden: etwa Merkmale wie Sprache/Dialekt, soziale Herkunft, Bildungsstand, Ausbildung und Tätigkeit, Familienstand, Wohnort. Solche Merkmale werden in der PKS aber nicht erhoben. Ethnische Merkmale werden an keiner anderen Stelle der PKS erfasst als bei dem Hinweis auf die „überwiegende“ Zahl von Sinti und Roma an den 86 des Trickdiebstahls Verdächtigen.

Für die Verfolgung von Straftaten des Trickdiebstahls hat die Mitteilung, dass mehr als die Hälfte der ermittelten (86) Tatverdächtigen angeblich der Bevölkerungsgruppe der Sinti und Roma angehören, keinen Wert. Kriminalistische Erkenntnisse über konkrete Täter haben kaum allgemeinen Wert; umgekehrt können allgemeine Aussagen solche Erkenntnisse nicht ersetzen. Für die Prävention könnte der öffentliche Hinweis allenfalls die Funktion haben, zu besonderer Vorsicht und Misstrauen gegenüber Mitgliedern der Bevölkerungsgruppe anzuhalten. Selbst wenn das zulässig wäre, erhöht es die Sicherheit des einzelnen potenziell Betroffenen kaum. Völlig unklar bleibt, woran die Bürger die Mitglieder der Gruppe erkennen sollen, sofern nicht grob vereinfachende, vorurteilsgestützte und empirisch falsche Zuschreibungen erfolgen. Eine Prävention, die potenzielle Opfer nicht vor bestimmten Tatmodalitäten und Gefahrensituationen, sondern vor den Mitgliedern bestimmter ethnischer Gruppen warnt, ist daher von vornherein in der Sache kontraproduktiv und verfehlt, unabhängig von ihrer verfassungsrechtlichen Problematik.

Effekte, erwünschte und unerwünschte

Quelle          :         Spiegel-online            >>>>>           weiterlesen  

———————————————————–

Grafikquellen           :

Oben       —         Romafamilie (? niet zeker…) in West Roemeens dorp voor hun huis 2006

Author John Klungers
This file is licensed under the Creative Commons Attribution 3.0 Unported license.

——————————–

2. von Oben          —      Stage act 1989

———————————–

Unten         —       Thomas Fischer auf der re:publica 2016

Abgelegt unter Deutschland, Innere Sicherheit, International, Justiz-Kommentare, Regierung | Keine Kommentare »

Ab in den Pazifik

Erstellt von DL-Redaktion am 8. November 2019

Kramp-Karrenbauers Grundsatzrede

Manfred Weber, Annegret Kramp-Karrenbauer and Ursula von der Leyen.jpg

Gefährliche Spielchen unter Blinde !

Von Tobias Schulze

Die Verteidigungsministerin will die Bundeswehr in mehr und riskantere Einsätze schicken. Damit übertrifft sie noch mal den bisherigen Regierungskurs.

Annegret Kramp-Karrenbauer hat es derzeit nicht leicht: Als CDU-Parteichefin steht sie intern in der Kritik, als Verteidigungsministerin scheiterte sie zuletzt mit ihrem Vorschlag einer internationalen Schutzzone für Nordsyrien. Genau der richtige Zeitpunkt also für einen Befreiungsschlag?

Am Donnerstagvormittag trat Kramp-Karrenbauer vor Studierenden der Bundeswehr-Universität München auf. Das Verteidigungsministerium hatte vorab eine „Grundsatzrede“ angekündigt – und lag damit zumindest nicht ganz falsch.

Die Verteidigungsministerin verlangte während ihrer knapp 40-minütigen Rede, dass Deutschland in internationalen Konflikten stärker mitmischt und die Bundeswehr stärker im Ausland einsetzt als bisher. Ähnliche Vorschläge gibt es von deutschen Regierungsvertretern zwar schon seit Jahren, Kramp-Karrenbauer ging aber über bisherige Forderungen noch mal hinaus. Zentral waren fünf Punkte.

Führungsrolle

Bislang nahm die Bundeswehr vor allem an Einsätzen teil, die von den USA, der Nato oder anderen initiiert wurden. In Zukunft soll Deutschland, wenn es nach Kramp-Karrenbauer geht, selbst vorangehen. „Nicht einfach nur abwarten, ob andere handeln, und dann mehr oder weniger entschlossen mittun. Wir müssen selbst Vorschläge machen, Ideen entwickeln, Optionen vorstellen“, sagte sie in München.

Ihr Vorschlag einer internationalen Schuttzone für Nordsyrien im Oktober war ein Versuch in diesem Sinne, scheiterte aber daran, dass weder der Koalitionspartner noch andere Staaten mitmachen wollten. In ihrer Rede am Donnerstag sprach die Verteidigungsministerin diesen Vorschlag nicht mehr an.

Kampfeinsätze

In den letzten Jahren leistete die Bundeswehr in Auslandseinsätzen vor allem Unterstützung für andere – etwa durch Ausbildung kurdischer Kämpfer im Nordirak oder durch Luftaufnahmen über Syrien. Im Vergleich zu Kampfeinsätzen wie im Jugoslawien- oder Afghanistan sind solche Einsätze weniger aufwendig, weniger risikobehaft und innenpolitisch leichter durchzusetzen.

Kramp-Karrenbauer will die Bundeswehr in Zukunft aber wieder häufiger kämpfen lassen. Sie forderte in München „die Bereitschaft, gemeinsam mit unseren Verbündeten und Partnern das Spektrum militärischer Mittel wenn nötig auszuschöpfen“.

Quelle         :           TAZ            >>>>>          weiterlesen

AKK’s Pläne für die Bundeswehr

Deutschland überall

SD hosts German Minister of Defense 190923-D-BN624-197 (48782888293).jpg

Unter fremder Fahne

Kommentar von Tobias Schulze

Die Bundesrepublik trägt international Verantwortung. Einsätze am anderen Ende der Welt anzuführen ist trotzdem Quatsch. Und auch nicht machbar.

Eins kann man Verteidigungsministerin Annegret Kramp-Karrenbauer nicht nachsagen: Dass ihr für die Bundeswehr nicht genügend Einsatzgebiete einfallen würden. Die Idee, deutsche SoldatInnen nach Nordsyrien zu schicken, hat sie mangels Konzept und Unterstützung gerade erst verworfen. Dafür setzte sie jetzt in einer Grundsatzrede gleich zwei neue Ziele auf die Liste: Im Pazifik sollen deutsche Kriegsschiffe gegen China „Präsenz zeigen“, in der Sahelzone sollen SoldatInnen der französischen Armee bei der Terrorismusbekämpfung helfen. Überhaupt soll die Bundeswehr wieder häufiger kämpfen, statt nur zu unterstützen, und internationale Einsätze anführen, statt sich nur an ihnen zu beteiligen.

Von „Verantwortung“ spricht Kramp-Karrenbauer dabei. Ein anderer Begriff würde es allerdings besser treffen: Aktionismus.

Quelle        :          TAZ           >>>>>>          weiterlesen

AKK, die Traumtänzerin

————————————————————-

Grafikquellen :

Oben          —            Manfred Weber, Annegret Kramp-Karrenbauer and Ursula von der Leyen

——————

Unten      —      U.S. Secretary of Defense Dr. Mark T. Esper hosts German Minister of Defense Annegret Kramp-Karrenbauer, at the Pentagon, Washington, D.C., Sept. 23, 2019. (DoD photo by Lisa Ferdinando)

Abgelegt unter Deutschland, International, Kriegspolitik, Regierung | Keine Kommentare »

Debatte um Mietendeckel

Erstellt von DL-Redaktion am 7. November 2019

Wohneigentum ist keine Schande

File:Potsdamer Platz, Berlin, April 2016.JPG

Kommentar von Anja Maier

Die Diskussion um den Mietendeckel wird grotesk: Einige arbeiten sich an Eigentümern einzelner Wohnung ab. Der Feind ist ein anderer.

Fangen wir mit den Begrifflichkeiten an. Gerade hat der Berliner Senat den sogenannten Mietendeckel beschlossen. Ein richtig blödes Wort, das doch eigentlich etwas Gutes meint. Deckel auf Töpfen, in denen es brodelt und kocht, waren noch nie eine gute Idee, weder physikalisch noch politisch. So betrachtet darf meine Geburtsstadt Berlin künftig als einzigartige sozialpolitische Versuchsanordnung betrachtet werden: Entweder das Ding fliegt irgendwann komplett in die Luft. Oder der Deckel bleibt drauf und am Ende werden alle satt – auch die bislang hungrig Gehaltenen.

Eigentlich handelt es sich beim Mietendeckel um einen auf fünf Jahre begrenzten Mietenstopp. Betroffen sind davon anderthalb Millionen hauptstädtische Wohnungen, was bei dreieinhalb Millionen BerlinerInnen keine Kleinigkeit ist. Künftig müsse jene um ihr als Naturrecht verstandenes Renditeversprechen bangen, die schon bisher den Hals nicht voll bekommen haben: Anleger von börsennotierten Immobilientrusts, denen die Menschen in ihren „Mietsachen“ herzlich egal sind. Zumindest solange sie ohne zu mucken pünktlich zum 1. d. M. zahlen.

Das Problem ist nun jedoch, dass das Leben, wie so oft, nicht ganz so eindimensional zu erklären ist. Denn weil es den anonymen Immobilienmillionären aus Barcelona, Moskau oder Bad Godesberg bislang herzlich egal war und weiterhin ist, wenn Menschen in Berlin, München oder Frankfurt sauer auf sie sind und vor Sorge um ihren Platz im Leben schlecht schlafen, verlegen sich kritische MieterInnen neuerdings lieber darauf, EigentümerInnen einzelner Wohnungen oder Häuser zu schmähen.

Statt sich prinzipiell und gemeinsam gegen den überhitzten Wohnungsmarkt und globale Hedgefonds zu positionieren, richtet die Wut sich der Einfachheit und ideologischen Übersichtlichkeit halber auf EigentümerInnen einzelner Wohnungen und Grundstücke. Leute also, die sich privat Geld für einen Kredit borgen, sich von ihren Eltern und Großeltern schon zu deren Lebzeiten ihr Erbe oder einen Teil davon auszahlen lassen oder – ja, das gibt es – die ganz gut verdienen.

Bei Twitter etwa wurde diese Woche eine Kollegin, die den Mietendeckel wegen seiner Auswirkungen auf KleinvermieterInnen kritisiert hat, teils aufs Übelste beschimpft. Sie bekam Drohmails, wurde sexistisch angegangen oder ultimativ aufgefordert, ihre private finanzielle Situation öffentlich darzulegen. Sie wurde als wahlweise dummes junges Ding oder abtrünnige Neoliberale geschmäht.

Der schlichte argumentative Angang in der Debatte ist in der Regel etwa dieser: Dass du eine Wohnung bezahlen kannst, ich aber nicht, beweist, dass du ein privilegiertes Arschloch bist. Es wird dann gern ein bisschen persönlich, die Aufforderung, sich für Privatestes zu rechtfertigen, steht im Raum. Der eigene Distinktionsgewinn, zumal im zeigefreudigen digitalen Raum, wächst bei ansteigendem Ton recht angenehm.

Hier meine Gegenthese: Sorry, Wohneigentum ist keine Schande, erst recht nicht, wenn es um die selbst genutzte Immobilie geht.

Um die Sache hier etwas zu verklaren, soll nicht unerwähnt bleiben, dass ich als Autorin dieses Textes glasklar der Arschloch-Fraktion angehöre. Ich besitze mit meinem Mann ein Haus im Brandenburgischen, das wir vor über zwanzig Jahren mit Unterstützung durch unsere Familien anfinanziert und dann fleißig abbezahlt haben. Wir waren Anfang dreißig, hatten zwei kleine Kinder und keinen Bock mehr, jeden Monat die üppige Szenequartier-Miete zu zahlen. Dann doch lieber das bisschen Geld, das wir verdienten, in was Eigenes investieren. Klingt uncool? War es auch. Aber eben auch nicht unschlau.

Wir hatten damals, Mitte der Neunziger, nicht gut verhandelt, der Kasten war im Grunde zu teuer und für den Preis nicht im allerbesten Zustand. Als dann während der deutschen Wirtschaftskrise in den 2000er Jahren der Wert der Immobilie sank und sank, befürchteten wir, das Ersparte unserer Nachkriegs-Elterngeneration hoffnungslos in den märkischen Sand gesetzt zu haben.

Unsere Stimmung hellte sich erst wieder etwas auf, als die ersten Freunde und Kollegen uns scheinbar nebenbei fragten, ob da draußen in den Weiten Brandenburgs noch etwas käuflich zu erwerben sei. Wenn diese hippen Hobos zu uns in die Provinz kommen wollten, dachten wir, mussten wir wohl irgendwas richtig gemacht haben. Und da hatten wir verdammt noch mal recht.

Quelle        :         TAZ          >>>>>         weiterlesen

——————————————————————-

Grafikquellen         :

Oben         —         Potsdamer Platz, Berlin, April 2016

Author Another Believer       /       Source   :    Own Work
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.

—————————-

Unten      —         Kanaldeckel auf dem Odeonplatz München – hier hört man einen unterirdischen Stadtbach rauschen: besichtigt auf der Radtour zu den Münchner Stadtbächen am 17.5.12, Wikipedia-Stammtisch München

This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
Author Amrei-Marie

Abgelegt unter Berlin, Deutschland, Positionen, Regierung | Keine Kommentare »

Doppeldeutige Revolution

Erstellt von DL-Redaktion am 7. November 2019

Die Fälschung der Geschichte : 30 Jahre 1989
Die Narren der Politik lassen sich für die Erfolge des V0lkes feiern.

Von Jens Reich

Für die politischen Ereignisse, die im Herbst 1989 ihren Anfang nahmen und nach einem turbulenten Jahr am 3. Oktober 1990 mit dem Beitritt zur Bundesrepublik das Ende der DDR besiegelten, haben sich in der kollektiven Wahrnehmung zwei konkurrierende Bezeichnungen und ein weltweit anerkanntes Ereignis von symbolischer Wirkung festgesetzt. „Wende“ und „Friedliche Revolution“ sind die beiden Sammelbezeichnungen, und das symbolische Ereignis ist der „Fall der Mauer“ am 9. November 1989. Alle drei Begriffe haben in den drei Jahrzehnten seither neben ihrem faktischen Inhalt einen propagandistischen Beigeschmack bekommen.

Das Wort „Wende“ hat eine nicht aufhaltbare Karriere im Sprachgebrauch gemacht, weil es in der Alltagssprache kurz und geschmeidig den Bezug auf die Zeit vor und die nach 1990 herzustellen gestattet: „vor der Wende“ und „nach der Wende“. Viele Zeitgenossen von damals, mich eingeschlossen, finden das ärgerlich, weil das Wort, das vor 1989 in der Bundesrepublik der Kohl-Ära im politischen Sprachgebrauch war, von den ums politische Überleben ringenden SED-Machthabern (Egon Krenz vor allem) als Vorspiegelung einer das System rettenden Kurskorrektur übernommen wurde. Das Volk wollte mit einer solchen Wende definitiv nichts zu tun haben, und der Volksmund (schon vor Christa Wolf in ihrer Rede vom 4. November) nannte die solche friedlichen Reformen beteuernden Genossen „Wendehals“. Zufällig war der Spechtvogel Wendehals 1988 von Ornithologen zum Vogel des Jahres ausgerufen worden, und das lieferte dem Karikaturisten der „Zeit“ die Anregung zu einer hoch amüsanten Karikatur. Sie stellte einen im gezackten Loch der Berliner Mauer sitzenden, stark gerupften Vogel mit der unverkennbaren Physiognomie des Egon Krenz dar: „Wendehals, Vogel des Jahres“.

Seitdem bemühen sich Aktivisten der damaligen Umwälzung ebenso wie Journalisten und Zeithistoriker darum, anstelle der Wende die umständliche Fügung „Friedliche Revolution“ als den Sachverhalt treffende Bezeichnung in den kollektiven Sprachgebrauch zu integrieren. Auch diese Wendung hat unverkennbar überredende Absicht. „Friedlich“ im Sinne von „friedfertig“ war die Volkserhebung gewiss nicht, „gewaltfrei“ wäre das passende Adjektiv, und ob es tatsächlich eine Revolution gewesen ist, darüber streiten die Theoretiker bis heute. Wer in der DDR zur Schule gegangen ist und danach noch weiter Zeitung gelesen hat, begreift unter diesem Schlüsselbegriff der marxistischen Lehre (mit dem paradigmatischen Beispiel der Großen Französischen Revolution von 1789) eine gewaltsame (!) Umwälzung der grundlegenden Eigentums- und Produktionsverhältnisse und der zugehörigen Staatsstruktur und damit des gesamten Überbaus, also der gesellschaftlichen und kulturellen Lebensverhältnisse der Bevölkerung eines Landes. Dass so etwas 1989 stattgehabt hat, wird wohl jeder intuitiv bestätigen, der zur Bevölkerung dieses Staates gehört hat, ungeachtet jeder politologischen Interpretation.

Bleibt man bei der marxistischen Staatsdoktrin, dann wird man allerdings vielleicht eher der Bezeichnung „Konterrevolution“ zustimmen müssen, denn intuitives Ziel und erreichtes Ergebnis der Volksbewegung war definitiv nicht die Errichtung einer neuen Gesellschaftsordnung, sondern die Wiederherstellung einer vormaligen, näherungsweise vielleicht des Weimarer Systems. Dass es die Übernahme der gesamten gesellschaftlichen Ordnung der Bundesrepublik werden würde, und nicht allein ihres Wohlstands, hatten vielleicht manche von Anfang an im Sinn, waren jedoch später besorgt und hätten gern manches Gewohnte behalten. Anders kann ich mir jedenfalls den Stoßseufzer nicht erklären, den ich nach 1990 oft gehört habe, als es Realität wurde: „Dafür haben wir die Revolution nicht gemacht!“

Mit „Fall der Mauer“ ist das eigentliche Ereignis ebenso unklar beschrieben. Die Mauer fiel ja gar nicht, metaphorisch begriffen, durch Einwirkung des Volkes um (wie in der Bibel bei Josua 6:20: „Da erhob das Volk ein großes Kriegsgeschrei, und man blies die Posaunen. Da fiel die Mauer um…“) – das Verdienst für die Öffnung am 9. November kommt vielmehr Günter Schabowski zu („sofort, unverzüglich…“), sowie dem Grenzpolizisten Harald Jäger („Wir fluten jetzt!“). Das revolutionäre Volk verhielt sich brav und versprach: „Wir kommen zurück!“, ließ sich den Ausweis zur vermeintlichen Dauer-Ausreise stempeln und inspizierte den Westen.

Wir sind das und/oder ein Volk

Ähnlich doppeldeutig stehen die beiden berühmten, damals vor allem in Leipzig gerufenen Losungen „Wir sind das Volk“ und, Wochen danach: „Wir sind ein Volk“. Der erste Slogan lässt sich sehr energisch von einer anonymen Menge skandieren, mit deutlichem Akzent auf dem alle vereinigenden „Wir“, und er suggeriert die Fortsetzung „…und nicht ihr da oben, ihr SED-Bonzen und Blockflöten!“. Beim zweiten Slogan ergibt sich kein solcher taktgerechter Rhythmus, weil die Betonung auf das Wort „ein“, das als Variation des ersten auftrat, sich nicht einstellen will – der zweite Satz rumpelt vielmehr synkopierend dahin. Skandiert man den zweiten Satz so energisch wie den ersten, dann verkrümelt sich das unbetonte „ein“ in die Umgebung von „ein beliebiges“ und lässt unartikuliert zurück, dass bereits damals die tendenzielle Spaltung bestand zwischen denen im „einigen Volk“, die den Beitritt sofort und bedingungslos wollten, und den anderen, die sich ihm gegenüber zögernd oder sogar ablehnend verhielten.

Diese Doppeldeutigkeit wohnte dem umstürzenden Aufbruch von Anfang an inne. Die widersprüchlichen Begriffspaare „Oben-Unten“, „Ost-West“ „Umwälzung-Kurskorrektur“, „liberal-illiberal“ waren in jenen Wochen alle gleichzeitig handlungswirksam vorhanden, aber eine Entscheidung wurde vertagt und bis heute nicht eingelöst. Im Gegenteil: Nachdem die Hängestellung eine Dekade lang beruhigt erschien, brechen nun, im dreißigsten Jahr danach, die Widersprüche als Feldzeichen politischer Gegensätze wieder auf.

Drängten die Fordernden und Handelnden damals mit dem Ruf „Wir sind ein Volk“ auf Öffnung der Mauern, auf Sprengung der Grenzen, nach Freiheit, „ins Offene“, so skandieren sie heute wieder „Wir sind das Volk“ (und diesmal nicht „ein Volk“) und meinen neue Abgrenzung und Ausgrenzung, Wiederherstellung von Kontrolle und Ablehnung jeglicher Veränderung, wie sie die globale Entgrenzung mit sich bringt. Die vehemente öffentliche Zurückweisung von Bewegungen wie AfD und Pegida durch eine Mehrheit der Bevölkerung bedeutet auch, dass man die im eigenen politischen Denken vorhandenen ambivalenten Tendenzen verdrängen möchte.

Gerade die im Osten politisch erwachsen Gewordenen leben heute mit zwiespältigen Tendenzen: Damals war die Mehrheit vehement für die schnelle Wiedervereinigung, heute gilt sie als von der Bonner Elite übergestülpt. Analog unterstützen heute die meisten, dass Flüchtlinge aufgenommen werden, aber meinen gleich darauf, dass der anstehende globale Flüchtlingsstrom eingegrenzt werden müsse, um das prekäre Gleichgewicht zwischen Freiheit und Sicherheit nicht zu gefährden. Fehlende Sicherheit bezieht sich dabei sowohl auf global entstehende Zumutungen wie auf intern aufgebrochene soziale und politische Konflikte.

Neue Krisen, neue Polarisierungen

Vor zehn Jahren, also zum 20. Jubiläum des Herbstes 89, konnte man meinen und habe auch ich gemeint, dass die mehr oder weniger gelungene Revolution zur Vergangenheit gehöre, alle Messen gelesen und ihr Kanon in zahllosen Büchern, Zeitschriftenartikeln und Audio- und Videodokumentationen niedergelegt wäre. Der gewaltlose Volksaufstand habe im Osten die Bürgerfreiheiten und Menschenrechte wiederhergestellt und im Übrigen eine Gesellschaft gebildet, die sich mental und in ihrer Wirtschaftsverfassung dem Vorbild der Bundesrepublik West langsam annähere. Die politische Willensbildung und ihre Realisierung liefe weitgehend über die Parteien, die aus der Zivilgesellschaft Wünsche und Forderungen aufnähmen, diese auf Durchführbarkeit und Mehrheitsfähigkeit prüften und gegebenenfalls über Parlamente und Regierungen realisierten. Offen blieb allerdings die Frage, ob diese Demokratie wirklich stabil wäre, wenn es zu ernsten gesellschaftlichen Krisen käme.

Krisen, von außen hineingetragene wie intern entstandene, haben wir seitdem in der Tat zahlreich erlebt. Und von grundlegenden Lösungen sind wir weit entfernt: Die Träger des politischen Handlungsmandats „fahren auf Sicht“, versuchen unbefriedigende Kompromisse und schieben die prinzipiellen Entscheidungen dilatorisch in die Zukunft.

Wendehals (Jynx torquilla)

Wendehals (Jynx torquilla)

Die politische Stimmung im Wahlvolk tendiert derweil zu je einem von zwei kaum zu vermittelnden Polen: einerseits liberal, menschenrechts- und bürgerfreiheitlich gesinnt, weltoffen, einwanderungsfreundlich, reformgläubig und Europa-affin und andererseits autoritär, nationalbewusst, migrationskritisch, abgrenzungs- und kontrollorientiert. Für die einen hat der Staat als Hauptaufgabe, die Freiheit des Individuums zu gewährleisten, während die anderen die Herstellung von Sicherheit und Ordnung für vorrangig erklären. Hinsichtlich der die Zukunft entscheidenden ökologischen Frage halten die einen radikalen Umbau der die Biosphäre als Ganzes gefährdenden Lebensweise für notwendig, meist ohne sich der einschneidenden Konsequenzen für das eigene Leben bewusst zu werden. Andere bestreiten die Krise oder halten sie für nicht beeinflussbar oder meinen auch, dass wenn eine ausbräche, sie durch technische Erfindungen und Maßnahmen durch „Wachstum“, ohne Verzicht, aufzulösen sei.

Der mentale Graben zwischen den beiden Tendenzen prägt sich im Gebiet der vormaligen DDR am deutlichsten aus. So deutlich, dass es schwierig wird, handlungsfähige Landesregierungen und teilweise auch kommunale politische Verwaltungen zu bilden.

Quelle         :         Blätter            >>>>>          weiterlesen

———————————————————————-

Grafikquellen             :

Oben         —        Transparent gegen Wendehälse bei einer Montagsdemonstration

Abgelegt unter Deutschland, Opposition, Regierung, Traurige Wahrheiten | Keine Kommentare »

AKL – Thüringen-Wahl:

Erstellt von DL-Redaktion am 7. November 2019

Linke Positionen in Gefahr

2019-10-27 Wahlabend Thüringen by Sandro Halank–54.jpg

Quelle      :     AKL 

Von Steve Hollasky, Dresden

Keine Kooperation mit den bürgerlichen Parteien – für ein sozialistisches Regierungsprogramm!

Drei Dinge zeigen die Landtagswahlen in Thüringen: Dreißig Jahre nach der Revolution gegen die in der DDR herrschende stalinistische Bürokratie befinden sich die bürgerlichen “Volks”parteien SPD und CDU weiterhin in ihrer tiefsten Krise seit 1945; die gesellschaftliche Polarisierung schreitet fort und der Anpassungskurs eines Teils der LINKEN erreicht zu einer Zeit, in der linke Positionen wie zum Beispiel die Forderung nach Enteignung der Immobilienhaie oder kostenlosem öffentlichen Personennahverkehr Zuspruch in größeren Teilen der arbeitenden Bevölkerung bekommen, eine neue Qualität. Und es stellt sich die Frage, was man mit der jetzigen Situation anfangen solle. Die Regierungsbildung gestaltet sich schwierig und in den Führungskreisen der LINKEN wird offen über ein Bündnis oder Kooperation mit der CDU schwadroniert.

Krise der Etablierten

SPD und CDU haben in Thüringen erneut Verluste hinnehmen müssen. Die Sozialdemokrat*innen büßten 4,2 Prozentpunkte ein und stürzten auf ein Thüringer Allzeittief von 8,2 Prozent. Weit dramatischer fielen die Verluste der CDU aus. Mit 11,7 Prozentpunkten minus im Vergleich zu 2014 fiel sie noch hinter der AfD auf Platz drei und landete bei 21,8 Prozent der Stimmen.

Abgestraft wurden bei der Wahl am Sonntag die Regierungsparteien im Bund – und zwar unabhängig davon, ob sie sich in Thüringen aktuell in der Regierung befinden, wie die SPD, oder aber in der Opposition, wie die CDU. Damit setzte sich augenscheinlich der Trend der letzten Landtagswahlen in Sachsen und Brandenburg fort.

Mehr noch, die schleichende Krise den Unionsparteien scheint nun auch offen auszubrechen. Bislang konnten sich die in Wahlumfragen geschwächten CDU und CSU mit Blick auf die SPD als gesund präsentieren. Anders als die SPD fuhr man keine einstelligen Ergebnisse ein. Dass diese Zeiten nun aber vorbei sein könnten, meint auch Ursula Münch, Politikwissenschaftlerin an der Akademie für politische Bildung in Tutzingen und Mitglied im Wirtschaftsrat der Bundesregierung. Im Interview mit der tagesschau erklärte sie am 29.10., der CDU drohe aus ihrer Sicht „das gleiche Schicksal wie der SPD“. Auch vorgezogene Neuwahlen im Bund schloss Münch in diesem Interview nicht aus.

Die Zerschlagung der Industrie durch die Treuhand nach 1990, die Wiedereinführung kapitalistischer Verhältnisse und die anhaltende Perspektivlosigkeit in ganzen ostdeutschen Landstrichen, hat die Menschen in den neuen Bundesländern nicht nur ungeheuer wütend gemacht, sondern in der Folge auch von den Etablierten entfremdet.

Gesellschaftliche Polarisierung

Nicht selten vernimmt man zur Beschreibung der politischen Lage das Wort „Rechtsruck“. Dass dies nur eine ungenaue Wiedergabe der Situation ist, zeigt das Wahlergebnis in Thüringen. Was sich zusehends abspielt, ist eine Polarisierung nach links und rechts. Nicht nur die AfD erzielte Zugewinne und schnellte auf 23,4 Prozent, wodurch sie Platz 2 besetzte. Auch die LINKE fuhr ein Plus von immerhin 2,8 Prozentpunkten ein und landete bei 31,0 Prozent. Dabei hat auch die Regierung unter Bodo Ramelow in der Koalition mit SPD und Grünen nicht eine grundlegende andere Politik gemacht, die klar erkennbar im Interesse der Masse der arbeitenden Bevölkerung ist. So bekam in der Konsequenz diese Regierung keine Mehrheit. Viele wählten die LINKE als stärkste Kraft, um zu verhindern, dass die AfD stärkste Kraft wird, so wie es auch in Brandenburg mit der SPD oder in Sachsen der CDU der Fall war. Doch Rot-Rot-Grün hat den Aufstieg der AfD in Thüringen nicht verhindert.

Die gern erwähnten Einstellungen von Lehrer*innen in Thüringen sind bei Weitem nicht ausreichend. Und die Gemeindereform des Landes Thüringen bedeutete in der Realität nur längere Wege für Anwohner*innen, weil Ämter verlegt oder geschlossen wurden. Wirklich linke oder gar sozialistische Maßnahmen wie Initiativen zur Rekommunalisierung von Wohnraum oder Kliniken sucht man in den vergangenen fünf Jahren vergebens.

Dass die Thüringer Linkspartei ausgerechnet mit Ramelow an der Spitze dennoch ihr bestes Ergebnis überhaupt einfuhr, beflügelt nun den rechten, in der Konsequenz prokapitalistischen Teil der LINKEN. Dietmar Bartsch, Vorsitzender der Fraktion der Linkspartei im deutschen Bundestag, erklärte inzwischen, man müsse an den Erfolg von Bodo Ramelow anschließen und als Bundespartei davon lernen“. Das ist aber genau der falsche Weg und die Linken in der LINKEN müssen jetzt klar dagegen halten.

Gerade die Tatsache, dass die LINKE die Wut über Sozialabbau, Niedriglohnpolitik und Rentenkürzungen nicht zum Ausdruck bringt und konsequente Lösungen anbietet, macht es der AfD leicht. Auf rechtspopulistische Art verbindet sie soziale Demagogie mit dem Gift des Rassismus und Nationalismus. So erklärte Höcke im Wahlkampf gern, Zuwanderer würden gute medizinische Versorgung erhalten und Hiergeborene hätten mit dem Pflegenotstand zu kämpfen. Darauf aufbauend versucht die Thüringer AfD unter der Führung von Höcke, rechtsextreme Positionen zu verankern und hoffähig zu machen. Dass die Positionen der AfD Lügen sind, wird dann leichter zu erklären, wenn Migrant*innen, Geflüchtete und Hiergeborene gemeinsam gegen den Pflegenotstand kämpfen. Das zu organisieren wäre eigentlich Aufgabe der LINKEN.

Anpassungskurs der LINKEN

Dass die LINKE auch nach dieser Wahl einen anderen Weg, nämlich den des Parlamentarismus und Regierungsbeteiligung beschreiten wird, steht zu befürchten. Schon kurz nach der Wahl rief die Führung der Thüringer LINKEN nicht etwa zu Kämpfen auf, sondern erklärte die grundsätzliche Verhandlungsbereitschaft mit allen im Landtag vertretenen Parteien, mit Ausnahme der rechtspopulistischen AfD.

Was damit gemeint war, offenbarte sich schnell. Als der konservative Spitzenkandidat, Mike Mohring, am Tag nach der Wahl im ARD-Morgenmagazin, ganz anders als noch am Abend zuvor, verkündete, seine Partei müsse nun „Verantwortung übernehmen“, sprang die LINKE-Führung sofort auf den Zug auf. Ramelow erklärte, man werde sehen, was möglich sei, „eine festere Koalition, eine absolute Koalition oder ein Tolerierungsmodell“. Unterstützung kam von der LINKEN-Bundesspitze. Bernd Riexinger meinte glatt, der Ball läge im Feld der CDU. Eine Absage an ein Bündnis mit einer Partei, die für die Situation in Ostdeutschland verantwortlich ist, kam nicht. Die Befürchtung, die LINKE könnte sich wirklich auf ein Bündnis mit der CDU einlassen war jedoch fehl am Platz. Aber nicht, weil die LINKE dieses Angebot prinzipienfest ablehnte, sondern, weil die CDU und auch Mike Mohring die diesbezüglichen Andeutungen wieder zurückzog. Das spricht Bände über die Situation in der LINKEN, wo führende Teile die Partei lieber als “verlässlichen” Bestandteil des Establishments sehen wollen, anstatt als Partei des Widerstands.

Was jetzt?

DIE LINKE muss endlich aufhören, das Bündnis mit den Sozialabbauparteien einzugehen und stattdessen das Bündnis mit der arbeitenden Bevölkerung und den Gewerkschaften schmieden, um den gemeinsamen Kampf mit Beschäftigten, Arbeitslosen, antirassistischen Initiativen, Rentner*innen und Mieter*innen zu organisieren. Das Potenzial dafür besteht auch unter dem mit Abstand erneut größten Teil aller Wahlberechtigten – den Nicht-Wähler*innen, die weder dem bürgerlichen Einheitsbrei, noch den Rechtspopulisten etwas zutrauen. Wenn aber die LINKE in Thüringen zum festen Bestandteil dieses Establishments wird – und das wäre bei einem Bündnis mit der CDU der Fall – dann wird für noch mehr Menschen der scheinbar einzige Weg ihre Wut zu artikulieren das Kreuz bei der AfD sein. Das darf man nicht zulassen.

Datei:Goldlauter-Blick.jpg

Eine Regierung der LINKEN in dieser Situation kann nur eine Minderheitsregierung mit sozialistischem Programm sein. Die müsste ohne Zweifel um jedes kleine Gesetz kämpfen. Gerade dazu müsste sie die lohnabhängig Beschäftigten unabhängig von Herkunft, Sprache, Religion, Alter oder Geschlecht mobilisieren. Das zu erreichen wäre ohne Frage nicht leicht. Es wäre zudem nur möglich, wenn man der Bevölkerung zeigen würde, dass eine LINKE-Regierung wirklich in ihrem Interesse wäre. Das Programm für eine solche Regierung müsste aus Eckpunkten bestehen wie der Kommunalisierung von Wohnraum unter demokratischer Kontrolle die Mieter*innen, Verstaatlichung von Pflegeinrichtungen und Krankenhäusern, massiven Stellenaufbau an den Schulen, eine Absage an die Schuldenbremse und stattdessen die Besteuerung der Reichen, sowie antirassistische Mobilisierungen gegen AfD und Co. Eine solche Landesregierung könnte – sogar aus der Minderheit heraus – zu einem bundesweiten Fokus von Opposition gegen eine immer schwächer werdende Bundesregierung werden und den Widerstand gegen Sozialabbau, den Kampf für wirkliche Verbesserungen inspirieren und voran bringen. Sozialistische Ideen könnten wieder greifbar werden. Das wäre auch ein großer Schritt auf dem Weg hin zu einer sozialistischen Massenpartei. Und es wäre das wirksamste Mittel gegen Rechts, um die Basis der AfD zu untergraben.

Würde man dieses Programm vertreten, könnte man den Landtag von außen mit einer großen Bewegung unter Druck setzen. Doch Ramelow wird diesen Weg nicht gehen. Auch da braucht man sich keiner Illusion hinzugeben. Eine Koalition der LINKEN unter der Führung von Ramelow mit – oder Tolerierung von – Sozialabbauparteien, von SPD, Grünen, FDP und CDU, wird in Thüringen leider kaum zu verhindern sein. Wahrscheinlich sogar dann noch, wenn die zu erwartende Wirtschaftskrise hart zuschlagen und die Lebensbedingungen der arbeitenden Bevölkerung stark einschränken wird. Das zeigt, dass es darauf ankommt um grundlegende Positionen innerhalb der LINKEN bundesweit zu kämpfen. Dafür muss man jetzt endlich die linke Opposition in der LINKEN organisieren. Sol tut das im Rahmen der AKL. Wir fordern alle auf, uns dabei zu unterstützen.

akl - Antikapitalistische Linke

—————————————————————–

Grafikquellen         :

Oben          —         Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

 

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Linke PV am 27. /28. 10. 19

Erstellt von DL-Redaktion am 6. November 2019

Konversion der Autoindustrie, Geschlechterparität im Bundestag und Thüringen-Wahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle     :  AKL

Bericht von Lucy Redler

Der Parteivorstand (PV) widmete sich am Sonntag, 27.10. schwerpunktmäßig einer interessanten Debatte über die Zukunft der Autoindustrie, einem Gesetzesentwurf zur Herstellung von Geschlechterparität im Bundestag und der Vorbereitung der Strategiekonferenz der LINKEN am 29.2. bis 1.3.2020 in Kassel.

Am Montag, 28.10. ging es neben der Wahlauswertung in Thüringen vor allem um die neue Forderung der LINKEN zur Mindestsicherung. Darüber hinaus gab es Berichte aus dem Jugend- und Studierendenverband und wurden etliche weitere Vorlagen beschlossen. Da Thies Gleiss derzeit leider die Stimme versagt, verantwortet Lucy Redler diesen Bericht allein.

Autoindustrie

Bernd Riexinger hatte eine Diskussionsvorlage zur Zukunft der Autoindustrie und deren „soziale, ökologische, demokratische Transformation“ eingereicht, die auf hohem Niveau diskutiert wurde. In der Debatte ging es um das von ihm vorgeschlagene Ziel der Halbierung der Anzahl der Autos bis 2030, ob E-Autos eine Alternative sind oder nicht, die nötige Konversion der Produktion, einen Fünf-Stufen-Plan zum kostenfreien ÖPNV, das Ziel einer emissionsfreien Wirtschaft in 15 bis 25 Jahren, der Forderung nach Arbeitszeitverkürzung bei vollem Lohnausgleich und Fragen der Vergesellschaftung.

Angesprochen wurde, dass all dies nicht in der bisherigen Form der kapitalistischen Verwertung möglich sei. Klar wurde dabei auch, dass es im Parteivorstand unterschiedliche Vorstellungen darüber gibt, ob eine Transformation der Autoindustrie und die Einführung von Wirtschaftsdemokratie im Rahmen des Systems möglich sind, oder es nötig ist (Lucys und Thies Meinung), offensiver die Eigentums- und Systemfrage zu stellen. Das Ziel, das Klima zu retten, erfordert die Konversion der Autoindustrie. Das ist nur durch die Vergesellschaftung der Autoindustrie möglich und muss einhergehen mit der Überführung anderer Schlüsselindustrien in öffentliches Eigentum, der Abschaffung der kapitalistischen Produktionsweise und der Einführung demokratischer Planung.

Eine Debatte gab es erneut (wie bereits beim letzten PV zur CO2-Bepreisung) zur Frage, ob es ausreicht, das Angebot des ÖPNVs zu erweitern und Ordnungsmaßnahmen zu ergreifen, oder ob die Nutzung von Autos in der Innenstadt verteuert werden muss durch Parkraumbewirtschaftung und andere Maßnahmen, um marktwirtschaftlich ein anderes Verhalten zu erzwingen. Letzteres würde aus Sicht der AKL aber vor allem Menschen aus der Arbeiter*innenklasse treffen, Reiche könnten sich weiter leisten, ihre Autos in die Städte zu fahren (Umweltverbände sagen zudem, dass solche marktwirtschaftlichen Steuerungen viel zu langsam und viel zu wenig Wirkung erzeugen).

Bernd Riexinger hatte vorgeschlagen, das Konzept der LINKEN als „linken Green New Deal“ zu betiteln. Lucy sprach sich aus verschiedenen Gründen dagegen aus. Für viele klingt Deal nach einem Deal mit den Konzernen und nicht nach dem nötigen Kampf gegen Konzerninteressen. Bernd Riexinger verwies dagegen darauf, dass der Begriff international von Linken geprägt sei, zeigte sich aber offen für andere Begriffe.

Als Lesehinweis empfahl Lucy das Buch „Mit dem Elektroauto in die Sackgasse“ von Winfried Wolf (erschienen 2019 bei Promedia) und die Durchführung von Veranstaltungen mit ihm zum Thema alternative Verkehrspolitik. Winfried Wolf spricht sich darin sehr deutlich gegen E-Autos als angeblich grüne Alternative aus.

Geschlechterparität im Bundestag

Als zweiten Schwerpunkt unter Aktuelles diskutierte der PV einen Gesetzentwurf der Bundestagsfraktion zur Umsetzung der LINKE-Forderung nach Geschlechterparität im Bundestag. Dazu nahm Conny Möhring, frauenpolitische Sprecherin der Bundestagsfraktion, an der Sitzung teil und stellte den Entwurf vor. Während die Quotierung der Kandidat*innen auf den Listen und in Wahlkreisen der LINKEN unstrittig ist, ging es darum, ob die Partei einen Gesetzentwurf einbringen soll, der alle Parteien dazu verpflichtet, Wahllisten und Kandidat*innen für Direktmandate in den Wahlkreisen geschlechterparitätisch aufzustellen. Die gesetzliche Verpflichtung zur paritätischen Aufstellung der Wahllisten ist noch einfach vorstellbar, komplizierter wird es bei den Wahlkreisen. Der Vorschlag von Conny Möhring und anderen ist, die Umsetzung als paritätische Doppelbesetzung der Wahlkreise zu ermöglichen, indem die heutige Anzahl von Wahlkreisen halbiert und dann doppelt mit Mann und Frau besetzt wird. Die Alternative zur Einführung der vollen Geschlechterparität wäre die Abschaffung der Wahlkreise und die Umsetzung der Wahl über ein reines Verhältniswahlrecht. Diese Vorschläge wurden konstruktiv und kontrovers diskutiert.

Das Stimmungsbild zum Gesetzentwurf ging dann auch dementsprechend ungefähr 50:50 aus.

Eine Entscheidung darüber wurde auf die nächste PV-Sitzung am 23./24.11. verschoben. Positiv wurde festgehalten, dass Conny Möhring diese Diskussion im PV sucht, da ja sonst nicht selten die Fraktion Entscheidungen trifft und die Partei vor vollendete Tatsachen stellt.

Strategiekonferenz 2020

Am 29.2. bis 1.3.2020 soll eine bundesweite Strategiekonferenz der LINKEN im Kulturbahnhof im schönen Kassel stattfinden, die offen für alle Mitglieder ist. Dort sollen keine Beschlüsse gefasst werden, aber Räume in Plena und workshops geöffnet werden, um über die weitere Strategie der LINKEN zu sprechen. Die Konferenz soll sich vor allem an Mitglieder und Aktive richten und zudem an Akteur*innen aus dem Umfeld der Partei.

Ilja Seifert brachte es gut auf den Punkt, als er sagte, es sei nicht zentral, dass dort hundert Journalist*innen rumspringen, um sich keine Agenda von außen aufzwingen zu lassen.

Was genau diskutiert werden soll, wird Gegenstand von Debatten und auch Kontroversen sein. Ein Mitglied des geschäftsführenden PVs meinte, es solle dort kein Best-of der Kontroversen der letzten Jahre geben, sondern das diskutiert werden, was gesellschaftlich nötig sei. Es ist natürlich richtig, dass die Strategiekonferenz neue (und alte) Fragen wie Zukunft der Autoindustrie, Klimapolitik, internationale Handelsbeziehungen- und kriege, Aussichten auf eine Rezession diskutieren muss, aber zugleich müssen auch die Kontroversen der letzten Jahre ihren Platz haben. Denn diese sind ja nicht losgelöst von den gesellschaftlich notwendigen und aktuellen Fragen.

Mitglieder der Partei sind aufgerufen, bis zum 10.1.2020 eigene Strategiebeiträge von bis zu 10.000 Zeichen einzureichen. Diese könnt ihr hier einreichen:

strategiedebatte@die-linke.de . Die Beiträge sollen online und eine Auswahl in einem Printreader veröffentlicht werden. AKL-Mitglieder werden sich mit Beiträgen zu Wort melden.

Der PV wählte eine Vorbereitungsgruppe, der folgende Mitglieder aus dem PV angehören: Jörg Schindler, Harald Wolf, Lucy Redler (Vertretung Thies Gleiss), Ralf Krämer, Jan van Aken. Dazu kommen Genoss*innen aus dem Bundesausschuss, aus Parteiströmungen, Jugendverband, SDS und der Bundesgeschäftsstelle.

Vorschläge zur Strategiekonferenz könnt ihr gern an die Vorbereitungsgruppe oder auch direkt an Lucy richten. Die Vorbereitungsgruppe wird nun noch erweitert durch Genoss*innen aus Landesverbänden (also meldet euch schnell über euren Landesverband, wenn ihr mitmachen wollt.)

Weitere Themen unter Aktuelles waren die Massenproteste in Chile, Katalonien, Libanon und Irak, die Parteikampagnen zu Pflege und Mieten, die geplanten Studierendenstreiks ab dem 23.11., die Aufklärung des Lübke-Mordes und die Rolle des Verfassungsschutzes.

Neue Forderung: 1200 Euro Mindestsicherung

Angesichts der gestiegenen Lebenshaltungskosten lagen vier Vorschläge zur Erhöhung der sanktionsfreien Mindestsicherungsforderung der LINKEN (derzeit 1050 Euro) vor. Von diesen wurden in der Debatte im Wesentlichen drei diskutiert:

Erstens: Die BAG Hartz IV, bei der Sitzung durch zwei Genoss*innen vertreten, stellte ihr Konzept von einer sofortigen Erhöhung der Mindestsicherung auf 1200 Euro vor.

Zweitens: Der Gegenvorschlag kam von Ralf Krämer, der eine Erhöhung von 1150 Euro errechnet hatte.

Drittens: Der dritte Vorschlag war, die Forderung auf 1200 Euro zum nächsten Bundestagswahlkampf zu erhöhen.

Die Debatte drehte sich dann weniger um die Differenz von 50 Euro, sondern um die Frage, nach welchen Gesichtspunkten wir Forderungen aufstellen. Während die BAG Hartz IV, Lucy und andere Parteilinke politisch dafür plädierten, die objektive Notwendigkeit zum Ausgangspunkt zu nehmen und mit der Forderung nach 1200 ein Signal an Bündnispartner*innen in Erwerbsloseninitiativen und Sozialverbänden auszusenden und eine überfällige Debatte in den Gewerkschaften anzustoßen, argumentierten andere entweder stärker mathematisch oder damit, dass für die Durchsetzung von 1200 Euro die starken Bündnispartner in den Gewerkschaften fehlen und 1200 Euro gegenüber Lohnabhängigen schwerer vermittelbar seien. Es stimmt, dass die Gewerkschaften diese Forderung nicht aufstellen, dasselbe gilt jedoch auch für die Forderung nach 1050 und 1150 Euro. Es stimmt auch, dass manche prekär Beschäftigte eine Forderung nach 1050, 1150 oder 1200 Mindestsicherung nicht nachvollziehen können, doch das spricht wohl eher für Lohnerhöhungen statt einer niedrigeren Mindestsicherungsforderung. Lucy sprach sich dafür aus, flankierende Forderungen nach einem Mindestlohn von 13 Euro aufzustellen.

Die Abstimmung ergab eine Mehrheit für die Forderung nach 1200 Euro, in der Stichwahl setzte sich dann der moderatere Vorschlag durch, diese Forderung zum nächsten Bundestagswahlkampf statt unmittelbar aufzustellen.

Wenn euch die Vorlage der vier Varianten interessiert, schicken Thies oder Lucy euch diese gern zu.

Wahlerfolg für „Landesvater Bodo Ramelow“

Die Auswertung der Thüringenwahl kam viel zu kurz. Bodo Ramelow und Susanne Hennig-Wellsow konnten Montag aufgrund vieler Termine erst ab 11:30 an der Sitzung teilnehmen und eilten um 12 Uhr mit den Parteivorsitzenden zur Bundespressekonferenz.

Landtag Erfurt 2011-05-18 mnII (55).JPG

Nach minutenlangen Standing Ovations für Bodo Ramelow für die Presse, an denen sich die Autorin nicht beteiligte, gab es hochlobende Beiträge der Parteivorsitzenden und dann Inputs von Susanne Hennig- Wellsow und Bodo Ramelow. Bodo Ramelow erklärte die Arbeitsteilung so, dass er alle drei Parteien vertrete und Susanne Hennig-Wellsow die Partei und diese Arbeitsteilung beim Arbeitskampf der Uniklinik Jena gut geklappt habe. Susanne Hennig-Wellsow lobte, dass Bodo Ramelow als „Landesvater“ überall respektiert sei. Sie verteidigte, dass es Wahlplakate mit Bodo Ramelow ohne Logo der LINKEN gab.

Leider werden diese Sichtweisen aus Sicht der Autorin von wenigen kritisch hinterfragt.

Bodo Ramelow verwies darauf, dass er Ministerpräsident bleibe und auch bereit sei, sich mit einfacher Mehrheit im dritten Wahlgang wählen zu lassen.

Natürlich sind 31 Prozent für DIE LINKE in Thüringen ein gutes Ergebnis. Es stellt sich jedoch zum einen die Frage, warum die AfD so stark werden konnte und ob DIE LINKE mit diesen 31 Prozent linke Politik betreiben wird und diese nutzt, die gesellschaftlichen Verhältnisse zu ändern oder nicht.

An Diskussionszeit verblieben genau 10 Minuten und es gab nur zwei Beiträge, unter anderem von Lucy, die neben den bekannten Differenzen zur Regierungsbeteiligung und einer Warnung vor Bündnissen mit der CDU fragte, ob DIE LINKE Thüringen die 31 Prozent denn nun gesellschaftlich für die Mobilisierung zur Umsetzung eines Gesetzes zu Mietabsenkung, Mietendeckel und einem Gesetz für bedarfsgerechte Personalbemessung im Krankenhaus nutzen werde. Bodo Ramelow antwortete, ein Mietendeckel sei Symbolik und die Regierung habe gerade erst 6000 Wohnungen zurückgekauft.

Das erinnerte die Autorin an das Motto des Berliner Bürgermeisters Müller statt auf Enteignungen auf „Kaufen, Bauen, Deckeln“ zu setzen – nur ohne Deckeln.

Die AKL bleibt gespannt, ob die 31 Prozent für wirklich linke Politik genutzt werden, oder ob es so weitergeht wie bisher mit sozialdemokratischer Politik. Die AKL spricht sich für eine Minderheitsregierung allein der LINKEN in Thüringen mit sozialistischer Politik, gestützt auf gewerkschaftliche Kämpfe und soziale Bewegungen, aus. Vier Beiträge aus dem Kreis der AKL zu Thüringen (vom Bundessprecher Thies Gleiss und von den AKL- Mitgliedern Claus Ludwig und Sebastian Rave) findet ihr hier:

https://www.antikapitalistische-linke.de

Weitere Beschlüsse

Außerdem wurde (neben weiteren Vorlagen) das Folgende beschlossen:

• Die Unterstützung der Proteste gegen den AfD-Bundesparteitag am 30.11./1.12. in Braunschweig und der bundesweiten Demonstration in Solidarität mit Rojava am 2.11. in Berlin

• eine finanzielle Unterstützung von Aufstehen gegen Rassismus, der Roten Ruhr-Akademie in Essen, des politischen Aschermittwochs in Bayern, dem Gedenken an 100 Jahre Kapp-Putsch des Kreisverbands Wesel

• politische Vorlagen zur Abschaffung des Solidaritätszuschlags, eine Rekommunalisierungskampagne

• die Durchführung des Jahresauftakts am 10.1.2020 ab 18h im „refugio“ in Berlin-Neukölln und der Gremienberatung mit dem Themenschwerpunkt 15 Jahre Agenda 2010 am 11.1.2020

Darüber hinaus wurden die Berichte zur Mitgliederentwicklung im dritten Quartal, der Finanzbericht und der Genderbericht 2018 zur Kenntnis genommen (und leider aus Zeitgründen nicht diskutiert, wir empfehlen die Lektüre) und die Berichte aus dem Jugend- und Studierendenverband entgegen genommen. Für Letztere soll in Zukunft mehr Zeit auch zur Diskussion eingeplant werden.

Berlin, 30.10.2019, Lucy Redler (und schöne Grüße von Thies Gleiss)

akl - Antikapitalistische Linke

————————————————————-

Grafikquelle           :

Oben        —       Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —        Susanne Hennig, 18. Mai 2011

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Stadtgespräch aus Zwickau

Erstellt von DL-Redaktion am 5. November 2019

Gedenken der NSU-Opfer in Zwickau – Nichts ist klar

Von Konrad Litschko

Vor acht Jahren flog der NSU auf. Das Erinnern an die zehn Mordopfer in Zwickau zeigt, wie wenig aufgearbeitet die Terrorserie ist.

In Zwickau stehen seit diesem Wochenende zehn Gedenkbäume im Schwanenteichpark. An Enver Şimşek, Abdurrahim Özüdoğru, Süleyman Taşköprü, Habil Kılıç, Mehmet Turgut, İsmail Yaşar, Theodoros Boulgarides, Mehmet Kubaşık, Halit Yozgat und Michèle Kiesewetter. Den zehn Mordopfern des „Nationalsozialistischen Untergrunds“, erschossen zwischen 2000 und 2007. Es ist ein Zeichen, dass Zwickau diese Menschen nicht vergessen will. Menschen, die starben, auch weil sich die NSU-Rechtsterroristen jahrelang unerkannt in Zwickau aufhalten konnten. Es ist ein überfälliges Zeichen.

Denn es ist inzwischen genau acht Jahre her, dass die Rechtsterrorserie aufflog – als sich in Eisenach Uwe Mundlos und Uwe Böhnhardt nach einem gescheiterten Bankraub erschossen und Beate Zschäpe in Zwickau den letzten Unterschlupf in die Luft jagte. Am Montag besuchte deshalb Bundeskanzlerin Angela Merkel die Zwickauer Gedenkbäume und legte Blumen ab. „Wir werden alles tun, damit sich so etwas nicht wiederholt“, sagte Merkel. Sachsens Ministerpräsident Michael Kretschmer geißelte die „furchtbare, menschenverachtende Ideologie“ des Rechtsextremismus. Auch dies: ein deutliches Zeichen, klare Worte.

Nur leider ist bei der NSU-Aufarbeitung, acht Jahre „danach“, nur wenig so klar. Und die Gedenkbäume in Zwickau legen dies schonungslos offen.

Es ist bereits vielsagend, dass die Stadt so viele Jahre brauchte, um diese Bäume aufzustellen. Lange wurde das Thema NSU in der Stadt nicht angefasst. Die CDU warnte vor einem Stigma für Zwickau, die AfD unterschrieb bis zuletzt ein Memorandum zum NSU-Opfergedenken nicht. Als BürgerInnen 2016 Gedenkbänke aufstellten, wurden diese sofort zerstört. Gleiches geschah vor wenigen Wochen mit einem ersten gepflanzten Baum für Enver Şimşek. Die Stadt wiederum befragte die Opferangehörigen erst gar nicht, was sie von der Pflanzaktion halten, lud sie auch nicht zur Gedenkfeier ein. Gamze Kubaşık, Tochter des Dortmunder NSU-Opfers Mehmet Kubaşık, spricht von einer „Unverschämtheit“.

Zwickau, Hauptmarkt 13-004.jpg

Als die Bäume nun am Sonntag eingeweiht wurden, waren die zehn Opfernamen auf den Gedenkplatten nur „eingedeutscht“ geschrieben. Auch legte die AfD nun doch einen Kranz nieder. Einige TeilnehmerInnen empfanden dies als Provokation: von einer Partei, die Rassismus befeuert und deren Vertreter den NSU-Prozess einst als „Schauprozess“ verunglimpfte. Eine Frau schnitt das AfD-Band ab, die Polizei nahm sie vorübergehend fest und löste so einen Tumult aus. Ein NSU-Opfergedenken, das die Opfer brüskiert: Es ist ein Sinnbild.

Abgeschreckt fühlt sich keiner

Denn es ist ja nicht nur Zwickau. Auch in Thüringen wurde vor Jahren schon eine NSU-Mahnstätte beschlossen, es gibt sie bis heute nicht. Gleiches in Köln. Und auch in Kassel, Heilbronn, Nürnberg oder Rostock wurden Gedenkplatten an die Opfer zerstört. Es ist also schon zu viel, unschuldig Ermordeten zu gedenken. Das ist infam.

Quelle        :    TAZ           >>>>>        weiterlesen

————————————————————

Grafikquelle          :

Oben          —          Die letzte Wohnung des NSU-Trios in Zwickau wurde von Beate Zschäpe im November 2011 zur Verdeckung zerstört

  • CC BY-SA 2.5Hinweise zur Weiternutzung
  • File:Nationalsozialistischer Untergrund – Explosion in Zwickau 2011 3 (aka).jpg
  • Erstellt: ‎16‎. ‎November‎ ‎2011

 

———————————-

Unten        —        Zwickau, Hauptmarkt 13

Abgelegt unter Innere Sicherheit, Medien, Regierung, Sachsen | Keine Kommentare »

Der Prozess in Würzburg

Erstellt von DL-Redaktion am 5. November 2019

Vollrausch, Tötung, Geldstrafe

Letters of the Law – ‘R’ for Road Policing.jpg

Eine Kolumne von

Viele Menschen empören sich über ein Urteil eines Jugendgerichts beim Amtsgericht Würzburg. Um zu prüfen, ob das berechtigt ist, sollte man die Lage jedoch möglichst nüchtern betrachten.

Das Urteil

Ein Urteil des Amtsgerichts – Jugendgericht – Würzburg vom 23. Oktober 2019 hat für großes Aufsehen, Empörung und erstaunliche Schlagzeilen gesorgt. Das Gericht verurteilte einen 20-jährigen Heranwachsenden wegen fahrlässigen Vollrauschs zu einer Geldstrafe, deren Summe 5000 Euro beträgt. Wie viele Tagessätze ihr zugrunde liegen, wurde wie üblich nicht berichtet, obwohl es nur darauf ankommt. Für jemanden, der 30.000 Euro netto im Monat verdient, wären es fünf Tagessätze, für jemanden, der 415 Euro im Monat netto übrig hat, 360 Tagessätze. Den Unterschied merkt man, wenn man nicht zahlt: Dann müsste der Erste fünf Tage ins Gefängnis, der Zweite ein Jahr. In der Presse wird regelmäßig nur das Produkt aus Tagessatzzahl und Tagessatzhöhe (= Monatseinkommen durch 30) mitgeteilt, obwohl das sinnlos ist.

Dem Urteil lag eine Tat vom 23. April 2017 zugrunde. Der Angeklagte, damals 18 Jahre alt und Fahranfänger, fuhr nachts auf einer Nebenstraße mit seinem Auto nach Hause. Er hatte eine Blutalkoholkonzentration von fast 2,9 Promille; drei weitere junge Männer, ebenfalls alkoholisiert, saßen mit ihm im Auto. Aufgrund seiner Alkoholisierung übersah der Angeklagte zwei am Straßenrand gehende Fußgänger und fuhr eine 20-jährige junge Frau an. Sie starb wenige Tage später an ihren schweren Verletzungen.

Die „Bild“ nennt das Opfer „totgeraste Teresia“, lässt also dem Leser schon im Ansatz das übliche „Feeling“ zukommen, indem Empathie und Nähe vorgetäuscht wird. Das Opfer wird beim Vornamen genannt, als ob die „Bild“-Leser ein Recht darauf hätten, sich der jungen Frau aufzudrängen. Die Tat heißt „Totrasen“, obwohl es für das Ereignis ganz unerheblich ist, ob der Täter „gerast“ oder langsam gefahren ist. Das entspricht dem üblichen populären Umgang mit den Gefahren des Straßenverkehrs: Wer schnell fährt und Glück hat, fährt „sportlich“, wer schnell fährt und Pech hat, heißt „Raser“. Die „Raser“ gehören weggesperrt; aber das sind immer nur die anderen.

Die Überschrift des „Bild“-Artikels vom 23. Oktober lautete übrigens: „Wer soll dieses Urteil verstehen?“ Wer den Artikel liest, der hier nur stellvertretend für viele andere genannt ist, „versteht“ das Urteil auf gar keinen Fall; daran ändert auch der „Verkehrsexperte“ nichts, den „Bild“ bemüht. Dem Leser werden hier wie anderswo schon die einfachsten Grundlagen der Rechtsfragen entweder verschwiegen oder so verdreht mitgeteilt, dass der Informationsgehalt sich auf bloße Anstachelung von Empörung beschränkt. An diesem Schmierentheater hatte, wie es zu befürchten gilt, das Gericht jedenfalls insoweit einen Anteil, als es sich mit den merkwürdigsten Äußerungen zur mündlichen Urteilsbegründung zitieren lässt:

„Bild“: „Die überraschende Erkenntnis von Richter Krieger: ‚Wir hätten gern eine Jugendstrafe verhängt.‘ Aber das sei nicht möglich gewesen, da der Angeklagte schuldunfähig sei – wegen des hohen Promillewerts. Im Klartext: Niclas H. ist frei, weil er total besoffen war!“

Oder so: „Focus“: „Richter kann Vater von Teresa (+20) kaum ansehen. Richter Krieger: ‚Es fällt mir schwer, Ihnen in die Augen zu gucken.'“

Oder beim Bayerischen Rundfunk: „Richter: ‚Das Urteil ergeht im Namen des Volkes. Aber das Volk muss schon ein paar Semester Jura studieren, um das zu verstehen, was ich heute geurteilt habe.'“

Gehen wir einmal davon aus, dass der Vorsitzende des Jugendschöffengerichts („Wir“) genügend lange studiert hat, um zu verstehen, was er (oder sagen wir, unter Erinnerung an das Beratungsgeheimnis: die Mehrheit des Gerichts) geurteilt hat. Wenn Richter es schaffen, ihre eigenen Urteile verstanden zu haben, sollten sie so freundlich sein, sie dem Volk so zu erklären, dass es bei gutem Willen möglich ist, die Rechtslage zu erkennen. Wer es darauf anlegt, sich als „volksnah“ aufzuplustern und zu behaupten, dem von ihm selbst soeben angewendeten Recht fehle es an verfassungsgemäßer Legitimität, dem schreibt Art. 100 Abs. 1 des Grundgesetzes ohne Wenn und Aber vor, was er zu tun hat: Das Verfahren aussetzen und die Sache dem Bundesverfassungsgericht vorlegen. Entweder – oder: Man kann nicht der Held der Strafprozessordnung und der „Bild“-Zeitung zugleich sein.

Ein paar Korrekturen

Aus der BR-Berichterstattung:

„Der Richter begründete das Urteil mit dem ‚pubertären männlichen Verhalten‘, das den Tod der 20-Jährigen zur Folge hatte. Zudem sei der Hauptangeklagte schuldunfähig, da ihm keine ‚Neigungen‘ attestiert werden konnten und er zum Tatzeitpunkt stark alkoholisiert war. Vor Gericht gab der junge Mann an, sich nicht an den Unfall erinnern zu können. Die Staatsanwaltschaft hatte zweieinhalb Jahre Freiheitsstrafe nach Erwachsenenstrafrecht für den 20-Jährigen gefordert. Das Urteil wurde jedoch nach Jugendstrafrecht erlassen, da der Hauptangeklagte zum Tatzeitpunkt 18 Jahre alt war.“

Obwohl die einzelnen Worte dieses Berichts nicht falsch sind und der deutschen Sprache entstammen, ergeben sie in ihrem Zusammenhang fast keinen Sinn und sind auf Wirrnis angelegt. Selbst der oben zitierte Richter dürfte nicht „das Urteil mit dem pubertären Verhalten begründet“ haben. Richtig mag sein, dass der Angeklagte ein solches Verhalten zeigte; das weiß man nicht. Man wird aber nicht wegen pubertären Verhaltens bestraft, sondern wegen der Begehung von Straftaten. Ob diese Ausdruck von „pubertärem Verhalten“ sind, ist für die Strafbarkeit nur eingeschränkt und unter bestimmten Voraussetzungen von Bedeutung.

Die Staatsanwaltschaft hatte eine Freiheitsstrafe nach Erwachsenenrecht beantragt. Das Jugendgericht verhängte „jedoch“, so der BR, eine Strafe nach Jugendrecht, „da der Hauptangeklagte zum Tatzeitpunkt 18 Jahre alt war.“ Das ist schräg. Die Staatsanwaltschaft weiß, dass es für die Anwendbarkeit von Jugend- oder Erwachsenenrecht auf das Alter des Beschuldigten zum Tatzeitpunkt ankommt. Daher liegt die Begründung, Jugendstrafrecht sei angewendet worden, „weil“ der Angeklagte zur Tatzeit 18 war, neben der Sache. Richtig ist, dass bei Personen zwischen 14 und 17 (sogenannten Jugendlichen) immer Jugendrecht anzuwenden ist, bei Personen ab 21 immer Erwachsenenrecht. Im Zwischenbereich von 18 bis 20 heißen die Personen „Heranwachsende“. Hier kommt es darauf an, ob der Täter (zur Tatzeit) „noch einem Jugendlichen gleichzustellen ist“. Es kommt also auf den Grad der Entwicklung, Reife, Verantwortungsentwicklung, Selbstständigkeit an: Es gibt 19-jährige, die den Entwicklungsstand eines 14-Jährigen aufweisen, und 18-Jährige, die ein in jeder Hinsicht selbstständiges Leben führen (können). Es kommt bei der Entscheidung aber auch auf die Art der Straftat an: Ein komplizierter Betrug eines 19-Jährigen wird selten „jugendtypisch“ sein, eine Schlägerei beim Fußball ziemlich oft.

Die Gerichte neigen dazu, die Anwendung von Jugendrecht recht großzügig zu bejahen. Das mag daran liegen, dass für die Entscheidung die Jugendgerichte zuständig sind, die aufgrund der speziellen Materie oft einer pädagogisch-psychologischen Betrachtung der Dinge näher stehen als Erwachsenengerichte.

Missverständlich ist die Erwähnung, es sei der „Hauptangeklagte“ gewesen, der zur Tatzeit erst 18 Jahre alt war. Das ist völlig unerheblich: Jeder Beschuldigte/Angeklagte wird natürlich nach seinen eigenen Voraussetzungen beurteilt. Wenn wegen ein und derselben gemeinsamen Tat ein Jugendlicher und ein Erwachsener angeklagt sind, wird gegen den einen Jugendrecht, gegen den anderen Erwachsenenrecht angewendet. Den Begriff „Hauptangeklagter“ gibt es im Strafprozess überhaupt nicht.

Die „schädlichen Neigungen“ haben mit der „Schuldunfähigkeit“ nichts zu tun; die Begründung ist vermutlich falsch zitiert, auf jeden Fall Unsinn. „Schädliche Neigungen“ sind eine von zwei (alternativen oder kumulativen) Voraussetzungen für die Verhängung von Jugendstrafe (also Freiheitsstrafe gegen Jugendliche). Das Jugendstrafrecht steht unter dem Oberbegriff des „Erziehungsgedankens“: Man will durch andere Maßnahmen (Auflagen, Weisungen, Arrest, Geldstrafe) möglichst die Verhängung der (oft eher schädlichen) Jugendstrafe vermeiden. Wenn aber entweder „die Schwere der Schuld“ oder „schädliche Neigungen“ bejaht werden müssen, ist Jugendstrafe zu verhängen. „Schwere der Schuld“ liegt zum Beispiel bei massiven Gewalttaten oder bei vorsätzlichen Taten mit hohem Schaden nahe. „Schädliche Neigungen“ sind, was man auch als „Tendenz zur sozialen Verwahrlosung“, Neigung zur Wiederholung, Fehlen von moralischen Strukturen und so weiter beschreiben kann. Bei Spontantaten, „Ausrutschern“, Taten unter Berauschung oder in emotionalem Stress liegen schädliche Neigungen nicht nahe.

Alkohol und Schuld

Quelle          :         Spiegel-online          >>>>>          weiterlesen

———————————————————-

Grafikquellen       :

Oben       —       The force Letters of the Law initiative continues today with the letter R for road policing looking at how West Midlands Police tackles drink drivers.

————————–

Unten         —             Thomas Fischer auf der re:publica 2016

Abgelegt unter Deutschland, Justiz-Kommentare, Kultur, Medien | Keine Kommentare »

Sind nun alle Bodo ?

Erstellt von DL-Redaktion am 5. November 2019

Für eine LINKE-Alleinregierung

2019-10-27 Wahlabend Thüringen by Sandro Halank–11.jpg

Quelle       :      AKL

Von Claus Ludwig.

Es ist gut, dass die LINKE zur stärksten Partei in Thüringen geworden ist und bei gestiegener Wahlbeteiligung in absoluten Zahlen und prozentual zulegen konnte. Doch Grund zum Jubeln ist dieses Ergebnis nicht. Zwei Wochen nach dem Doppelmord von Halle haben die Stichwortgeber der Nazi-Terroristen unter dem offenen Rechtsextremisten Björn Höcke ihre Stimmen mehr als verdoppeln können. Jetzt werden Rufe laut, die LINKE solle mit der CDU koalieren oder die FDP zu R2G dazuholen. Die LINKE sollte  dies ablehnen.

Wie in Brandenburg und Sachsen hat es bei der Landtagswahl in Thüringen eine scharfe Polarisierung anhand der Frage “für oder gegen die AfD” gegeben. Viele dieser Wähler*innen haben ihre Stimme der stärksten Anti-AfD-Kraft und damit der Partei des Ministerpräsidenten Bodo Ramelow gegeben. In Sachsen profitierte davon die CDU, in Brandenburg die SPD.

Die LINKE gilt – nicht zu Unrecht – im Osten als Teil des Establishments. Die Regierungsbeteiligung hat die LINKE verändert, nicht aber die Verhältnisse. Auch unter Bodo Ramelow gab es keinen Politikwechsel, sondern überwiegend ein “weiter so”.

Es ist rechnerisch nicht möglich, eine Regierung ohne LINKE oder AfD in Thüringen zu bilden. Eine Regierung mit der CDU würde, gerade angesichts der nahenden Wirtschaftskrise, dazu führen, dass die LINKE die Mitverantwortung für eine Politik übernimmt, die gegen die arbeitenden Menschen gerichtet ist. Das würde der AfD die Möglichkeit eröffnen, noch stärker zu werden. Das gleiche gilt, wenn die LINKE mit SPD, Grünen weiter regiert und sich die FDP als neoliberale Laus in den Pelz holt.

DIE LINKE hat 31% der Wähler*innen für sich mobilisiert. Was macht sie daraus? Wie baut sie auf der Grundlage eine starke antirassistische Bewegung auf, um die AfD zu bekämpfen? Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, mit klaren Eckpunkten und dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren (siehe unten).

In den nächsten Wochen wird viel von Verantwortung die Rede sein. Die wahre Verantwortung der LINKEN ist es, eine gesellschaftliche Alternative zu Sozialabbau, Niedriglöhnen, Armutsrenten und Rassismus zu formulieren und dafür auf allen Ebenen zu kämpfen – auf der Straße, im Parlament und – bei 31 Prozent Wähler*innen – auch in der Regierung. Das geht nicht mit den Establishment-Parteien von CDU, FDP, GRÜNEN und SPD, das geht nur mit einer linken Alleinregierung. Wenn die LINKE klare Beschlussvorlagen im Interesse der arbeitenden Menschen in den Landtag einbringt, müssen die etablierten Parteien Farbe bekennen, ob sie mit der AfD gegen die LINKE opponieren oder deren Anträge passieren lassen.

akl - Antikapitalistische Linke

Grafikquelle    :           Election night Thuringia 2019: Bodo Ramelow (Die Linke)

Abgelegt unter Berlin, L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

LINKE vs. Höcke-AfD

Erstellt von DL-Redaktion am 4. November 2019

Analyse der Thüringer Landtagswahl

2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg

Quelle       :     AKL   

von Claus Ludwig, Köln

Der Aufstieg der AfD ist alarmierend und führt viele an die Wahlurne. Auch wenn es in Thüringen eine klare Mehrheit gegen die AfD gibt und nur 15 Prozent aller Wahlberechtigten (inkl. der Nichtwähler*innen) die rechtsextreme AfD unter Björn Höcke gewählt haben: Die politische Polarisierung war selten so deutlich wie bei dieser Wahl. Von der Stimmung gegen rechts hat die LINKE profitiert, die ihre Stimmen von 265.000 auf 344.000 (Zahlen auf Tausend gerundet) steigern konnte. Doch Jubeln und Freudenfeiern seitens der LINKEN sind fehl am Platz.

Die AfD konnte ihre Stimmen von 100.000 auf 259.000 um den Faktor 2,6 vermehren. Die AfD ist die Partei der erwerbstätigen Männer im mittleren Alter, liegt bei den 18-24jährigen knapp vor der LINKEN und bei den Erstwähler*innen knapp hinter ihr. Die stark von Senior*innen geprägte Altersstruktur des Landes ist einer der Faktoren, welche einen Durchmarsch der AfD verhindert haben.

Ein anderer Faktor ist das unterschiedliche Wahlverhalten von Frauen und Männern. Frauen haben in stärkerem Maße die LINKE gewählt. Das wird auch an der beruflichen Aufteilung deutlich: Bei der stärker weiblich geprägten Gruppe der Angestellten dominiert die LINKE mit 34 Prozent gegenüber 19 Prozent der AfD, bei Arbeiter*innen liegen beide nah beieinander (31 und 29 Prozent). Bei den Selbstständigen liegt die AfD vorn. Gewerkschaftsmitglieder haben zu 36,6 die LINKE und zu 22,6 Prozent die AfD gewählt, bei den Gewerkschaftsfrauen waren es 40,2 zu 16,2 Prozent.

Die AfD hat mit 34 Prozent eine besonders hohe Unterstützung unter denjenigen, die ihre eigene wirtschaftliche Situation als schlecht ansehen. Allerdings waren  nur 13 Prozent der Befragten der Meinung, die Lebensverhältnisse hätten sich in ihrem direkten Umfeld verschlechtert, für 31 Prozent sind sie gleich geblieben, 34 Prozent sehen sogar Verbesserungen. Bei den “Sorgen” dominierten die Angst vor “politischen Anschlägen” (80 Prozent), dem Klimawandel (65 Prozent), Kriminalität und dem Islam (54 Prozent). Sorgen um den eigenen Lebensstandard machen sich 31 Prozent.

Bei der Wahl der AfD gibt es Elemente von Protestwahl, aufgrund zuvor erlebter sozialer Ausgrenzung und der Benachteiligung des Ostens. Diese waren jedoch bei dieser Wahl nicht entscheidend. Die AfD wird zwar von vielen gewählt, die sich vernachlässigt oder abgehängt fühlen. Dies ist allerdings nicht deckungsgleich mit einem bereits erfolgten sozialen Abstieg. Es handelt sich auch um eine Zunahme verfestigter rassistischer und rechtsextremer Einstellungen, auch wurzelnd in der massiven Intervention von Nazi-Organisationen in den 1990er Jahren und der Förderung von Rassismus durch staatliche Institutionen und die Debatten der bürgerlichen Parteien. All dies wurde und wird begünstigt durch das Fehler einer wirklich klaren linken Alternative und starken Gewerkschaften.

Björn Höcke ist auch unter AfD-Wähler*innen umstritten – was diese nicht daran hindert, ihn zu wählen. 82 Prozent aller Wähler*innen sehen die AfD zu nah an rechtsextremen Positionen. Aber 47 Prozent der Befragten finden es gut, dass sie “die Zuwanderung begrenzen” will und 39 Prozent halten sie für eine “demokratische Partei wie die anderen Parteien auch”. 44 Prozent der AfD-Wähler*innen sehen Höcke zu nah am Rechtextremismus, aber 77 Prozent “finden es gut, dass er kein Blatt vor den Mund” nimmt.

Bei der AfD-Unterstützer*innen handelt es sich nicht überwiegend um harte Faschist*innen, die bereit zur Aktion sind. Doch die Akzeptanz völkisch-faschistischer Sprache und Propaganda ist hoch. Das Potenzial, von einer Phase überwiegend parlamentarischer Agitation zu Straßenaktionen überzugehen und die Landes-AfD zu einer aktiven faschistischen Kraft wie die NPD zu machen, wächst.

Die LINKE hat es mit ihrer Fokussierung auf den Ministerpräsidenten Bodo Ramelow geschafft, die Rolle von SPD und Grünen gleich mit zu übernehmen. Anders als in Sachsen und Brandenburg konnte sie ihre starke Position bei den über 60jährigen halten. Gleichzeitig wurde sie zur Gegenspielerin der AfD, legte in größeren Städten wie Jena, Erfurt, Weimar, Suhl und Gera sowie unter Erstwähler*innen, bei Menschen mit höherer Bildung und bei Frauen im erwerbstätigen Alter besonders stark zu. Dies sind Schichten, die in anderen Bundesländern vor allem die Grünen wählten, auch wegen ihrer scheinbar konsequenten antirassistischen Positionierung. Dieses Ergebnis ist vor allem der Bündnis-Konstellation auf Landesebene geschuldet. Dazu beigetragen hat allerdings auch die glaubhafte Positionierung von Bodo Ramelow und vieler bekannter LINKER, die sich an Blockaden gegen Nazi-Aufmärsche beteiligt haben oder im NSU-Untersuchungsausschuss aktiv waren.

Der Verlust der Regierungsmehrheit für R2G bei Stärkung der LINKEN ist ein Hinweis darauf, dass die Lager-Arithmetik der Regierungsbefürworter*innen in der LINKEN nicht stimmt. Es wird keine starke LINKE neben einer stabilisierten SPD und dynamischen Grünen geben. Wenn die LINKE erfolgreich ist, geht das auf Kosten der SPD und der Grünen. Der Aufschwung der Grünen ist hingegen mit einer Begrenzung der LINKEN verbunden.

2014-09-14-Landtagswahl Thüringen by-Olaf Kosinsky -96.jpg

Solange nicht auf der Basis verstärkter Klassenkämpfe die Gesellschaft in Bewegung gerät und weitere Schichten von bisherigen Nicht-Wähler*innen erreichbar werden, bleiben die Verschiebungen bei den Wahlen im Großen und Ganzen innerhalb der Lager. Die Grünen profitieren vom Niedergang der SPD, die LINKE vom Schwächeln der Grünen. Die CDU verliert an die AfD. Ausnahmen bestätigen die Regel: In Thüringen gab es eine bedeutende, aber nicht entscheidende Wanderung von 23.000 CDU-Wähler*innen zur LINKEN. Die CDU-Spitze hatte versucht, LINKE und AfD gleichermaßen auszugrenzen, dies wurde von deren Wähler*innenschaft mehrheitlich abgelehnt.

Die in Berlin regierenden Parteien kommen nicht aus ihrer Krise heraus, und das am Vorabend des wirtschaftlichen Abschwungs. Die Meinung der meisten Thüringer*innen über die SPD ist eindeutig: “nur mit sich, ihrem Personal und Posten beschäftigt”.

Die Zahlen stammen aus: “Die Wahl zum 7. Thüringer Landtag am 27. Oktober 2019, WAHLNACHTBERICHT UND ERSTER KOMMENTAR”, Horst Kahrs und Benjamin-Immanuell Hoff, Rosa-Luxemburg-Stiftung sowie von Infratest Dimap im Auftrag der ARD-Tagesschau.

akl - Antikapitalistische Linke

————————————————————————–

Grafikquelle        :

Oben           —         Bodo Ramelow während der Regierungsmedienkonferenz am 3. September 2019 in der Thüringer Staatskanzlei in Erfurt

  • CC BY-SA 3.0 deThis image contains persons who may have rights that legally restrict certain re-uses of the image without consent.view terms
  • File:2019-09-03 Bodo Ramelow by OlafKosinsky MG 0388.jpg
  • Created: 2019-09-03 13:05:37

———————————-

Unten            —         Landtagswahl Thüringen am 14. September 2014

Abgelegt unter L. Thüringen, P. DIE LINKE, Überregional | Keine Kommentare »

Linke sollte Kämpferisch sein

Erstellt von DL-Redaktion am 3. November 2019

Statt Sozialdemokratie 2.0

2019-10-27 Wahlabend Thüringen by Sandro Halank–53.jpg

Besser nicht so ?

Quelle       :       AKL 

Von von Sebastian RaveBremen

Die ernüchternden Wahlergebnisse in Brandenburg und Sachsen scheinen bei der LINKEN fast schon wieder vergessen zu sein. Nach dem Wahlerfolg von Bodo Ramelow in Thüringen und der ersten Regierungsbeteiligung im Westen in Bremen gehen kritische Stimmen im Knallen der Sektkorken unter. Dabei liegt gerade in diesen vermeintlichen Erfolgen eine Gefahr für DIE LINKE.

Es gibt nichts Grundlegendes, was die LINKE, die in Sachsen und Brandenburg verloren hat, von der LINKEN unterscheiden würde, die in Thüringen gewonnen hat. Alle drei Landesverbände stehen für die Hoffnung, als linker Teil eines “linken Lagers” in der Regierung eine graduelle Verbesserung der Verhältnisse erreichen zu können.

Tatsächlich sind die Regierungserfolge beispielsweise in Thüringen aber eher überschaubar. Der Verfassungsschutz blieb ebenso unangetastet wie die Schuldenbremse (wie in Bremen), ein Landesmindestlohn, der auch bei Aufträgen von Kommunen gilt, wurde nicht eingeführt. Dafür ist Thüringen heute das Land mit dem zweitgrößten Niedriglohnsektor (30%).

Das Scheitern des Projekts Sozialdemokratie 2.0 lässt sich deutlich daran festmachen, dass eines der Ziele des Koalitionsvertrags der scheidenden rot-rot-grünen Regierung lautete: „Der Kampf gegen alte und neue Nazis, gegen Rassismus und Antisemitismus, muss entschlossen fortgesetzt werden“. Bei allem Bemühen und der Teilnahme an Demonstrationen: Am Ende der Legislatur wurde das Ziel, Nazis und Rechtspopulist*innen wirksam zu bekämpfen, verfehlt. Und leider trägt auch DIE LINKE mit ihrer wirkungslosen sozialdemokratischen Politik einen Teil der Verantwortung dafür. Wenn die Menschen das Gefühl haben, trotz einer linken Regierung Bürger*innen zweiter Klasse zu bleiben und DIE LINKE Teil des Establishments ist, hat es eine rechte Opposition eben leicht.

Die ehemalige Sozialdemokratie ist nicht aus reiner Boshaftigkeit zur neoliberalen Agenda-2010-Partei geworden, sondern weil sie sich den Sachzwängen des globalisierten Kapitalismus gebeugt hat. Dieser ist mittlerweile in einer tiefen Krise, die Sachzwänge verschärfen sich sogar noch weiter – ein Kurswechsel bei der LINKEN weg von der Sachzwanglogik ist deshalb dringend nötig.

Die Partei muss sich endlich trauen, den Kapitalismus nicht nur in Programmen in Frage zu stellen. Sie muss sich in den Stadtteilen und Arbeitsplätzen verankern, indem sie eine konstruktive Rolle bei jeder kleinen und großen Gegenwehr spielt. Zum Beispiel wurde der Mietendeckel in Berlin vor dem Hintergrund einer monatelangen Debatte über Enteignung von Immobilienkonzernen als Zugeständnis an die Bewegung durchgesetzt. Wenn es auch in Bremen und Thüringen solche Verbesserungen geben soll, reicht es nicht, SPD und Grüne am Kabinettstisch mal darauf anzusprechen. Die LINKE sollte eine sozialistische Strategie zur Veränderung Thüringens entwickeln, dafür im Parlament Unterstützung einfordern und auf der Straße, den Betrieben, Unis und Schulen mobilisieren. Zu den Eckpunkten sollten gehören:  1. Nichtumsetzung der Schuldenbremse, 2. Bekämpfung der Niedriglöhne, 3. Stopp aller Abschiebungen, 4. Mietendeckel, Mietsenkung und Enteignung der Immobilienkonzerne, 5. Einführung eines Landesgesetzes zur bedarfsgerechten Personalbemessungen in den Krankenhäusern (Thüringen könnte hier Vorreiter werden!) 6. Bedarfsgerechter Haushalt, 7. Rückgängigmachen von Privatisierungen.

Wir gehen nicht davon aus, dass sich SPD und Grünen an einer Regierung mit einem solchen Programm beteiligen würden. Aber das wäre ein Brechen mit der Sachzwanglogik und würde die Frage nach einer gesellschaftlichen Alternative zum Kapitalismus konkret auf die Tagesordnung stellen.

akl - Antikapitalistische Linke

———————————————————————

Grafikquelle         :       Election night Thuringia 2019: Anja Siegesmund (Büdnis 90/Die Grünen), Thomas L. Kemmerich (FDP)), Mike Mohring (CDU), Bodo Ramelow (Die Linke))

Abgelegt unter L. Thüringen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

30 Jahre Mauerfall

Erstellt von DL-Redaktion am 2. November 2019

Geistiges Kleingärtnertum

Von Stefan Reinecke

Non Stefan ReineckeDie westdeutsche Linke träumte von Revolutionen. Doch als 1989 eine vor ihrer Haustür geschah, war sie überfordert.

Wir kennen die Bilderschleifen, die jeden 9. November aufs Neue gezeigt werden. Wahnsinn-Rufe, knatternde Trabis, Genscher und der Jubel in der Prager Botschaft. Auch Bilder können Floskeln werden, die mehr verstecken als erhellen. Im Herbst 1989, sagen diese Bilder, waren die Deutschen begeistert.

Alle Deutschen? Die Stimmung im Westen war viel schwankender. Im September waren aus der DDR schon Zehntausende in den Westen gekommen. Es fehlten Wohnungen und Jobs. Laut einer Umfrage meinte fast die Hälfte der Westbürger, das Boot sei jetzt leider voll und die Ostler sollten bitte in Plauen und Güstrow bleiben.

Ein paar Wochen nach dem Mauerfall ventilierte Oskar Lafontaine, ob DDR-Bürger weiterhin ein Anrecht auf Sozialleistungen haben sollten. Damit fördere man ja deren Abwanderung. Der SPD-Chef wollte, zumindest für eine Weile, zwei Staatsbürgerschaften. Lafontaine wollte die DDR genau in dem Moment faktisch anerkennen, in dem die SED politisch und die DDR wirtschaftlich kollabierte.

Er spekulierte auf das Gefühl der Westler, von den Habenichtsen aus dem Osten überrannt zu werden. In seinen Reden erschien die Einheit eher als unvermeidliches Übel. Die Grünen rangen sich widerwillig im Frühjahr 1990 – noch nach der SED/PDS – dazu durch, anzuerkennen, dass die Zweistaatlichkeit Geschichte war.

Keine Hürde für Europa

Die Erklärungen von Sozialdemokraten und Grünen bezeugen, 30 Jahre später gelesen, Realitätsblindheit. Warum diese Irrtümer? Der Historiker Timothy Garton Ash hat die Unfähigkeit der SPD im Herbst 1989 mit der erstarrten Ostpolitik erklärt.

Die SPD war demnach auf die SED-Führung und die Politik kleiner Verbesserungen fixiert und nahm die Bürgerbewegung nur als Störung wahr. Die späte Ostpolitik zeigt in der Tat Wahrnehmungsblockaden einer Politik, die auf Verständigung mit den Macht­eliten einer Diktatur verengt war. Allerdings waren die Grünen eng mit der Bürgerbewegung verdrahtet – und hatten ähnliche blinde Flecken.

Die westdeutsche Linke versagte 1989 komplett: moralisch, analytisch und politisch. Moralisch gab es keine Rechtfertigung dafür, dem DDR-Volk, das sich gerade befreit hatte, vorzuschreiben, in welchem Staat es zu leben hatte. Warum sollte Selbstbestimmung in Tibet und der Westsahara gelten, aber nicht zwischen Rostock und Görlitz? Zudem hatte die DDR laut Grundgesetz-Artikel 23 misslicherweise das Recht, der Bundesrepublik beizutreten.

Politisch hechelte die Linke dem Geschehen hinterher. Kohl setzte zügig die Währungsunion um. Dazu gab es angesichts des Abwanderungsstroms von Ost nach West keine realistische Alternative. Doch Lafontaine war überzeugt, dass die Währungsunion ein Fiasko würde und Kohl, der Nationalist, von seinen haltlosen Versprechungen eingeholt würde. Auch die atemlose Kritik, dass die deutsche Vereinigung die europäische zerstören würde, war falsch. Kohl setzte die Einheit zusammen mit Paris, London, Moskau und Washington ins Werk. Die deutsche Einheit war keine Hürde für Europa – im Gegenteil.

Gegen den Kapitalismus

Nach dem 9. November zeigte sich das geistige Kleingärtnertum der politischen Linken. Sie war fasziniert von Revolten gegen Autokraten – in dem Moment, in dem eine Revolution vor ihrer Haustür passierte, war sie schnell irgendwie beleidigt. Eine Epoche ging zu Ende. Die radikale Linke nahm übel, weil die Ossis genau das wollten, was sie ablehnte: Parlamentarismus und Kapitalismus. Viele Sozialdemokraten und Grüne klammerten sich an ihre eingravierte Überzeugung, dass es zwei deutsche Staaten geben müsse, und mäkelten, dass Kohl wieder alles falsch mache. Aber Kassandra gewinnt keine Wahlen.

Warum dieses Versagen? Es wurzelte nicht in der Nähe zum SED-Regime, sondern tiefer. Es gab in der Linken zwar eine kleine Strömung – um Rudi Dutschke, Tilman Fichter und Peter Brandt – die die Einheit als linkes Projekt verstanden. Doch das Gros hielt das für einen bizarren Spleen.

Die meisten Linken verstanden die Teilung irgendwie als gerechte Strafe für die NS-Verbrechen. Das war historisch Unsinn: Die innerdeutsche Grenze war, wie jedes Schulkind wissen konnte, Resultat des Kalten Krieges. Aber unser Gefühl sagte etwas ­anderes. Wir waren, manche insgeheim, manche ­offen, froh, dass die Mauer die fatale Geschichte des deutschen Nationalstaates beendet hatte.

Bundeshauptstadt Bonn 04.jpg

Ich will die neue Kanzlerin werden. Mein Hab und Gut habe ich mitgebracht.

Und gab es dafür nicht auch solide, vernünftige, moralische Motive? Der Historiker Hans Mommsen hatte 1981 eine historische Einordnung des bundesrepublikanischen Selbstgefühls skizziert. Wie in Österreich gebe es in der Bundesrepublik das Bewusstsein, etwas Eigenes geworden zu sein. Der Bismarck’sche Nationalstaat sei Geschichte und die Deutschen seien angesichts der Katastro­phen des 20. Jahrhunderts besser in mehreren Staaten aufgehoben.

Die westdeutsche Linke war postnational – und damit Avantgarde. Die Hälfte der unter Dreißigjährigen im Westen empfand die DDR 1987 als Ausland. In einem CDU-Programmentwurf von 1988 kam die Wiedervereinigung nicht mehr vor. Hatte nicht auch Helmut Kohl 1981 festgestellt, dass „die verlorene Einheit im Sinne eines alten Nationalstaates nicht mehr wiederherstellbar ist“?

Quelle          :        TAZ         >>>>>        weiterlesen

———————————————————————

Grafikquelle          :

Oben       —          Lafontaine Fotomontage:

Die Fotomontage stammt aus der Projektwerkstatt


Virtuelle Projektwerkstatt von SeitenHieb Verlag steht unter einer Creative Commons

——————————

2.) von Oben    —           DL / privat  – CC BY-SA 3.0

———————–

Unten         —        Die Bundesumweltministerin Angela Merkel am Stresemannufer hinter dem Plenarsaal der ehemaligen Bundeshauptstadt Bonn beantwortet einem Fernsehteam deren Fragen. Im Hintergrund ist das Abgeordnetenhochhaus Langer Eugen zu sehen. Fotografische Impressionen von Andreas Bohnenstengel während der Parlamentarischen Woche im Juni 1995 in: Der Dreizehnte Deutsche Bundestag. Innenansichten unseres Parlaments. ISBN 3-87576-357-2

Abgelegt unter Nordrhein-Westfalen, P. DIE LINKE, Positionen, Überregional | Keine Kommentare »

Machtkampf in der CDU

Erstellt von DL-Redaktion am 2. November 2019

Hier zittert das schlechte Gewissen von christlichen Parteimitglieder – Innen seiner Wege.

Von Anja Maier

Die Parteivorsitzende Annegret Kramp-Karrenbauer wankt, im Fernsehen ätzt Friedrich Merz, die Kanzlerin reist nach Indien. Was ist los in der CDU?

Am Mittwoch der zurückliegenden Woche erschien in der Frankfurter Allgemeinen Zeitung ein Namensbeitrag des CDU-Generalsekretärs. Das Blatt gilt seit etlichen Jahren als die geeignete Plattform für Konservative; wer der Unionspartei etwas mitzuteilen wünscht, findet hier seine Zielgruppe.

1999, vor genau zwanzig Jahren, hatte ebenfalls in der FAZ eine andere CDU-Generalsekretärin – Angela Merkel – gefordert, die Partei möge mit ihrem Ehrenvorsitzenden Helmut Kohl brechen. Ihr Text – Aufmacher auf Seite 2, Ressort Politik – war überschrieben mit „Die von Helmut Kohl eingeräumten Vorgänge haben der Partei Schaden zugefügt“.

Der Beitrag markierte den Aufbruch der Christlich Demokratischen Union ins 21. Jahrhundert. Und er ist bis heute die Folie für die Erzählung von der harmlos wirkenden, tatsächlich jedoch männermordenden Angela ­Merkel. Es ist diese Erzählung, die bis in die ­Gegenwart Männer – junge, ältere, alte – zur Rache anspornt.

Der diese Woche erschienene Text von Paul Ziemiak für die FAZ – Aufsetzer auf Seite 8, Ressort Zeitgeschehen, Rubrik „Fremde Federn“ – trägt den Titel „CDU und Linke sind wie Feuer und Wasser“. Es geht diesmal nicht um Aufbruch, sondern um Schadensbegrenzung.

Ziemiak schreibt, es könne ja sein, dass „manche“ eine Zusammenarbeit von CDU und Linke gut fänden. „Ich könnte das nie.“ Politische Mehrheiten ergäben sich eben nicht nur aus dem Addieren von Mandaten, sondern aus der Summe gemeinsamer Überzeugungen. „Das gibt es mit der Linkspartei nicht.“

Die Klarstellung war nötig geworden, weil es nach der Landtagswahl in Thüringen heftige Abweichbewegungen von der Parteilinie gegeben hatte, was wiederum die Vorsitzende der Bundes-CDU bedenklich ins Rutschen bringt.

Thüringens Landeschef Mike Mohring – minus 11,7 Prozent – war mit seinen Christdemokraten von Platz eins auf Platz drei abgerutscht. Gleichwohl verspürte er „einen Auftrag, verantwortlich mit dem Ergebnis umzugehen“, also Machtoptionen mit Bodo Ramelow auszuloten. Und dann sprach er auch noch diesen epischen Satz: „Ich brauche nicht Berlin, um zu wissen, was für Thüringen nützlich ist.“

Berlin – das ist für LandespolitikerInnen der CDU das Konrad-Adenauer-Haus. In dem futuristischen Bau in der Klingelhöferstraße sitzt die Parteizentrale, dort haben die Vorsitzende und ihr Generalsekretär das Sagen.

Ebendieser Generalsekretär Paul Ziemiak hatte noch am Sonntagabend, unmittelbar nach Bekanntwerden der ersten Prognosen klargestellt: „Unser Wort gilt auch nach den Wahlen: Es wird von der CDU keine Koalition mit der Linkspartei oder der AfD geben.“

You were not dear (25398157868).jpg

Die Folgen des  Klimawandel ! Der Merz kommt Ende Oktober und die Krampe sendet Nachtfrost. Schnell weg – Indien ist wärmer.

Was im Laufe der nächsten Tage folgte, ist hinlänglich bekannt und fühlt sich für interessierte BeobachterInnen an, als habe sich die CDU die Aufführungsrechte bei den SozialdemokratInnen besorgt. Das Drama ist noch nicht zu Ende.

Nicht ausgeknockt

Aber was man jetzt, quasi in der Pause, festhalten kann, ist dies: Annegret Kramp-Karrenbauer ist massiv angegriffen worden. Sie ist angeschlagen, sie wankt. Aber sie ist nicht ausgeknockt. Denn sie hat sich gewehrt und zum taktischen Gegenschlag ausgeholt.

Der Reihe nach. Am Montag nach der Thüringenwahl gibt es Knatsch im Bundesvorstand, weil Mike Mohring nicht einsehen will, warum er nicht einfach mal mit dem Bodo reden sollte. Ziemiak weist, völlig zu Recht, auf den geltenden Abgrenzungsbeschluss der CDU hin; dann wird es unübersichtlich.

Vorstandsmitglieder fordern einen sofortigen Beschluss, der das ohnehin Beschlossene einfach noch mal bekräftigt. Die Parteivorsitzende und die Kanzlerin sollen dies laut Bild-Berichterstattung als überflüssig abgelehnt haben. Woraufhin Tilman Kuban, Vorsitzender der Jungen Union, mal eben fordert, hier und jetzt die Führungsfrage zu klären.

In der anschließenden Pressekonferenz mit Mike Mohring wagt Kramp-Karrenbauer dann die Vorwärtsverteidigung. Sie weiß, dass aus der CDU-Gremiensitzung eh alles an die Medien durchgestochen wird, sie spricht vom „Liveticker“. Also sagt sie, sie habe bekanntlich vor Jahresfrist das Rennen um den Parteivorsitz gewonnen und stehe deshalb in der Verantwortung. Wer meine, es besser zu können, möge auf dem Parteitag in drei Wochen einen entsprechenden Antrag stellen.

Und dann tritt Merz auf

Quelle         :         TAZ      >>>>>          weiterlesen

Grafikquellen          :

Oben             —         Bootsflüchtlinge mit einem sich nähernden Schiff der spanischen Küstenwache

 —————————————-

Unten      —        Bundeskanzlerin Deutschland Federal Chancellor Germany

 

Abgelegt unter Deutschland, International, Regierung, Wirtschaftpolitik | Keine Kommentare »

Sexismuskritik -+- Wedding:

Erstellt von DL-Redaktion am 1. November 2019

Das „viertcoolste“ Stadtviertel der Welt

File:Strassenschild luederitzstr berlin.JPG

Ist es nicht eine alte Tradition der Politiker – Innen, ehemalige Mörder und Verbrechen durch  Benennung von öffentlichen Plätzen und Straßen im Gedächnis  einzuzementieren.  Motto wir sind heute soooo viel besser !!

Quelle      :         Untergrund-blättle CH.

Von    lcm

Vor gut einem halben Jahr, es war die Nacht zum 8. März, zogen wir durch die menschenleeren Strassen im Wedding, um uns zur Feier des Tages einen Teil des öffentlichen Raums anzueignen.

Wir sind eine Gruppe organisierter Frauen aus dem Wedding, die anlässlich des Frauenstreiks verschiedene Aktionen in ihrem Kiez durchgeführt haben. Eine davon die Umbenennung von Strassennamen.

Es gibt knapp 10.000 Strassen in Berlin. 90 % der nach Personen benannten Strassen tragen männliche Namen. In anderen Städten sieht das Verhältnis genauso aus. Keiner dieser Namen ist zufällig gewählt, die Strassenbenennung ist eine Würdigung und ein unübersehbares Gedenken an diese Person. Gedacht wird allerdings fast ausschliesslich Männern, darunter auch so besondere Schätze wie Axel Holst, ein SS-Sturmführer oder Adolf Lüderitz, ein Kolonialherr. Gleichzeitig werden Frauen in der Geschichte und im öffentlichen Raum systematisch unsichtbar gemacht, obwohl es zahlreiche tatsächlich verdienstvolle Frauen gibt.

Anlässlich des Frauenstreiks in Berlin haben wir mehrere Strassen, die jeweils einen Mann würdigen, umbenannt. Wahlweise in Elise-Hampel-Strasse, Stephanie-Hüllenhagen-Weg oder auch Luise-Kraushaar-Allee. Sie alle waren NS-Widerstandskämpferinnen, die zum Teil auch im Wedding gelebt haben. An jedes Strassenschild befestigten wir ausserdem einen Steckbrief zur Person und der Erklärung, warum diese Strasse nun einen Frauennamen trägt. Die Müllerstrasse, die so etwas wie die Hauptstrasse im Wedding ist, benannten wir ausserdem in „Müllerinnenstrasse“ um.

Mit der einsetzenden Morgendämmerung fielen wir zufrieden in unsere Betten. Die Aktion war geglückt. Das böse Erwachen kam dann einige Monate später in Form eines Grossflächenplakats, prominent platziert auf dem Mittelstreifen der Müllerstrasse. Auf ca. 2×3 Metern war da ein Foto der von uns umbenannten „Müllerinnenstrasse“ zu sehen. Unsere Kritik war plötzlich Teil einer Kampagne der StandortGemeinschaft Müllerstrasse e.V., gefördert vom Bundesministerium des Innern, für Bau und Heimat sowie der Berliner Senatsverwaltung für Stadtentwicklung und Wohnen. Kannste dir nicht ausdenken.

Nun ist es sicherlich kein neues Phänomen, dass Systemkritik verwertbar und warenförmig gemacht wird. Auffällig ist aber, dass man sich derzeit besonders gern mit feministischen Attitüden schmückt. Sexismuskritik sells. Da werden im Sweathsop produzierte Shirts mit frechen feministischen Sprüchen verkauft, einer der bekanntesten Hersteller für Rasierer ruft zur „Selflove-Challenge“ auf, weil Frauen sich doch so mögen sollen wie sie sind (nur bitte ohne Haare unter den Achseln!) und „Problemkieze“ bekommen mit gegenderten Strassenschildern ein hippes Image, um sie attraktiver für Investor*innen zu machen. Feminismus wird zur erfolgreichen Marketingstrategie.

Im Wedding taucht das Plakat ausserdem zu einem Zeitpunkt auf, an dem der Gentrifizierungsprozess so richtig an Fahrt gewinnt. Das internationale „Time Out Magazine“ erklärte jüngst den Wedding zum „viertcoolsten“ Stadtviertel der Welt und beschreibt den Kiez wie folgt: „This neighbourhood in north-west Berlin feels warm and inviting, with street markets and sprawling public parks frequented by young families and long-time residents alike. Striking Weimar-era architecture contrasts with the harsh lines of former factories – a hangover from Wedding’s history as a working-class district in West Berlin“. Dazu ein Titelbild, das ausschliesslich weisse, adrett gekleidete Menschen zeigt, die gemütlich im Nordhafenpark sitzen. Man könnte lachen, wenn es nicht so traurig wäre.

Vor ein paar Tagen hat dann noch das Projekt Mietenwatch seine Studie veröffentlicht, bei der 80.000 Wohnungsangebote in 477 Kiezen in Berlin ausgewertet wurden. Das Ergebnis? Es gibt kaum noch bezahlbaren Wohnraum. Bezahlbar bzw. als „leistbar“ gelten Wohnungen, deren Gesamtmiete 30 % des Netto-Haushaltseinkommens nicht übersteigt. Für Haushalte mit niedrigem Einkommen sind Mieten aber bereits in dieser Höhe mit erheblichen Lebensqualitätseinschränkungen verbunden. Und damit hat Berlin gleich noch einen weiteren Weltlistenplatz belegt: Laut des „Global Residential Cities Index“ sind die Immobilienpreise in Berlin zwischen 2016 und 2017 um 20,5 Prozent gestiegen. Damit liegt die Stadt beim Preisansteig von Immobilien weltweit auf Platz eins. Glückwunsch.

File:Berlin Gesundbrunnen mit Stephanuskirche von Humboldthöhe.jpg

Die Studie von Mietenwatch zeigt ausserdem, dass der Verdrängungsdruck im Wedding am höchsten ist. Ob Humboldthain, Reinickendorfer Strasse, Leopoldplatz oder Soldiner Strasse – für Vermieter*innen ist es hier besonders lukrativ Altmieter*innen loszuwerden und die Wohnung danach teurer weiterzuvermieten. Ja, der Wedding kommt. Was lange Zeit ein Running Gag war, scheint nun bittere Realität zu werden. Die meisten von uns haben das bereits am eigenen Leib zu spüren bekommen und nervenzehrende Auseinandersetzungen mit der eigenen Hausverwaltung hinter sich oder stecken mitten drin.

Doch auch wenn all diese Dinge eine enormes Frustrationspotential bieten, wir werden weder die kapitalistische Ausschlachtung feministischer Kämpfe noch die Verdrängung aus unseren Kiezen akzeptieren. Gemeinsam kämpfen wir gegen den Ausverkauf der Stadt und unserer Kieze. Ob in Berlin oder anderswo: Der Aufbau von Gegenmacht hat gerade erst begonnen.

# Die Autorin Ella Papaver lebt in Berlin-Wedding und ist organisiert in der Kiezkommune Wedding

Soweit nicht anders angegeben und keine Quellenangabe (Name einer Organisation oder Internet-Adresse) vorhanden ist, gilt für die Texte auf dieser Webseite eine Creative Commons Lizenz (CC).

—————————————————————–

Grafikquellen          :

Oben            —          Straßenschild der Lüderitzstraße in Berlin-Wedding (Afrikanisches Viertel), benannt nach Adolf Lüderitz (1834-1886

Author Chrischerf  /    Source      –      Own work
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.

————————–

Unten            —         Panorama from the Humboldthain

Author Andreas Praefcke    /      Source     :     Own work
This file is licensed under the Creative Commons Attribution 3.0 Unported license.

Abgelegt unter Berlin, Kriegspolitik, Mensch, Regierung | Keine Kommentare »

Wege in den Extremismus

Erstellt von DL-Redaktion am 1. November 2019

Wo kommen nur all die Rassisten her?

Thilo Sarrazin030709.jpg

Und woher kam diese Knalltüte ? Natürlich aus einer politischen Partei, wie viele andere der völkischen Stimmungsmacher auch ! Das ist das Feld auf dem die Pflanzen groß gewählt werden.

Eine Kolumne von

Viele glauben, dass Deutschland seit 2015 einen Rechtsruck erlebe, aber das ist Quatsch. Den Grundstein für den Erfolg der AfD haben andere gelegt. Wir haben das Gelaber vom Aussterben der Deutschen viel zu lange zugelassen.

Menschen haben ja unterschiedliche Zeitrechnungen. Wir leben nicht nur im Jahr 2019 nach Christus, im Jahr 70 der Bundesrepublik oder 30 nach Mauerfall. Wir, die Menschen mit Kanakenhintergrund, wir zählen auch das Jahr zehn nach Sarrazin, kurz n. S.

Vor zehn Jahren gab Thilo Sarrazin, ehemaliger SPD-Finanzsenator in Berlin, der Kulturzeitschrift „Lettre International“ ein Interview mit dem Titel „Klasse statt Masse“ und plädierte, so kann man das lesen, unterm Strich für eine Einwanderungspolitik auf erbbiologischer Grundlage. Er machte so krude Aussagen wie: „70 Prozent der türkischen und 90 Prozent der arabischen Bevölkerung in Berlin“ lebten vom Staat und produzierten „ständig neue kleine Kopftuchmädchen“. Und Türken würden Deutschland per Geburtenrate „erobern“. Da seien ihm „osteuropäische Juden mit einem um 15 Prozent höheren IQ als dem der deutschen Bevölkerung“ lieber.

Nach der Veröffentlichung gab es eine wochenlange, bundesweite Debatte darüber. Das Absurde daran: Man war sich – trotz genetisch bedingter Intelligenzzuschreibung und kriegerischer Überfremdungsrhetorik – nicht einig, ob man das schon als „rassistisch“ bezeichnen kann. Noch mal: Man war sich nicht einig, ob das Rassismus ist. In Deutschland. 2009.

Wir angeblich Schlechtintegrierten mussten fassungslos mit ansehen, wie manche das als berechtigte „Polemik“ abtaten. Wir lasen nüchterne Faktenchecks zu den steilen Thesen und erfuhren die genaue Geburtenrate des Einwandererstammes der Türken. Ich arbeitete beim „Tagesspiegel“ und las in meiner Zeitung, Sarrazin habe „mindestens in der Tendenz recht“, was die Geburten angeht.

Die Debatte markiert eine Zäsur, weil sich damals zum ersten Mal zeigte, dass das Gerede von Überfremdung und „Islamisierung“ keine rote Linie überschritt. Sarrazin blieb damals ein gern gesehener Gast in Talkshows.

2010, im Jahre eins n. S., erschien das Buch „Deutschland schafft sich ab“. Es trug die Überfremdungsthese mal eben in die bürgerliche Mitte und machte Sarrazin zum Millionär. Und alles kreiste um die Frage: Wie viele „von denen“ verträgt unser Land.

H Hoffmann Struwwel 12.jpg

Von den Talkshows wanderte der Rassismus auf die Straße: 2013 traten erst die „Hooligans gegen Salafisten“ (HoGeSa), 2014 die „Patriotischen Europäer gegen die Islamisierung des Abendlands“ (Pegida) auf den Plan. Obwohl die Beziehungen von Pegida ins rechtsextreme Milieu bald offenkundig waren, war der Mythos vom „besorgten Bürger“ geboren. Zeitgleich zog die AfD ins Parlament: Im Jahr fünf nach Sarrazin holte sie bereits zehn bis zwölf Prozent der Stimmen bei den Landtagswahlen in Sachsen, Brandenburg und Thüringen.

Ich zähle das alles auf, damit klar wird: Uns, die Mitbürger mit Kanakenkontext, haben die Ergebnisse bei den Landtagswahlen in Ostdeutschland 2019 nicht überrascht oder schockiert. Wir stehen unter Dauerschock. Seit zehn Jahren.

Quelle        :         Spiegel-online               >>>>>           weiterlesen

———————————————————————-

Grafikquellen         :

Oben         —           Thilo Sarrazin am 3. Juli 2009

Unten       —        Der Struwwelpeter: Die Geschichte von den schwarzen Buben Tafel 4

  • Public Domainview terms
  • File:H Hoffmann Struwwel 12.jpg
  • Created: created 1858

Abgelegt unter Deutschland, International, Kultur, Regierung | Keine Kommentare »

Kritik ARD – „Tatort Luzern“:

Erstellt von DL-Redaktion am 1. November 2019

Wie der Sonntagskrimi Politik vermittelt

Quelle     :    Scharf  —  Links  

Filmkritik von Hannes Sies

Kann eine Krimiserie Propaganda für den Neoliberalismus und gegen WikiLeaks machen? Sicher, und das hat System. Der französische Soziologe Luc Boltanski thematisierte nicht ohne Grund den Krimi als ideologisches Konstrukt.

Ein Schuss, ein Schrei und „Alles Weitere nach der Obduktion“, so gehen TV-Kommissare allabendlich auf Mörderjagd. Eine wahre Institution im deutschsprachigen Fernsehen ist die „Tatort“-Reihe am Sonntag nach der Tagesschau. Deren letzte Folge „Elefant im Raum“ war unfreiwillig selbstentlarvend, fast komisch. Thema waren unabhängige Politblogs, mit Verweis auf WikiLeaks. Die Darstellung war tendenziös und sollte die Zuschauer offensichtlich gegen Politblogs einnehmen: Der Chef des fiktiven Blogs „Veritas“ (Wahrheit) wird als pomadig, sensationslüstern und arrogant inszeniert. Rücksichtslos publiziert er alles, was ihm im Netz anonym zugespielt wird, ist frech zum Kommissar und beruft sich lauthals auf die Pressefreiheit, wenn ihm der wackere Polizist Ohrfeigen und Kinnhaken verpasst.

Aus Sicht des Krimis geschieht Polizeigewalt gegen Journalisten meist völlig zu Recht, denn bei Mordermittlungen muss ja alles erlaubt sein. Der Kommissar bleibt der Held und wenn er mal wegen Kompetenzüberschreitung vom Dienst suspendiert wird, leidet der Krimifan mit ihm. Kämpft der Kommissar nicht gegen das Böse und für uns alle? Aber sicher doch. Dabei wurden jetzt sogar die feuchtesten Träume der korrupten Machtelite wahr, wenn in der Filmhandlung ein kritischer Enthüllungs-Journalist, der just miese Rüstungsgeschäfte aufdecken wollte, vorher von einem aufgehetzten Paranoiden attackiert wird. Vom wem aufgehetzt? Von einem kritischen Politblog. Genau wie im „richtigen“ Mainstream-Medienleben blieben im Krimi die nebenbei enthüllten Finanzschiebereien in karibischen Steuerparadiese nahezu folgenlos.

Wo unsere Medienelite mit ihren famosen „Recherche-Netzwerken“ in Panama-Papers & Co elitäre Schweinereien aufdeckt, bleibt nachhaltige Kritik an den Herrschenden aus: Täglich grüßt bei ARD & Bertelsmann das Murmeltier der Migrationsgefahr die skandalöse AfD. Täglich jagt man dort der immer größer werdenden rechten Hälfte der Bevölkerung Angst vor den Fremden ein, der schrumpfenden „besseren“ Hälfte Angst vor der AfD, also vor den „Populisten“. Und die Populisten, das bleibt dabei kaum je unerwähnt, lauern immer an beiden Extremen, Rechts wie Links. Besonders lauert die Gefahr Links, wo linksextreme Populisten eine gerechte Reichtumsverteilung fordern. Die grundlegenden Strukturprobleme von Macht und Finanzwelt, von ausbeuterischer Reichtumsanhäufung und prekärer Verelendung, werden so systematisch ausgeblendet und auf einzelne Skandale, am besten fern in Panama, reduziert. Würden unsere Medien eine Kampagne gegen Steueroasen so hartnäckig führen wie jene gegen Julian Assange und WikiLeaks, sie wären längst trocken gelegt und das Schattenbank-Unwesen reguliert. In der Schweiz ärgerte die Geldelite sich ja besonders über WikiLeaks-Enthüllungen zur mächtigen Traditionsbank Julius Bär.

Neoliberalismus-Propaganda im Sonntagskrimi

Die konservative Sichtweise des Tatort-Drehbuchs basiert vermutlich auch auf einer unbewussten (?) ideologischen Parteinahme für den Neoliberalismus. Hätten die Drehbuch-Autoren nur gelesen, was der französische Soziologe Luc Boltanski in seinem inspirierenden Werk „Rätsel und Komplotte: Kriminalliteratur, Paranoia, moderne Gesellschaft“ geschrieben hat. Der Krimi als Literaturformat entstand laut Boltanski mit dem Niedergang von Kirche und Adel, mit dem Aufstieg der bürgerlichen Nationalstaaten. Der Krimi ist heute ein wichtiges Ritual zur Feier einer neuen Religion des Nationalstaats: Der „Tatort“ als Ersatz für das Abendgebet. Der Staat, nicht mehr König und Kirche, sorgt heute für den Sinnzusammenhalt der Realität.

Im Krimi dringt das Bedrohliche, das Rätsel, die Störung, als Verbrechen in diese staatliche Realität ein. Aber die staatliche Ordnung wird rituell durch Aufklärung, Verhaftung oder Beseitigung des Verbrechers wieder hergestellt und gefeiert. So weit, so gut. Doch im bürgerlich-kapitalistischen Staat gehört zu dieser Ordnung vor allem auch der Markt in allen Konsequenzen: Ungerechte Verteilung, Formierung einer Geldelite, Vereinzelung und Entrechtung der Masse der Bevölkerung. Die Sozialwissenschaften könnten diese Ungerechtigkeiten analysieren, kritisieren und eine soziale Politik fordern (womöglich sogar eine sozialistische). Doch die ideologische Dominanz des Neoliberalismus macht Kritik am Markt und an einer aus ihm entstehenden Klassengesellschaft zunehmend schwer.

Boltanski macht den Neoliberalismus an einem seiner mächtigsten Klassiker fest: An Sir Karl R. Popper, der den Begriff der „Offenen Gesellschaft“ prägte (die den angeblich „geschlossenen“ Gesellschaften sozialistischer Länder gegenüber stehe). Popper inspirierte damit nicht nur Multimilliardäre wie George Soros, der mit seiner milliardenschweren „Open Society Foundation“ weltweit für die Öffnung von Märkten für das Kapital arbeitet. Popper Einfluss auf die Wissenschaften, die Medien und die westlichen Gesellschaften geht tiefer.

Luc Boltanski schreibt in seinem Buch „Rätsel und Komplotte“ einem Grundsatzvortrag, den Popper 1948 in Amsterdam hielt, eine verhängnisvolle Wirkung für die Entwicklung der Sozialwissenschaften zu. Popper habe dort in seinem Eifer, den Marxismus mit dem Faschismus in einen Topf zu werfen und beide als „Historizismus“ zu verdammen, allen Sozialwissenschaften, insbesondere aber Ökonomie, Soziologie und Geschichtswissenschaft, Scheuklappen angelegt. Poppers individualistischer Ansatz lehnt soziologische Begriffe ab, welche Gruppen oder soziale Strukturen als eigenständige Entitäten bezeichnen, insbesondere den marxistischen Begriff „Klasse“.

Poppers Fluch: